This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb28068. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb28068 |
| Sequence | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 3 (apd2, camp, parapep) |
| Link to Source | apd2_AP00524, camp_CAMPSQ487, parapep_1357, parapep_1358, parapep_1426, parapep_1427, |
| Major Functions | 5 (antibacterial, antiviral, antiparasitic, antimicrobial, antifungal,) |
| Sub-functions | anti-gram+, antitrypanosomic, antileishmania, anti-gram- |
| Additional Info | chemotactic, wound healing, |
| Helix (%) | 14.6 |
| Strand (%) | 31.7 |
| Coil (%) | 26.8 |
| Turn (%) | 26.8 |
| DSSP states | CCBSHHHHHHTTCEEESSCCCTTCEEEEBCSSTTCEEEECC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Experimentally determined structure from PDB) |