This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb20061. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb20061 |
| Sequence | MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 2 (cancerppd, parapep) |
| Link to Source | cancerppd_1239, cancerppd_1240, cancerppd_1241, cancerppd_1242, parapep_1364, parapep_1400, parapep_1402, |
| Major Functions | 4 (anticancer, antibacterial, antiparasitic, antimicrobial,) |
| Sub-functions | antiplasmodial, antitrypanosomic |
| Additional Info | lytic peptide, |
| Helix (%) | 78.9 |
| Strand (%) | 0 |
| Coil (%) | 18.4 |
| Turn (%) | 2.6 |
| DSSP states | CCCHHHHHHHHHHHHHHHHHHHHTCCHHHHHHHHHHCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Homology based) |