This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb18160. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb18160 |
| Sequence | KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 3 (apd2, camp, phytamp) |
| Link to Source | apd2_AP02041, camp_CAMPSQ3943, phytamp_PHYT00056, |
| Major Functions | 4 (antibacterial, toxic, antimicrobial, antifungal,) |
| Sub-functions | anti-gram+, cytotoxic, anti-gram-, antiyeast |
| Additional Info | NA, |
| Helix (%) | 37.8 |
| Strand (%) | 13.3 |
| Coil (%) | 15.6 |
| Turn (%) | 33.3 |
| DSSP states | CEEESSHHHHHHHHHHTTTSCHHHHHHHTTEEECSSSSCCTTSCC |
| Tertiary Structure (Technique) | View in Jmol  OR Download Structure (Experimentally determined structure from PDB) |