This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb27556. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb27556 |
| Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 5 (apd2, avpdb, camp, parapep, yadamp) |
| Link to Source | apd2_AP00176, avpdb_AVP1553, avpdb_AVP2029, camp_CAMPSQ693, parapep_1144, parapep_1707, yadamp_1223, |
| Major Functions | 6 (anticancer, antibacterial, antiviral, antiparasitic, antimicrobial, antifungal,) |
| Sub-functions | anti-gram+, antitrypanosomic, anti-gram- |
| Additional Info | effector molecule of innate immunity, chemotactic, wound healing, enzyme inhibitor, host defense peptides, |
| Helix (%) | 0 |
| Strand (%) | 6.7 |
| Coil (%) | 63.3 |
| Turn (%) | 30 |
| DSSP states | CCCCCCSSSCTTCCCSSCCCBTTBCCCCCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Experimentally determined structure from PDB) |