This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb16988. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb16988 |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 4 (brainpeps, hmrbase, neuropedia, parapep) |
| Link to Source | brainpeps_7, hmrbase_11242, neuropedia_349-P06850, neuropedia_791-P01143, parapep_1329, parapep_1330, |
| Major Functions | 4 (antiparasitic, cell-cell communication, antimicrobial, drug delivery vehicle,) |
| Sub-functions | antitrypanosomic, hormones, blood brain barrier |
| Additional Info | neuropeptide, |
| Helix (%) | 80.5 |
| Strand (%) | 0 |
| Coil (%) | 17.1 |
| Turn (%) | 2.4 |
| DSSP states | CCCSCHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Homology based) |