This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb20840. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb20840 |
| Sequence | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK |
| C-terminal modification | Amidation |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 3 (apd2, cancerppd, parapep) |
| Link to Source | apd2_AP00139, cancerppd_1317, cancerppd_1318, cancerppd_1319, cancerppd_1320, cancerppd_1329, cancerppd_1330, cancerppd_1331, cancerppd_1332, cancerppd_1341, cancerppd_1342, cancerppd_1343, cancerppd_1344, parapep_1246, parapep_1338, parapep_1407, parapep_1437, parapep_1438, |
| Major Functions | 5 (anticancer, antibacterial, antiviral, antiparasitic, antimicrobial,) |
| Sub-functions | antiplasmodial, anti-gram+, antitrypanosomic, antileishmania, anti-gram- |
| Additional Info | NA, |
| Helix (%) | 86.5 |
| Strand (%) | 0 |
| Coil (%) | 10.8 |
| Turn (%) | 2.7 |
| DSSP states | CHHHHHHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Homology based) |