This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb18459. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb18459 |
| Sequence | [LL-37, 37 aa] |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 7 (apd2, avpdb, baamps, cancerppd, hemolytik, parapep, yadamp) |
| Link to Source | apd2_AP00310, avpdb_AVP1245, avpdb_AVP1922, baamps_124, baamps_2, cancerppd_5002, cancerppd_5004, cancerppd_5006, hemolytik_2452, hemolytik_2699, hemolytik_3066, hemolytik_3952, parapep_1295, parapep_1296, yadamp_1573, |
| Major Functions | 7 (anticancer, antibacterial, antiviral, antiparasitic, toxic, antimicrobial, antifungal,) |
| Sub-functions | hemolytic, anti-gram+, cytotoxic, antitrypanosomic, anti-gram- |
| Additional Info | chemotactic, antibiofilm, wound healing, |
| Helix (%) | 81.1 |
| Strand (%) | 0 |
| Coil (%) | 13.5 |
| Turn (%) | 5.4 |
| DSSP states | CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSCCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Experimentally determined structure from PDB) |