This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb12987. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb12987 |
| Sequence | KAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 1 (neuropedia) |
| Link to Source | neuropedia_733-P01355, |
| Major Functions | 1 (cell-cell communication,) |
| Sub-functions | NA |
| Additional Info | NA, |
| Helix (%) | 0 |
| Strand (%) | 0 |
| Coil (%) | 63.6 |
| Turn (%) | 36.4 |
| DSSP states | CCSTTCCCCCCCCTTSCSSCCCCSSCCCCSSCC |
| Tertiary Structure (Technique) | View in Jmol  OR Download Structure (I-TASSER) |