This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb27887. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
Field/Function | Detailed desription |
---|---|
Peptide ID | satpdb27887 |
Sequence | GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR |
C-terminal modification | Free |
N-terminal modification | Free |
Peptide Type | Linear |
Type of Modification | S-linked glycopeptide |
Source (Databases) | 1 (apd2) |
Link to Source | apd2_AP01606, |
Major Functions | 2 (antibacterial, antimicrobial,) |
Sub-functions | anti-gram+ |
Additional Info | NA, |
Helix (%) | 43.2 |
Strand (%) | 0 |
Coil (%) | 24.3 |
Turn (%) | 32.4 |
DSSP states | CCCTTHHHHHHHHTTTTCCSSCSCTTTHHHHHHHHCC |
Tertiary Structure (Technique) | View in Jmol  OR Download Structure (Experimentally determined structure from PDB) |