This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb25025. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb25025 |
| Sequence | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 5 (apd2, avpdb, baamps, parapep, yadamp) |
| Link to Source | apd2_AP00451, avpdb_AVP1241, avpdb_AVP1554, baamps_92, parapep_1355, parapep_1356, parapep_1424, parapep_1425, yadamp_1500, |
| Major Functions | 5 (anticancer, antibacterial, antiviral, antiparasitic, antimicrobial,) |
| Sub-functions | anti-gram+, antitrypanosomic, antileishmania, anti-gram- |
| Additional Info | NA, |
| Helix (%) | 0 |
| Strand (%) | 19.4 |
| Coil (%) | 33.3 |
| Turn (%) | 47.2 |
| DSSP states | CCCCTTTTTCEEESSSCCTTSCBCSCCSSTTSEEEC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Experimentally determined structure from PDB) |