This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb22492. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb22492 |
| Sequence | MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 2 (cancerppd, parapep) |
| Link to Source | cancerppd_1775, cancerppd_1927, cancerppd_2079, cancerppd_2231, cancerppd_2383, cancerppd_2526, cancerppd_2669, parapep_1399, parapep_1401, |
| Major Functions | 3 (anticancer, antiparasitic, antimicrobial,) |
| Sub-functions | antiplasmodial, antitrypanosomic |
| Additional Info | lytic peptide, |
| Helix (%) | 81.6 |
| Strand (%) | 0 |
| Coil (%) | 15.8 |
| Turn (%) | 2.6 |
| DSSP states | CCCHHHHHHHHHHHHHHHHHHHHTCCHHHHHHHHHHHC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Homology based) |