This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb19995. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb19995 |
| Sequence | YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY |
| C-terminal modification | Amidation |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 2 (dadp, parapep) |
| Link to Source | dadp_2270-SP_P80952, parapep_1346, |
| Major Functions | 2 (antiparasitic, antimicrobial,) |
| Sub-functions | antileishmania |
| Additional Info | neuropeptide, |
| Helix (%) | 50 |
| Strand (%) | 0 |
| Coil (%) | 36.1 |
| Turn (%) | 13.9 |
| DSSP states | CCCCCCCCSSCCCHHHHHTTHHHHHHHHHHHHHSCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Homology based) |