This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb27605. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb27605 |
| Sequence | YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 2 (neuropedia, parapep) |
| Link to Source | neuropedia_631-P97297, parapep_1323, parapep_1324, |
| Major Functions | 3 (antiparasitic, cell-cell communication, antimicrobial,) |
| Sub-functions | antitrypanosomic |
| Additional Info | neuropeptide, |
| Helix (%) | 38 |
| Strand (%) | 0 |
| Coil (%) | 42 |
| Turn (%) | 20 |
| DSSP states | CCCCSCCSGGGCCCSSSSSSHHHHHHHHHHHHCCCCSSCCHHHHCCCCCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Homology based) |