Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_gilvum_Spyr1
Gene IDProtein IDProtein DetailsSequence
315446826YP_004079705.1 50S ribosomal protein L34 [Mycobacterium gilvum Spyr1]MAKGKRTFQPNNRRRAKVHGFRLRMRTRAGRAIVTARRAKGRRSLTA
315446824YP_004079703.1 hypothetical protein Mspyr1_53440 [Mycobacterium gilvum Spyr1]MSGRSAVVRAVVYVIQLYRHTISPLRLPTCRFTPTCSQYAVDALTEFGFF
RGSWLALIRLLKCGPWHRGGWDPIPERTSHSDATADGASCAAEVCDTADH
RVAPVQQGKSHTSVV
315446822YP_004079701.1 RNA-binding protein [Mycobacterium gilvum Spyr1]MTEIDSGAESTAAGTTDVLAAADEPGTTEGVGTSTEGAEVSTDGAEAPVE
DLEDRLVAEGEIAGDYLEELLDLLDFDGDIDLDVEGDRAVVSIDGGGDLN
KLVGRKGEVLDALQELTRLAVHQKTGERSRLMLDIAQWRRRRRDELAALG
DKVARRVLETGDREELSPMTPFERKIVHDAVAAVDGVHSESEGVEPSRRV
VILAD
315446820YP_004079699.1 chromosome segregation ATPase [Mycobacterium gilvum Spyr1]MSGSSDPGVAEESSTAPADSVSRETEGSRETDVSRETWNAQDVDTPIGAE
AARAVRLMQAAVQGQLPRPSRQRVFTIANQKGGVGKTTTAVNIAAALALQ
GLRVLVIDLDPQGNASTALGIEHRPGTPSSYEVLIGEIGVESALQQSPHN
ERLYCIPATIDLAGAEIELVSMVAREGRLRTALAELKHHDFDYVFIDCPP
SLGLLTINALVAAPEVLIPIQCEYYALEGVGQLLRNIEMVKAHLNPELDV
STVVLTMHDGRTKLADQVANDVREHFGNKVLRTVIPRSVKVSEAPGYGMT
IISYDPGSRGAMSYLDASRELALRGGTAQDEGGRDR
315446818YP_004079697.1 hypothetical protein Mspyr1_53380 [Mycobacterium gilvum Spyr1]MATRITPLRLEAFEQLPKHARRCVYWEVDPPVGGGGDQLADPEFEKEAWL
SMVMLEWGSCGQLAVECRTDPSDGEPLPVADDDPCLGYVFYAPPRSVPRA
VRFPTGPVSADAVLLTTLGIESGQNSDTLPHTLIAAVVADLVRRGVRALE
AFGRTAAASELTGLPSVPQDVLPVTEALGDCSVEQCVLDADLLMDAGFVV
VSHHTYFPRLRLELEQGLGWKAGVEAALERLLESAQLEQPVGAGAGVGV
315446816YP_004079695.1 thioredoxin [Mycobacterium gilvum Spyr1]MSDSSTVTVTDDSFSDDVLSSGTPVLVDFWATWCGPCKMVAPVLEEIASE
KAGSLTVAKLDVDENPATARDFQVVSIPTMILFKDGQPVKRIVGAKGKAA
LLREIADVV
315446814YP_004079693.1 hypothetical protein Mspyr1_53340 [Mycobacterium gilvum Spyr1]MGSGTDSTPDPETVTRLRRELAYLGSDTASAPEVPPAVTARITAALRDAS
GTHAVDRPVLSRSQRTGLVLGAAAVVAAVVLAVLTLGGDPEPQFPAGPTA
SQITVAPSFPLSEQDLWEVVAAAPDLGPLADPARLASCLAALGYPPTVEV
VGGRQLQVSGRPAILLALTGDDPDRVHAVAVGTGCGAGDSDLLAETTVRR
315446812YP_004079691.1 integral membrane protein MviN [Mycobacterium gilvum Spyr1]MPDARPEMSDRAVVSRSWGMAVATLVSRLTGFARIVLLAAILGAALSSAF
TVANQLPNMIAALVLEATFTAIFVPVLARAERDDPDGGAAFIRRLLTLAT
ALLLAVTIISTVGAPLLVNLMLGSEPLVNQPLTTAFAFLLLPQIIFYGLS
SVFMAILNTRNIFGPPAWAPVVNNVVAIATLGLYVLVPGELSLDPVRMGD
AKLLVLGIGTTLGVVAQAAVLFVAIRRERISLRPLWGIDARLKKFGMMAL
AMVLYVLVSQVGFIVGNQVASASAASGPAIYNYTWLILQLPFGIVGVTVL
TVVMPRLSRNAASGDGGAVLADLSLATRLTMLTLIPIVALMTVGGPAIGS
ALFSYGNFGAVDAGYLGMAITLSAFTLIPYTMVLLQLRVFYAREEPWTPI
VLIVVITIVKIAASLASPHLTDDPQLVAGYLGLANGLGFLAGATVGYLLL
RARLDPPGGHLVSRDVVRTILVTITASMAAGLIAHIADQLLGLEQLTEHW
GGGGSLIRLTVLGLVMCPIILGVLIAAKVPDALAGVAAVRRRLGARGAST
GSPVPQMSPPALTYADRSNRRGPSAETADDGRRKGSAVSDKPTSDSPSGP
NSTAPPSADDFQPDVPDSYQPDPAADDSATTALPAQGVPTESPTEAVKRP
RADYSNDPTREALAFDPPREPAIETATPAEDTHLIPGATIAGGRYRLLVS
HGGPEHLQFWQATDTALDRQVALTFVAPDATMPDQQVQGILDRTQRLSQI
DMPGVARVLDVLKTATGGLVVSEWIRGGSLAEVAATNPSPIGGARAIQSL
AAAAEVAHRNGVALSIDHPSRIRVSIDGDVALAFPATLPDATPDDDIRGI
GASLYALLINRWPLPETGEPSGLAPAELDAAGQPAEPRSIDRDIPFQISA
AAAHAVQEGGGIRSAPTLLNLLQQATAIADRTDHISPVDEPSPAAAADTS
WSADPEDAEEAAARRRRNLTIGLSVAGVIVVVAVILLATVLSRIFGDVGS
GLGGDELGLNAPSSSQTDSPSTATGSALEPVRATVFSPEGEADAPDAASL
AIDGDPSTVWPIDTYTDPVPFPNFKNGVGLMLQLSEPARIGSVTVNLNST
GTAVQIRSSSTATPSSLEDTTALTEPTTLKPGSNTIEVDDAEPTSYVLVW
VSTLGQVGGQSRSDIAEITLNAAS
315446810YP_004079689.1 ADP-ribose pyrophosphatase [Mycobacterium gilvum Spyr1]MRSGRVPPATIIAGVSDGEQAKPRRRRGRRRGRRAAGPPEAGTDQAPGAR
QQNPATRQQSSGAGTADQAGQPPKPQRTRTRRPQERLRTVHETSAGGLVI
DGLDGPKDSQVAALIGRVDRRGRMLWSLPKGHIEMGETAEQTAIREVAEE
TGIEGSVLAALGSIDYWFVTEGRRVHKTVHHYLMRFLGGELSDEDVEVTE
VAWVPLKDLPSRLAYADERKLAEVADELIDKLHTEGPGALPPLPHSAPRR
RGQTHSHTRKHRSDPSAQQQPGRRTNGCGQGP
315446808YP_004079687.1 hypothetical protein Mspyr1_53280 [Mycobacterium gilvum Spyr1]MEYCLSDLDGTATVWTAGPDTDLDGDGVFDAVALDLDDDGVIDDALLDLD
DDGTADHAARDLDGDGTPEAYFTDDGTGAWSVSADRIGAALRWFGLDGVE
HPASADAADLDGDGAPERLADTNGDGLADRAFGAGQAWVDTDGDGRWDVR
LADADGDGAAEAAEHLR
315446806YP_004079685.1 hypothetical protein Mspyr1_53260 [Mycobacterium gilvum Spyr1]MAAAAPLIAELRAESDELDALVADLTPQQWTLSTPAPGWTIAHQIAHLLW
TDRVAVLAVTDEARFADVVAASAHDSAFVDTAAAELAVLPPAELLADWRT
TRAALHDALLAVTDGRKLPWFGPPMSAASMATARLMETWAHGLDVADTLG
AVRIPTSRLRSIAHIGVRTRDFAFTVHGLTPPPEPFHVKLRAPDGSTWSW
GPEDADQRVEGSAEHFCMLVTQRRPRAALDVVATGHEAERWLTIAQAFAG
PPGAGRD
315446804YP_004079683.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MASPDDPEDYQDRAAPAAHRVRAGTMLLANTDLLEPTFRRSVIYVVEHND
GGTLGVVLNRASETAVYNVLPQWAKLAVKPKTMFIGGPVKRDAALCLGTL
RVGSDPVGVPGLRHVQGRIVMVDLDADPDELAPILEGVRIFAGYSGWTIG
QLEGEIERDDWIVLSALPTDVLVEPKVDLWARILRRQPMPLSLLATHPID
LSRN
315446802YP_004079681.1 lipoprotein LpqN [Mycobacterium gilvum Spyr1]MSESARHWRILAGGIGALAGIAGVLGVTSTASAQPAVPQPTVPQPVIPQA
SIPQVSVPAPAAVASAVPAAANALPAAAPVAPAVPPAPRPPTIVPATSGT
LAEFFAAKGVTLEPQNSRDFRALNIVLPMPRGWELIPDPNVPNAFAVLAD
RVGGNGLYSSNAQVIVYKLIGQFDPREAISHGFVESQKLPAWRTTDASLA
EFGGMPSSVIEGTYRENNMTLNTSRRNVIATVGPDNYLVSLAVTTSVDQV
VAAADATEAIVNGFKVSVPGPAPVMPLPGAPALPLPAAAPQAPGAPAVAP
PPQLLGLQG
315446800YP_004079679.1 short-chain alcohol dehydrogenase [Mycobacterium gilvum Spyr1]MITGASGGLGSALADALAPTHTLFLAGRPSPRLDAVAERLGATTWPVDLA
DPDSMAAVVEPIVELDVLIHNAGVAYPGRVAESHVDEWRSTMAVNVVGAV
ALTLELLPALRAARGHVVFINSGAGINASPGLASYTASKFALRGFADSLR
ADEPTLRVTSVHPGRIATAMQEDLVAYEGRPYEPDRFLSPQTVARLTVDA
INAPADAHVHEVIIRPNPAPR
315446798YP_004079677.1 MarR family transcriptional regulator [Mycobacterium gilvum Spyr1]MVTTDAQVSELAGELQRVLSKLMSVMRHTGRTPTSGDLTLAQLSILLTLI
DQGPMRMTELAAHEKVRTPTTTVAIRRLEKLGLVKRDRDPSDLRAVLVDI
TPEGLAQHQEALAIRQAHLASLLGKLSCDELDALTKALAPLERIAE
315446796YP_004079675.1 amino acid ABC transporter substrate-binding protein [MycobacteriumMSCTRVLRPTVKTFALALIIGMVTAMGLAAPAGAQTDQCSPPGEQSASAL
PTNLAAAATGPAADKYTTATVTPLDAVDVDALGLSEPGTLTVGTLSDAPP
SICIDSSGQFTGFDNELLRAVADRLGLRINFVGTEFSGLLAQVASRRFDV
GSSSITTTDARRQTVGFTNGYDFGYFSLVVPKGSPITGFDELTAGQRIGV
VQGTVQEAYVIDTLKLQPVKFPDYNTVYASLKTGQIDAWVSPSQQAQGTV
QPADPVEIIENTFSLDNFIAWAVASDNQPLIDALNSGLDAVIADGTWSRL
YSDWVPRALPPGWKPGSKTAPTPELPDFTAIAAQNQDTGAPVAPAEPKST
LSQLAASFLDWDLYKQAIPDLFKTGLPNTLILTICASIIGLILGMALAIA
GISKSRWLRWPARVYTDIFRGLPEVVIILLIGLGVGPVVGHLTNNNPFPL
GIAALGLMAAAYVGEIFRSGIQSVDPGQLEASRALGFSYSTSMRLVVVPQ
GVRRVLPALMNQFISLLKASSLVYFLGLIANQRELFQVGRDLNAQTGNLS
PLVAAGLFYLALTIPLTHLVNYIDVRLRRGRRPDEKDPLVLATSQEMN
315446794YP_004079673.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMTSETSRPIRIGVQLQPQHSPRYDLMRDAVRRCEDIGVDVVFNWDHFFPL
YGDPDGAHFECWTMLGAWAEQTSRVEIGALVTCNSYRNPELLADMARTVD
HISDGRLILGIGSGWKQKDYDEYGYEFGTVGSRLDDLAAALPRIESRLSK
LNPQPVRDIPVLIGGGGERKTLRMVAQHAHIWHSFSDTETYPRKSEILAR
HCADVGRDPDAIERSAEAKGRTEDALLENAAALTSLGVSMLTVGVNGPDY
DLSQAETLCRWRDSHTAAG
315446792YP_004079671.1 hypothetical protein Mspyr1_53120 [Mycobacterium gilvum Spyr1]MSQPPAKRPLNKQDQSVRRAAGFPVRQWLKLGAASAGMGAALLGFSLLGP
ATGTAAADSTGDTSSAQSSSSAGDSPSGKPAGGADREAGATTSGSASADD
SDSETGTASRSRRDVRPADDEDAAEHDDIDTGDIDTGEAEDTEAAPQGAT
KPRAARLSGAAAEPAEEEQEQQQPAPPVKAPDWLAPRRARGETVSRIVDT
WTQRNQAWINSLNVSEARKAELAASFAQFKRTFLNQAPTLNPIQVTGLVS
GAITGRIEASDADGDRIVYRLAGNPREGSVVVNADGTYTYTPGANFDGVD
TFRVVALDAGSNLNLLDPLRGVGTSAVGLINQNAITFEFTYTGADWTEPR
QKALEDVAAGLLEYFRVDRPVTLTYAVRLEDPTDPERGLAAAGSDYISKL
PGYWPTVVQHKLQTGRDVNGAKTDGWITWNFADHKWALGDVVSAAEYDFT
AVAVHELMHSFGFLSSLGKPGSAQDLDLSVFDRFIVTARGTDPFVLGRWQ
RSNDPKLEGEDGGLYFGGPNAVLGYDGYLIPLFTPWEFKGGSSVLHFDDL
TFTGDRMKVMTAETPTGPSPRLFSAMEIGILRDLGYTVVSPQQPPYAPAA
LIGFVFLFRTRRK
315446790YP_004079669.1 hypothetical protein Mspyr1_53100 [Mycobacterium gilvum Spyr1]MRRWLHAGAVTAGMGAALLGFGVLAETATAAADPGSESASAGATNAGPSA
GEDGGSTAPDAATDADEAADADETDDEEAADEAADDDEAADDADAEESDA
EPVAVKPSTHRTKTDTAVEAAVAEQVSSTALPGRAATQPPYVSEQSAYEK
RVAEALAAWTQRNQEWVDSLDVTDERKERMQESFVAMRTTFFNQAPTIAP
VQITGVITGPVTGTIGAIDPDGDRLRYVITRAPATGTVKINADGTYTYTP
GAEFDGVDAFHVRAIDLGLHVNLLQLLRPLGSGRATSLVNQGAVTFDFDF
TTGSQYWTTPRREALQDAADDLVAYFRVTRPVTLTFEVEGSDNASSSTLA
SAGSGTISRDPGYWRTVVQNKLLGGEDSNGEEADGSINWNWGKGWEIGDE
VPSDKFDFRAVAIHELLHAFGFTSGTEEPGDRDRRHWYILDSFIVTRNGT
SPISSDFEWQEEFDGYLEGEDGGLYWGGSHAEDAYGGYVPIFTPDPWDEG
SSGAHLDDWTFNDGDEKLMNAATSRGPSVRTLSDIELGILTDIGYLVYAK
AD
315446788YP_004079667.1 acetyltransferase [Mycobacterium gilvum Spyr1]MPAHTTSLTVRSATEADWPAIGLIAATGFGMWRPDETVQVWRSMMPPDSV
VVACDGDEVVGVALFLDLQLTVPGGAVLPMAGVSFVAVAPTHRRRGALTA
MFNELHSRMGDYPIAGLEASEAGIYGRFGYGPATVWESVSVERERAQLRA
GVPDPGGVRIVRPAEHRAQLEDIDERWRLQTPGGLHTPARLWDEILEDRE
SLRGGGSALYCLLHGDGFAMYRVHNSDRRKDRAQVTKLAAATPQAYIALW
RTLLGLDLMATVDITTHPGALLPYLLTDARLVRTVDVQDGLWLRMLDIPA
VLQARTYDADVSVVLDVSDPVLDGGGRFAVEIRGGRASCVATDAPADVHT
DLSVLGSLYLGAHRASAFAAAHRLRCDDSTQLRALDAAFATDVPAELGYG
F
315446786YP_004079665.1 PadR family transcriptional regulator [Mycobacterium gilvum Spyr1]MLELAILGLLQESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQTDG
LIVEDSAPEGTVKVRRARRVYQLTESGKQRFTELVADTGPQNYSDDGFGV
HLAFFNRTPAEARMRILEGRRRQVEERREGLREAVARASNSFDRYTRQLH
QLGLESSEREVTWLNELIAAEKSAQGRAEQT
315446784YP_004079663.1 hypothetical protein Mspyr1_53040 [Mycobacterium gilvum Spyr1]MRLQRQVVDYALRRRSLLAEVYSGRTGVTEVCDANPYLLRAAKFHGKPSS
VMCPICRKEQLTLVSWVFGDHLGAVSGSARSAEELVLLATKYDEFSVHVV
EVCRTCSWNHLVKSYVLGAVPPPKGSRGPRRTQTARGTARTASE
315446782YP_004079661.1 integral membrane protein [Mycobacterium gilvum Spyr1]MTSPSPLGTDLRSLDSRDMPSRTDTLGAALSGTIGGPVGRHALIGRTRFM
TPLRVMLIIALVFLALGYSTKAACLQTTGTGTADQRVGNWENQRAYYQLC
YSDTVPLYTAELLNLGKFPYKSSWVETDAEGRPRVQYDGEPAVRYMEYPV
LTGLYQYLSMTVAKTYTALTKVVSIPVIAEVVMFFNIAALGLALAWLTTL
WATAMLAGPRRIWDAALIAASPIVIFQIFTNFDALATAFAACGMLAWARR
RPVLAGVLIGLGVAAKLYPLLLLIPLVLLAVRTGRVREAGKTVVAAVVAW
LAVNLPIMVLFPRGWSEFFRLNTRRGDDMDSIYNVVKSFTGWGGFDPDLG
FWEPPVVLNTVTAALFAACLIAIAYIVLTATRRPRVAQIAFLVVAAFLLT
NKVWSPQFSLWLVPLAVLALPHRRILLAWMTVDMLVWVPRMLYLFGEQRM
GLPEQAFTATVLLRDIAVITLCALVIRQIYRPELDLVRHGGVDDPAGGVF
DRAIDAPPKWLPDWLRPRPSSLTSLAPAGP
315446780YP_004079659.1 30S ribosomal protein S6 [Mycobacterium gilvum Spyr1]MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGSVDKVDIWGRRRLAY
EIAKHAEGIYAIIDVKAEPATVSELDRQLNLNESVLRTKVMRTEKH
315446778YP_004079657.1 30S ribosomal protein S18 [Mycobacterium gilvum Spyr1]MAKSSSTKRRPAPEKPVKTRKCVFCSKKGKNQVIDYKDTQLLRTYISERG
KIRARRVTGNCVQHQRDIAIAVKNAREVALLPFSSSTR
315446776YP_004079655.1 replicative DNA helicase [Mycobacterium gilvum Spyr1]MAVVDDRGRSGDRSDLEPPPSEDFGRQPPQDAAAEQAVLGGMLLSKDAVA
DVLEKLRPGDFYKPANQLVYDAILDLYGRGEPADAVTVAAELDRRGLLRR
VGGAPYLHTLISTVPTAANAGYYAEIVAEKSLLRRLVEAGTRVVQYGYAG
ADGADVNEIVDRAQAEIYDVTERKSSEDYVILEEILQPAMDEIDAIASQG
GISKGVPTGFTDLDELTNGLHPGQMIVVAARPGMGKALALDTPLPTPTGW
TTMAEVKVGDFLIGADGKPTRVVAATGVMVGRPCFEVEFSDGTVLVADAE
HQWLTETRASRRSAAIRTTREIAETLGFNHSVVNTAPLQGTAQDLLISPY
TLGAWLGDGASTAAQITTADPEILMRIEGEDRGLSGERLRTIGVLGDKHI
PMDYLRASEEQRRAVLAGLLDTDGTVTNGGSVQYTGTNSRLIGDVAELIV
SLGYRCQIAKKAVNGRSADSSVAYTINFSTDDVVFGLHRKAVLHKERRRS
ATTVRSGSRFITDVRPVPSVPVRCVEVDNEDHLYLAGRSMIPTHNSTLGL
DFMRSCSIKHQLPSIVFSLEMSKTEIVMRLLSAEAKIKLADMRSGRMNDD
DWTKLARRMSEISEAPLYIDDSPNLTMMEIRAKARRLKQKADLRLIVIDY
LQLMTSGKKVESRQQEVSEFSRQIKLLAKELEVPVVAMSQLNRGPEQRTD
KKPMLSDLRESGSIEQDADMVILLHRPDAFESDDPRGGEADLIVAKHRAG
PTRTVTVAHQLHLSRFSNMAK
315446774YP_004079653.1 integrase family protein [Mycobacterium gilvum Spyr1]MSDGLVRVSVGTRFIHDGELMQVVEMQAAATGTVVVLGPAIGGSTAVIRV
ALRELLDGGRARLLPDESGPQAGDDVDLAGVVFAAMSDFERNELNERAAH
VREVLTGYRSGSAELPAKDEPRDQYDPGISLTSRYTAKAAELDVSLRTIK
QWVSDFRRYGVAGLARKQSNRQKPLGNVDDVWGETALEVMVEHTDQSRPS
QSMVISRTNARVIARFGEGAVKIPSRATAYRVLAELENRHPTFRHSTKRN
RDIADRPSEAHGKLRPTRPGEYLLMDTTRLDVFALDPLTLRWVQAELTVG
MDWYTRCITGIRVTPVSTKSVDAAAVLYQAYRPRPAGTDWPAQAVWPEHG
IPRTVLLDAGAIEGSIRGAAGPAIVPETIVVDHGKIYVSEHLTSVCQRMG
ISIQPARLRTGRDKGPVERFFRTLRESLLQVLPGYKGPDVHSRGVDPESE
AFFYLDELEAIIREWVAAFYHHDPHESLRDPYAPGLLMSPAEMFEHGMAR
AGYIEAPRDPDLAYEFLNMQWRTIQHYGVDLGRRYNGSALNPYRNVTSPY
TGKAKGRWPIHYSPDDITRAYFRDPETRQWHTLTWEHAPSMNMPLSEDAM
TFARKLAAAKYTYPDDRLAIADLFERWNLGLGDTLAERRMALRLSRDAVL
LDELPSNKDVVALPSVARVLAATERPDESPSERVEEPDPETGDDDLDEDV
DELHAEDFEQDLDDFYADALEDA
315446772YP_004079651.1 regulatory helix-turn-helix protein- lysR family [Mycobacterium gilMSSVRTLPIRVAPVSGEALDSWLEAIAHRTNTMHADLLSAVGLKANKGMG
IGTWMVEPAANELQSLSIATSLRADLLESMVLQHYSERALRISPDGKALS
RTFPWGRGRGSRFCPQCLEETGGRWQLSWRLGWAFACTVHNCLLADACPE
CGVVQRLRTHIGDVVPQPGRCAHPARDAVGRAPERCGADLTAVSTVTFDA
KHPVVRAQQIINAVIESETAAFGVYRLHPQPRINVLSDIRAVAGRILAYA
TTEDLKATITPDLLVTHQSVDERQPRRYAPAQTDAKPGLAAPARAATAAV
GAVGAIDVLNSSDVFAAGDSLRWLIISSRDRGSAVSATNIAWGKNTTPVL
SAVQLAALGPLLKPSDQLRHRVGTALPNRPTADKRRAEVLAQGLPTMLWR
AWSLRMAIPDSHQRQLRPALSSALLLVNSRLNLDEAATMIDSPLDGHAVS
RVLQLLETQAQWDGLRLGLIRMADYLVDCRSPIDYRRRRQLDYSMLLPDK
VWTQICRDTGTPGVRSIRARIARSLLFERLSGLPASASSMFPDSNAFRTQ
VADFPRYLTTELHQALDKHAQEFLADQGVSGEPSVWEPPAALLDGLDLPG
DDPGKVQIKHLHRAATTDGIKMGATATLLNTSLDTVRYLLEIHPPPPPVR
SGTTPYNRAYVTAKAALPRERLLELYERQHMSLRDIAESVGVSRQVVGRI
ARDYDLALREPGLKARTIIERDWLHDQYVNKRRTLPDLAKETGMSTANMA
RWAKTHGIPLRARGGPSHSSAMAAADDAADAPELLRPVLAGVGGRERLER
FVAASSFSTLTAAAENLGIHQFTLVNQINRIERELATKLFIRAERGRPME
LTDDGERVVAAIRSYRDGSWP
315446770YP_004079649.1 histidine kinase [Mycobacterium gilvum Spyr1]MKTYRLEAGDDHVQKLAHENDPVRAVIELVWNSLDADAHHVTVVLHRNDT
DVVVGAEVTDDGHGMAPEDIATEFKWVGNSWKRTALRSKGERRPLHGRFG
QGRLRAFALGTQVTWETVGDRIDGKRVQTVIRARAISRTDVEVSDPIETS
VDTGTRFVGEGKESLDPLDREAAAERIGTTLAPYLISHTGVEVTYDGQRI
QPTDNIARDTLLPVEWEHDGTVHHAKLRVIEWFKAKERVVHLCDADAVVV
DTLDAAPGPDFTYSAYLLWDAMPEHHDQWPVARMETTPTVLGVLLKELDQ
VLDDYLDARRAERRRELVEEWKSGNVYPYEGEPSSEEEKVERATFDVVAT
SIRRHIPKEKSKKRLTLGLLKDSIQQRPGDVGALLDEYVGLPAEEREQLD
RLLRNTGLSRVIRASTDVTNRLEFLRALDLMVFDPEAHKMVGEREHLHRI
LERELWVFGEQYNFMVSERGLSAALDRHLELLGEARADKTPVKRLDGTVG
RLDLLLSAAATEHDRNRHLVVELKAPKVVASMAELNQIKSYAKAVAKDPR
FASSTTQWDFWLVTSELDDDVRQEANQRGREQGVVFEPDLPEAPGARVRV
WVRDWGQIINDAKRRLDYFQKSLQHDPSLEDARDYLRRNHGDVIPEGLLA
EGNAAPEACPAETQQPPPDAGAKSTASPIREE
315446768YP_004079647.1 type I restriction-modification system methyltransferase subunit [MMGESAGVLLTPSEIADLAGVTRGAVTNWRKRPSDPPFPDPAPESATKPLY
DLDKVIAWLAETKPEIQIQRDSGLAALSHSLNALRGRVSGSVAGEFALAL
CCAKKLSLEAVDANWRLIAAASPSQTADVLRRTATDAQWDDILSTLDDVE
RETNGRLDTLPIAAVVSAVDGIEPDRLAIAADEVLRRGSGERGRAAGYGV
GEHGIVNSRVSELLSNLASSTKGLVYDPACGIAEALVRTRTKRAGGGRLV
GHDINVRAIRIARMRSFLHELDAEFECADVLLEDPAPDLRADTVVAEPPF
GMDWSRSQNIADPRWAFGIPPANNSELAWLQHAIAHLKPEGSAYVVTSTA
PLTARGSSAAIRAELLRSGWIEAVILLPPKMLPHTTIPVALWVLRQADHP
SNTVDVLLIDASAAESPETHVLAWLDDCLNGSAVDAPPYALVTTLDLLAE
DAQLDPRRWVQTPGSDPKDVAARLSDSQRVLQNALASLLDRAVVQVPQGP
SAAPRLLTVKELVQLGVASIQNGRIKRDDLNEADAAVLITPSEVRDGLPV
LDELPTDGRPSLAGGRDERTRAGDVLVTTWNAVRAVVDEQGGRIIGSGVH
RLRVDDKQCEPHYVAQCLCGSWNERFKKGSSIQRVDLRDLEIPLVPLPDQ
ERLVEALREIEQLARHAAEVAEAAAASATAILDAVRYDAPMGDK
315446766YP_004079645.1 restriction endonuclease S subunit [Mycobacterium gilvum Spyr1]MPLPISDRWRRGQVKNVADVKLGKMLQSDDTGDDVQADYMRAANVQPDGA
LRLQPKQMWFKPSELEGLSLKRGDVVVVEGGVGGFGRAAYLPNDLDGWGF
QNSINRIRPTAATDGRFLAYYLIALRASGFIERYCNIVSMPHLTAEKLAA
LPVPVPDRSDQCAIADFLDRETARIDTLIAEQQLFVGLLRERRQAVIDST
VSVVKAEPVQLRRVIELVTSGSRGWGDYYSDAGVRFLRIGNLPRTDLAIR
GEVQLVDLPPDVTEGERTRLVVGDVLFSITAYLGSVAVVDDAWEGGYVSQ
HVALCRLDPLRANSRFVGWVMLTTDGQDQLRQGAAGGTKQQLGLDDIREL
RVPLPLLDEQHRIVAFLDEQTSKIDTLIAETKVFIELSRERRTALITAAV
TGQIDVRNEVA
315446764YP_004079643.1 translation initiation factor IF-2 [Mycobacterium gilvum Spyr1]MAGKARVHELAKELGVTSKEVLARLAANGNWVKSASSTVEAPVARRLREA
YGVPHPAPRSASDKGRQRAAGSIPTPLDVASGKAQRQRTATATSPQPKPA
GEKRQSSRLTSADALNIYRSYLLAVASENPSHAINDLFRECEARFGISRS
ALRQLVTSDKLRGLASGEARSTPPKDDAERTVRGTKPALATEVRRPMPQP
TGAVQQNSGAAGVKSRPAPIRPADALDIARQYLLAEASENPRKAIEELSA
GWKAKYGLSEARLRRIVARHKGRLAAQPNRRNAKSSTRNKEELKGQGAGG
AGATKSSLLKEVAAIGRPRERVPNLPRLTATIDLEAVADIVAGKSERQAD
REAILTCLRQFAPNRSGEYSYLTWRYDAIRPTHNEPRLTTAHQDLIALAV
VIDQERQLLDSLVRDHGSILTNPDLAEHGLEREFRRIVGTTQGTHSIDDR
LRSTRAAIDFLRRSVILTIASTGNGQSLWDLLGRLQPLTREPVETSLRLE
GARRRLSDQIGSVESLLSTNDAHLETFLRHSRASLAALQLKRYDFLRPFR
DSAVGLRALAHRATPDLAFQVLPQGEQLRKFLGEVRASKRYSGYRVDEHR
LTVLEDLQKHFGAHRCVWHRGSDSSDGIGIRYLVLAIKSDNGSGENAVAI
SPLAGRHATYVVRADCAEADWKTLFAYPKFEARLRGARKLLFTDNRGDTD
QYGAMRDKIIKLLECHPREFR
315446762YP_004079641.1 hypothetical protein Mspyr1_52820 [Mycobacterium gilvum Spyr1]MIEAQADSVRRMAVEQIDRFGYLVADVAYERWCAGLNAPIWREAFENPKV
LAFLDAEGYSAWLPVKEILMRRAALRGWLVYTQEPRSLRFGPTYLASTPK
KTAVRQPHELGRRIACSIGGFVSRRHRYPTADDLVMFIRNPDGTHLFRSG
SELTRNLPWLSVAGWVRYEGGEIRCGASAVAYDQERATRHHIKRELRLEA
RDHTEAGEGGDRAAFAASN
315446760YP_004079639.1 hypothetical protein Mspyr1_52800 [Mycobacterium gilvum Spyr1]MPPNGAEDVDRREPADARHRPKLSWTFALNGSEVGWLWQRNGDPPLDLLE
AVRTPTASALNRHIAVTAYSVTNDGTLALESGLEHDLLRRLDRDASVTRI
VAQPFRLSWRGGPPNKHIPDLFTVGKGGAVTVWDVRAPDQQDADFDVKAK
ITSVACAAVGWTYEMFGGLEPVERLNLLWLHGFRRRPSWAARCERQVLDI
ARAPRAVVRDVFAADSGSGELKSMMWHMVWSGALDIDLCRRWTLDTAIGP
HSMRAD
315446758YP_004079637.1 hypothetical protein Mspyr1_52780 [Mycobacterium gilvum Spyr1]MDPQLWHDYCTSVDAADPVPLSLRQWKRLSQVERRMHIDGLQRWISQLFI
ETEEMKGVTDAIANTLRRNKDSPPGAKEIFALSGPNAVGKSTFMMRWGRE
RYLQMITGAATDERGRTVMKLDDDCEADLCPVTWTHIPARAAVKVVNQLI
LGCYGLPGDGDVGQLTTNAVRAARRHGTQILIFDDVHLLYTDWKGGRFVL
DHIKHINTELGYTGTTLVLVGANIEDSVLVRDPQIAGRLTLKPLAPYQVH
TIDERRAWQGVVRQLEERVLPHLPAGEPGMLFLELAGELWLRTQGFLGDL
KTLVGEAVVAASEDGTHRIVREHLNRIELCARAEGTRRELAQPRRRSARS
TRTAPDDWGSAPDGQSAVSQTPQ
315446756YP_004079635.1 Helix-turn-helix protein [Mycobacterium gilvum Spyr1]MPTRPSQNNPERVAQWEHWRRLVGAMIRELRIARNMTQEALALRSGVTRN
VLIDVEHGRRGLLYERLFDIADALDVNVAELLP
315446754YP_004079633.1 hypothetical protein Mspyr1_52740 [Mycobacterium gilvum Spyr1]MADWWRSGATFRGFLDDRDEFWRSPDGQRLQAVHEAAEADLQAWLAEQPG
VVIHSHGGYVPEQWEGQVDGHSFYFRERDTEWDIEIDRRPSGWVMRSGDT
GNDDGTTPNQRDAIVEGDVIATGRTTAEGYGDSPRERAAFIVATIREHVT
RQACTHPGLEALAAVLGVPVRWCPTCGIRVRDQGVRREP
315446752YP_004079631.1 hypothetical protein Mspyr1_52720 [Mycobacterium gilvum Spyr1]MEWPGHGTQSRPWSTRNRQGNRDDRTLNVIEVSVPPFIASLHCDPIGNTA
RVLEDAVIAVAHLEAGFGQHLAPLADFLLRSESVASSKIEQIDAGWRAFG
KAVAGGKASDEARSQLAAVHALLALVEISSTGPVTLPAILQAHRLLMAAD
PYADSPGVLRTVQNWIGGSDFSPVGAVYVPPPPELVPELMDDLMAFAARS
DLPILAQAAIAHAQFESIHPFTDGNGRIGRALISAILRRRGLTRRVTVPL
TSAMLADTDHYFAQLTDYRKGAADQFIGYVAGAALHASQAAEETAARLAG
LPARWRDTARPRANSADETLLDNLLDVPIFNADTAQQLTGTTDASTYKAL
NRLTEAGILEVLSTGMRNRIWAASDILVELDVLSATIGRRTRASRSMNRD
EQN
315446750YP_004079629.1 hypothetical protein Mspyr1_52700 [Mycobacterium gilvum Spyr1]MQPCRFIAAILTGALAAACSSNAPDSAPPAIVPGMVHIHGLGINPSDETL
YVATHYGLYTAETDQAPQRVGDLVQDFMGFTITGPDEFLASGHPDPADRQ
QPPHLGLIKSSDAGRTWESLSLHGSADFHALEYRHGRVYGHDSQSGTVMV
SLDQKSWQRRAEIPASDLAVSPADADEILATTPQGLLRSTDGAMTFAAVT
DAPALVLVSWPQRGPLVGVSPEGTVYTSTDNGQTWQPRHTLNAKPQALLA
AGDGQVFIATHTAIYTSTDDGATVNVLTAVE
315446748YP_004079627.1 signal transduction histidine kinase [Mycobacterium gilvum Spyr1]MTPVPAATARRRQRRGRPGIGLRLLAAQAIVLVAGAATTAVVAAIVGPPL
FREHLHLAGVPMDSPEEVHAEEAYGYATVMSIGGALAVSALAALAVSFYV
SRRLQRSITEVASAATVVAQGNYEIRVSQPGLGDDFDALSTAFNQMASRL
QAVESTRQQLFGDLAHEIRTPVAVLEAYIEALEDGVRTLTPQTAAMLRDQ
TRRLVRFSNDVAALAKAEESSVSMSYATVDVDRLTRQCVAATQERYDIKG
VALRVRLQKALPPLWADEQRLSQVLGNLLENALRHTPSGGSVDVSCVREG
DRLRIAVADTGEGIAAEHLTRVFERFYRADTARDREHGGAGLGLAIAKAL
VEAHGGSISVTSAGLGTGATFTVDVPVAEVRADEYPVAGASARN
315446746YP_004079625.1 hypothetical protein Mspyr1_52660 [Mycobacterium gilvum Spyr1]MRWLMDVCPNSLGWQTWLILCAVVVVLWAAAIAGATALFHVSGRPCRSER
REALKEPVRSGHAGAD
315446744YP_004079623.1 transposase [Mycobacterium gilvum Spyr1]MLSEHGCQIAPRTFYAWLARPPSARALWDTVITEILAGFYEPDEHGRRKP
ESLYGATKMWAHLQRQGIAVARCTVERLMRANGWRGVTRRKKVHTTIADP
AAGRAPDLVDRQFRVPAPNVLLVADFTYVRLASGVFVYTAFAIDAYAGRI
VGWTCSAGKSDAFVRQAIRHAAQLRLNEGNPLSGNTIHHSDAGSQYTSLR
FGETLALSGLVASIGTVGDAFDNALAETTIGLYKTEAVRDDSPFRRGPLH
RLTDVELLTAEWVHWYNTDRLMHRLGRIPPIEYETVYYATNTARSEAAHQ
315446742YP_004079621.1 hypothetical protein Mspyr1_52610 [Mycobacterium gilvum Spyr1]MPQTGCPPAFRATTHWLRTTVLAVAVLLIAAACTSSPTAAPTPDVIVDKG
TPYADLLVPKLEASVTDGAIGVAVDAPVTVTAGDGVLSRVSLTNEAGELV
DGQLSPDGVTWSSAEPLGYNKQYTLQAQAQGLGGTASTNATFETHSPENL
TMPYVLPNDGETVGVGQPIAIRFDENITNRVAAQQAITVTTQPPVEGAFY
WLSNREVRWRPADYWDPGTTVEVSVKAYGVDFGDGLFGQDDVTTRFTIGD
KIVATADDASKTMTVRRNGEVVKTMPISMGKAKTPTDNGTYIIGDRYSFL
VMDSSTYGVPVNSPDGYRTEVEWATQMSYSGIYVHSAPWSVGSQGIANVS
HGCLNVNPANARWFYDNTRRGDIVEVINTTGPTLSGTDGLGDWNIPWEQW
KAGNANL
315446740YP_004079619.1 copper chaperone [Mycobacterium gilvum Spyr1]MSTIKYAVTGMTCGHCELSVREEVSEVAGVQGVEVSATTGTLIVTSSGPV
DDAQILRAVDEAGYSAVRVA
315446738YP_004079617.1 copper/silver-translocating P-type ATPase [Mycobacterium gilvum SpyMTTSTPVSGPSVELRIGGMTCASCANRIERKLNKIDGVAATVNYATEKAT
VTVPDGYDPALLIAEVENAGYSAALPTPEKLAPTGETGEIDDPDMVSLRH
RLTGSVLLSAPVIAMAMIPTLQFTYWQWASLVLAAPVIVWAAWPFHRAAW
ANLRHATATMDTLISLGTLSAFLWSLYALFFGTAGTPGMKHPFELTLAPS
HGAANIYLEVAAGVTTFILTGRYFEKRSKRQAGAALRALLEMGAKEVSVL
RDGAESKIAVEDLVVGDEFVVRPGEKIATDGVVASGTSAVDASMLTGESV
PVEVGPGDTVVGATVNAGGRLVVRATRVGSDTQLAQMAQLVENAQTGKAQ
VQRLADRISGVFVPIVLAIAVITLGAWLGAGFPIAAAFTAAVAVLVIACP
CALGLATPTALLVGTGRGAQMGVLIKGPEVLESTRKVDTVVLDKTGTVTT
GKMTLVDVVTAPGTERADLLRLAGALENASEHPIAQAIATAATEELGTLP
TPEDFANAEGKGVQGVVDGHAVVVGRESLLADWAQHLSPELVQAKSAAEA
QGKTVVAVGWDGQARGVLVVADTVKPTSAQAISQMRELGLTPVLLTGDNE
AVARQIAAEVGIDTVIAEVMPKDKVDVVVRLQAEGKTVAMVGDGVNDAPA
LAQADLGLAMGTGTDVAIEASDITLVRGDLRSAVDAIRLSRKTLSTIKTN
LFWAFAYNVAAIPVAALGMLNPMLAGAAMAFSSVFVVGNSLRLRGFKSTS
TSSAPTH
315446736YP_004079615.1 hypothetical protein Mspyr1_52550 [Mycobacterium gilvum Spyr1]MTHVDDADHCPASGSVHHGYITDKDKYLKRLKRIEGQARGISRMIEEERY
CIDILTQADALTKALQSVSLALLDDHIRHCVRDAAAAGGPAADAKLTEAS
EAIARLVRS
315446734YP_004079613.1 hypothetical protein Mspyr1_52530 [Mycobacterium gilvum Spyr1]MCRYPGAAVQCVGSAEIVDYDDADARRAFHAWWFSVASFPPRSASSLSVL
SCASSSPRPRRLLSTYGIGMSALATVRHPGGAIGRRDLTGGNYETEARDW
LLRGPASMHVVMVSVVV
315446732YP_004079611.1 hypothetical protein Mspyr1_52510 [Mycobacterium gilvum Spyr1]MPLSYALIGAAWALAATFAIVAVAWRTPRFDPAKPGRELPEWVSAVVDSP
AVRWIAAIAAAMFTVWVAIAAIWGPQGSDNALPGVFYVLLWVGLVAISVV
LGPIWRVISPVRTVWRLLHIGRRGAAPEEGRMQYRPGWGYWPGVIGLFAF
VWLELASSDPGSLTAIKIWILLYAVTMLAGAALFGTTWFARADPFEVYSV
TVSRLAPFRRNRTTGRIVLGNPLDHLPTMPVRPGTVAVMAVLLGSTAFDS
FSQSSVFSNFVTRNAAGIPLVGPSAGGTVLRSLGLLLFVLAVGVTFSAAA
RATAGVSREQRRQLPALLAHSLIPIVVGYIFAHYLSYLVERGQETIVRLA
DPLDRGWHLLGLDAADVQYVLSLNPTLLWTIKVASVVIGHMLAVIAAHDK
ALRVLPVGHQLTGQLAMMLTMVGYTFAGLYLLFGA
315446730YP_004079609.1 hypothetical protein Mspyr1_52490 [Mycobacterium gilvum Spyr1]MLKILLRIVGVLMVSGVVALLVSPSATAHVGAYIEGGEPGETGLITLRVP
AESDNPPTTKVEVRIPDDIQIRTVRPQPVAGWQLDIEKKKTNPTIYRDDG
TAVDEVVSSVTWTAVGPGLMPGQFDDFVLEAGPLPDVETLSLPTLQTFAD
GATDAWVEPAPEGSDPEFPVPTVTLGAGADSAPSGGSAMTSVIAWTALGF
AVIAVALGLFAIDRARRSADTGSLGAAPPPERSAVAE
315446728YP_004079607.1 Zn-dependent protease with chaperone function [Mycobacterium gilvumMTTGLWLMLYGTALAWAAPSLLGRLTKTGLSPQMGVAAWLTAIATTVIAW
VIALVLIGLAALDGLRNSSTVALCLELFGLSEHAGLPGLSGSIALTVAGS
AVSVIFVLRTGRSVARLRSRSREHANAVMLVGRPTTCPGVVVVDAPRPAA
YCVSGRPPAIVVTSAAWSSLGQSELAAVLAHEQAHIAGRHHQLLIMLRAA
ATALPRVPVMKQSAPAVAELLEMCADDAAARRHGVNSLLGGILAMADTHP
VPAEGLAAAGTATAARAMRLAEPTSSRARWTQRAVLGLAMTSMLGAPGLI
ELLCHH
315446726YP_004079605.1 cysteine synthase [Mycobacterium gilvum Spyr1]MSRALSIHSPSHMAVHHLRLRRFDRPGTMIGNTPVLRIGAPFSDDNSHGF
WAKLEGFNPGGMKDRPAMHMVERGRARGDLRAGGRIVESTSGTLGLGLAL
AGTVYGHPVTLVTDPGLEPIISRMLTAYGADVDVVTEPHPAGGWQQARRN
RVMEILESDPSAWYPDQYNNPDNVDAYRGLADELSAQLGTIDVLVCSVGT
GGHSAGVARVLRETNPDLRLIGVDTIGSTIFGQPAQSRLMRGLGSSIYPR
NVDYAAFDEVHWVAPAEAVWACRALASTHYASGGWSVGAVALVAGWVART
NPSSTTVAAVFPDGPQRYFDTIYNDDYCHSHGLLGGAPPRNPKVIADPRG
RIVTSWTRTSAVTDPTAVVPQ
315446724YP_004079603.1 hypothetical protein Mspyr1_52430 [Mycobacterium gilvum Spyr1]MDDDVDALADELARRLHLDGRSEAILFALRASLAAAGAESLNRRDRLLEV
MNSEIWPLLDDREPISKNERENILGLNPSTGA
315446722YP_004079601.1 hypothetical protein Mspyr1_52410 [Mycobacterium gilvum Spyr1]MTVTGERPEILLEDVDFNRRDHPDRPLRPIPPGRDHFAPQWRHMREVMFG
EWIDIDKEVEPSELTRLRDDYFWQRDELMIGVVDAFERIGHETGRALFEQ
ALTRGIDTLDDPPQEFVDLFAHLDGLAGEFDLVAAERGRMLAMSSTMAAT
TIIRGWALYETAMTGDISAATGATGRFADDGPRRNIETARVFAEFTLPDI
FDRQSEAFQDVVRVRLMHSLASRGLRRKWGDALYLKFGEPIPVTSLLGFG
SGMLLGRLVDHAFGRTLTRQQLEDLAEYSSYSGQLWGAPKQLRSPDGVEL
IKSLNYVLARGGNPSPWRAELVDAIASREHLEVLTDALPDWVRSVVSRYA
DQITATIAMASAGVVFGYEQIDAMVADTRFAKGFNFERRVRHFARFTKLN
VRLAIVVDRLPFSNPIRERRKKTGAAARERIAMLNKVAAGRQIPLTYTHH
DRSTSGEGFTG
315446720YP_004079599.1 fructose-1-phosphate kinase/fructose-6-phosphate kinase [MycobacterMADKKPSPIVIFAPLPVLTVTVEDRSGEADIHVHAGGQGVWQSRMVSSLG
VPVVLCSALGGETGDVLGHLLPADGVTVQTVPVSARNGSYVHDRRSGSRE
IIAEADGSPLDRHELDSLYELTLTEGLTHGRVLLSGPQEDDVIPADLYRR
LSTDLSANGCKVAADLSGERLKAVLEGKPDLIKVSHEELLDDGRAKSEDA
ADLVKAMHSMRDDGAGTIVVSRSGSAPALALLDDGDVLEVCMPTLEPADP
AGAGDSMTAGMVSALALGRSLREALQIGAACGALNVVRHGLGTGGARAVE
TLAERVELKEWKK
315446718YP_004079597.1 excinuclease ATPase [Mycobacterium gilvum Spyr1]MTGEPDPYIRVFASRVHNLKTVDVAAPRDSFVAFTGVSGSGKSSLAFGTI
YAEAQRRYFESVAPYARRLLLPQDAPKVDDITGLPPAVALQQRRGTATSR
STVGTVTTLSNLVRMLFSRAGTYPPGATDRLDSDAFSPNTTIGACPQCHG
LGRIHEVTEETLVPDPSLSIRDGAVAAWPGAWQGQNLRDILITLGYDIDK
PWRKLTKRQREWILFTEDQPTVEIDPSRHPVTADYYYNGTFSSAERHVRH
TLANSQSAAMRRRVLQYVHSTDCPVCEGSGLRAEALAVTFAGRTIAELVA
LPLTTLAEVLEPAATRTEFVAAYESTESGEFTEVATMIAADLVARIGVLV
DLGLGYLSLHRRTPTVSPGELQRLRLATQLRAGLFGVLYVLDEPSAGLHP
ADAEPLLEVLDRLRRAGNSLFVVEHDMDVVRRADWVVDVGPGAGELGGDV
LYSGPVAGLANVDASVTRRFLFAEEPRPARAPRTPASVMRLRGITFHNLV
GVDVDIPLGSFVAVTGVSGSGKSTLVCKVLGDVMARQLGRSPEPAEDAAD
GDAELLDIDVDSSVGVAVEGAEIIDRLVTVDQRPIGRTPRSNLATYTGLF
DAVRKAFADTPEARRRGWSAGRFSFNVAEGRCATCQGEGFVAVELLFLPG
TYATCPACGGARYSDETLEVTYRDRTIADVLAQTVDEAADFLTELPGAAR
SLTTLREVGLGYLRLGQPATELSGGEAQRIKLATELQRAKRGHTLYVLDE
PTTGLHPADVELLERQLHRLVDAGNTVVVAEHDMAVVAGADHVIDLGPGG
GDDGGTVVAAGTPSVVAAHASSRTAPYLAVQLR
315446716YP_004079595.1 sugar phosphate permease [Mycobacterium gilvum Spyr1]MDSRDARPPTIEKEQPPAVLKKAIAASAIGNATEWFDYGIYAYGVTYISA
AIFPGDAANATLLALMTFAMSFLVRPLGGFVWGPLGDRLGRKRVLAMTIL
LMAGATFCVGLVPTYAAIGMWAPFLLVLLRMIQGFSTGGEYGGAATFMAE
YSPSRRRGLLGSFLEFGTLAGFSCGALLMLGCSLVLGDEDMQAWGWRLPF
LVAAPLGLIGVYLRSRLEDTPVYRELEQEGRTEESTSMQFRDLVVRYWRP
ILQMGGLVVALNVVNYTLLTYMPTYLENSIGLSADQSLMVPIIGMLAMMV
FVPFAGLLSDRVGRKPLWWFSLIGLFVAGIPAFLLMGTNLAGAVVGFAIL
GLLYVPQLATISATFPAMFPTQVRYAGFAIAYNVSTSIFGGTAPAVNDWL
VGATGDNLVPAYYMMGACVIGALALMRIPETTRCPLNGTATPGTDEAPAP
VEYEKSSA
315446714YP_004079593.1 glycine/D-amino acid oxidase [Mycobacterium gilvum Spyr1]MESMSERSGGRPQRVVVVGAGMVGLSTAWYLQEHGVDVTVVDSDGVAAGS
SWGNAGWLTPSIATPLPEPAVLRYGVRALLSPASPVYVPPTADPRLIGFL
LRFARNSTASRWQKAMKALIPLNRDALAAFDRMEVQSSEKSSPAEPFIAA
YRTAADREVLLEEFAQIRAAGQSVNFEVLDGATARAQEPALSPEVDAAIA
IHDERFVNPSAYVDALAAQVLARGGRIEAGVDVDSVSDTGDGVRVAGQRY
DAAVVATGARLNKLLAPFGLRRTVQAGRGYSFTVKVDHLPRGPVYFPTQR
VACTPVGDRLRIAGMMEFRAVDAPLDPRRIEVLKNAAGELLTGAHLDTRE
DEWVGARPCTADGLPLIGRTRSSRVFAAGGHGMWGITLGPVTGRLLAEQI
VTGRTPDALRAVDPLR
315446712YP_004079591.1 FAD/FMN-dependent dehydrogenase [Mycobacterium gilvum Spyr1]MLRPCSVLPVPESLADTLRRAGIADVRVDATSRAAYSSDASLYRVTPTAV
VFPTGHDDVHAVLDVCRSEGVPVTARGGGTSIAGNAIGAGVVLDFSRYMN
HVLSIDPDAQIAVVQPGVVQAVLQSEAAPFGLRFGPDPSSLSRCTIGGMI
GNNACGSRALGYGRTSDNVAALRVLTARGEELRLTSSGPGTRSPAPSSPI
PRALSELTRAGMGTIRTEFGRFGRQVSGYSLEHLLPENGFDVSRLLVGSE
GTLAVCTEATVALVREPAHRVLVVLGFPDIASAGDATPAILRHRPTACEG
IDSRIVDVVRERKGDNAVPPLPRGAAWVFVEVVGDTAEEALARAAEVGSG
CGAVDSLVVGEGGRAAALWRIRADGAGLAARSPRGRPAHAGWEDAAVPPD
RLGDYLRDFDALMAEFGATGMPYGHFGDGCMHVRIDLPLDRPGGVAVFRE
FMVAAAHLVAGYGGSLSGEHGDGRARSELLPVMYSAEALALLAAVKHAFD
PDNLLNPGVVVDPRALDADLRVPAAAPIRHDLALAYRHDGGDFTQAVHRC
TGVGKCRADNTDTGGVMCPSYLATREEKDSTRGRARVLQEMINGADVRGG
WRSPEVHEALDLCLSCKGCASDCPTGVDMAAYKSEVLHQSYRRRLRPASH
YSLGWLPRWAKLGSAVPRLANRAAHLPGLGAAALAAAGVDRRRSIPPLAS
QTFRSWFASRPASPAAGDEVLLFVDTFTNYFTPDVGIATVRVLESAGYRP
TLTGKQLCCGLTWISTGQLDTARRTLTRSLTAMAPAARRGVPIVGIEPSC
TAVLRSDADELVGGEIAAQVGAATRTLAELLTARGWTPPSLQGRHVVAQP
HCHHHSVMGWSTDAALLRGAGAEVSRLGGCCGLAGNFGVEKGHYEVSVAV
AEQQLLPAVRGAGPATAILADGFSCRTQLDDLTDRHGIHLAQLLARNLED
315446710YP_004079589.1 hypothetical protein Mspyr1_52290 [Mycobacterium gilvum Spyr1]MADKSQGRAVKKPAMTIKERRAAKRAKEIESGAMVTRRKRAERS
315446708YP_004079587.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MARLRLDEQLCFALYSASRAVTSAYRPLLEELGLTYPQYLVLLVLWEEEP
CTVGHLGERLHLDSGTLSPLLKRLEGAGLVQRQRSATDERRVTATLTPAG
RALEERAACIPERMLGSTGAAAEDLAALRDALHLITEELHTRSS
315446706YP_004079585.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MTDHFDVVIVGAGISGISTAWHLQQRCPDKSYVILERRENIGGTWDLFKY
PGIRSDSDMFTLGFRFKPWPSARSIADGPSIWNYINEAAQENGIDKHIRV
KHQVLAANWSDAENRWELTVDHDGEQKQITCSFLSVCSGYYNYDQGYSPE
FPGADDFAGRIIHPQHWPEDLDYTGKRIVVIGSGATAVTLIPSLVAGGAG
HVTMLQRSPTYIGSLPLVDPIAEKANKYLPGSLAHFVNRWKAISFSTLQY
QLSQRFPKYMRKTLMTMAQRRLPEGYDVEKHFGPRYNPWDERLCLAPNGD
LFKTIRAGKADVVTDTIDRFTETGIRLNSGEELAADIIITATGLNMQLFG
GATATRNGEPIDLTKTMTYKGLMLSGVPNMAITFGYTNASWTLKADLVSE
FICRLLNYMDDNGFDRVEAQHPGDSVEEKPFMDFSPGYFRRAMDTLPKSG
SEAPWRLKQNYFIDLRTIRYGKVDEESLRFTKHGAPVALSS
315446704YP_004079583.1 hypothetical protein Mspyr1_52230 [Mycobacterium gilvum Spyr1]MGERTRDDAGRPRNSRPRDALGRPLPPGSAGVPRIPDDLRLSAPEYLAYA
QDLLDRGLAFNAHEVLEAAWKDRPQDERPLWQGLAQLAVGVTHIQRGNSS
GATALLHRGCAGLAEVTRPAPHAVDVDGLIAWATDLTEAVGSVDASPDIP
PARLRPRLTCG
315446702YP_004079581.1 hypothetical protein Mspyr1_52200 [Mycobacterium gilvum Spyr1]MDQHYLDSTPEHDRRPVLQWRVVDIVVASVLAVAAGLVFVFWNVAYNPIG
APLGAALPGLQGLASGVWLFAGVLTALVIRKPGAALYGEVVAATVSALVG
NQWGVLTIESGLVQGLGAELVFAAFLYRRWNLPVAVLAGAAAGVALAVNE
LILWYPGSTTAFAAIYTVSAIVSGAVLAGVLSWVVVRGLAKTGALSRFAS
GRVSSSRSR
315446700YP_004079579.1 cobalt ABC transporter permease CbiQ [Mycobacterium gilvum Spyr1]MMRVNPVAKLLAAAVIAAVLVLSVDWASALTALVLEIPLFMALRIPLRAF
LIRGAYITVAAALTALTNLLYGEPRGEVYWSFLLVTVSEGSVELAAAMFL
RVLAIALPSVVLFLDVQPTELADGLGQIVKLPARFVVGALAGMRLVGLLR
QDWEYLGYARRARGVADHARLRRFTGQAFALLVFALRRGSKLATAMEARG
FGAYPTRTWARPSTFGALELALIAGGVVIAAAAVTVSIATGHWDFIGGR
315446698YP_004079577.1 hypothetical protein Mspyr1_52160 [Mycobacterium gilvum Spyr1]MSTDFDRRDRRAFDLSGKVVVVVGAGQSPGPGMGNGRAISLLAARHGAEV
VAVDLNPAAVKETVEMILAEGGNAYAVEADVAEKDDCQRIFDTAMQTSGR
VDGMVYSVATNPPFDFETNSMTVENFNRGINVNMLGCYHCTLFAAQCMER
NSGDTTGSIVNISSIASVKNELGLNIGIMPYALGKCGLNQITEIAAVQYA
PAGIRVNTLMLGPIDSVLANRDSQSLFGLDADEATARHNEVVKLKMGRAS
VWESAYAAVYLLSDESRFMTGQQLRLDGGATLVR
315446696YP_004079575.1 hypothetical protein Mspyr1_52140 [Mycobacterium gilvum Spyr1]MRETADDAWTPFTVGLPQWTAATRLRGRHALVRTVDRVEAAVLVLVCAIA
VIALPVAGAIGTELYDSMSHSHAGAQAATGGVVIWAGTTLAAVTVFLVAR
ALCNRVREARWDSGLRNLADSEDGSAHNQNGQ
315446694YP_004079573.1 hypothetical protein Mspyr1_52120 [Mycobacterium gilvum Spyr1]MTSGEQEPDYRFTLANERTFLAWIRTALALIAGGIAVVQFVPSFGIPGVR
HGLGLALTAGGGVLAALAVRRWQRVQAAMRRDEELPPTHVPALLGGAIFV
VTVAVIVVLVIWPPAGP
315446692YP_004079571.1 Zn-dependent hydrolase [Mycobacterium gilvum Spyr1]MSAAVSIIETSGLGDRSYLISADGTAVVVDPQRDIDRVLDLARERGVRIT
HVLETHIHNDYVTGGLELSRVAGAEYVVPAGDDLGYERRAVTDGDVVDAG
PVRLQVMHTPGHTHHHVSYVLRDSGDAVVGVFTGGSMLHGTTGRTDLLGD
EHTEELSHAQFHSVRRLAAELPDDTEVYPTHGFGSFCSATPASGDSSTIA
DQRQTNPALTKDEQSYVDELIAGLGAYPAYYAHMGVINTEGPTPVDLSMP
EPVDPDELRRRIEAGEWVVDLRNRTAFAAGHVGGTLGFELSDNFVTYLGW
LYSWGSPLTLIGDDADQIAEARRELARIGVDNLTGSATGDIDSLAAGAPL
RSYRVADFAALAEALAENTEAGTPAVLDVRQDSEFADGHITGAVNVPLHE
LSKRLDEVPEGEVWVHCASGYRSSIAASMIDRDDRTVVLVDDSFDQAGKA
GLVS
315446690YP_004079569.1 hypothetical protein Mspyr1_52080 [Mycobacterium gilvum Spyr1]MVGDEDAIAAVLNRLRRAQGQLAGVISMIEQGRDCKDVVTQLAAVSRALD
KAGFKIVATGLRECLTGEAADGQQPMSEAELEKLFLALA
315446688YP_004079567.1 Rhodanese-related sulfurtransferase [Mycobacterium gilvum Spyr1]MTAPATIDSHDLNQMLDSATPPRVLDVRTPGEFETAHIAGAYNVPLDLLR
EHRDEIIKHLDEDVVLVCRSGQRAAQAEETLRNAGLPNVHILDGGITAWE
AKGFAVNRGAQRWDLERQVRLVAGSIVLSSILGSVAAPKLKWVAGAVGGG
LTFAALSNTCAMGMLLSKLPYNRGASCDAQSVVSQLVGTQSPSVRS
315446686YP_004079565.1 NAD(FAD)-dependent dehydrogenase [Mycobacterium gilvum Spyr1]MITDKHQIVVVGGGTAGISVASRLLRKGYTDVAVIEPSDVHYYQPLWTLV
GGGQADAATTARPEASVMPKGATWIKNAAAAVDPDANTVTCSDGAVYEYD
VLVVCPGIQLDWNRTEGLAEALGKDGVSSNYRFDLAPRTWEFIRDLRSGT
AVFSMPSGPIKCAGAPQKIAYLASDYWRKQGVLSDIDVHLVVPTPRLFGI
PAIADTLDTIAADYGITVHTGSEITSIDAASHKVGVTPTAGGPDTVLPYD
VLHAVPRQSAPDWIKAGPLSTGDGGGYVEIDKHTMQHVRYPNVFSLGDAG
SSPNSKTGAAIRKQAPVVVENIDALLTGRPLTASYNGYGSCPIVTSSHEM
LLAEFDYDLNMTPSFPLLDPTKPHRGYWYLKKYGLPFMYWNLMLKGLA
315446684YP_004079563.1 glutamate synthase family protein [Mycobacterium gilvum Spyr1]MKACGSVGRMKKRTLAALVPAVAAAGIAVQDLLQKEHALRRNFPVLARAR
YLLESIGPELRQYIITSNDAERPFSRDQRRWVYTSAKKENNYFAFGTDND
TENATYPIIKQATFSDVVPASPIHLRDIEVPGAKVLGGPRGRRHAFRPAS
VVNVSAMSFGALSPQAVEAMNKAAKIADFLHNTGEGGLSDHHRHGGDLVF
QVGTGYFGCRDEHGNFDLARLADVVASGPVRAIEIKLSQGAKPGLGGHLP
GAKVNAEIARIRGVEQGKDVASPSRHTAFRNVDEMLDVVERIADATGLPV
GIKSAVGEIGFWETLADRMADGQRGVDFIAIDGGEGGTGAAPLVFADHVS
FPFRTGFARVYGLFAQRGMSDRVTWIGSGKLGLPANAIVAFALGVDLLSV
AREPMLAIGCIQAQKCHTDRCPTGVATQDPWLAHGLDPEQKSHRLANYVL
TLRRDLLKVSEAAGVRHPAMLGPDHVEILDGDRGHRTLREVYGYQDGWGV
PGPDIVADIDDYMRPYDDLPGTDRVVEHAPLKLATEPNQATE
315446682YP_004079561.1 heme oxygenase [Mycobacterium gilvum Spyr1]MKTQTSPAFQPLSAAIKAGSAAEHDAAEQSPFITELLAGRVSRHGYAEYL
QRLRIIYRALEDAIRRHRDDPLVAAVYDPALERVPALDADLAYWAPGIHR
DVDSPAAQRYRDRIAELSWGGALVAHHYTRYLGDLSGGQAMGRILDREFA
LDGEGLAFYAFGVRVKPYKDGYRDRLDGLGLDTAEIERMVDEVKIAFGLN
QAVFDELAEMLPDYRR
315446680YP_004079559.1 hypothetical protein Mspyr1_51980 [Mycobacterium gilvum Spyr1]MATHTVHRRSTSDYVWPAVVSLATAATLVVNGLANGLPINGQTTGEVTRR
VEVYFVPAGYVFSIWSVIYFGLLAYSVYLGLTLARRRPDSGAARAIAPWY
LLTAVANCSWLFAWHHNLFPLSMALMAVLLGALIVIYRVQASLPAASTLE
RWAVHIPFRVYLGWISVATIANATITLDDAGWSGFGLSEPTWGVIMVLVA
TALGVAMGVRHRDIAYLVVLIWALVGIAVRLHETTAVLVASLAGAAVLGV
VLAMSARPRRRTLT
315446678YP_004079557.1 acyl dehydratase [Mycobacterium gilvum Spyr1]MTAPADSSPLEARVGHHYQMAGTYLVGREKVREYARAVQDYHPAHWDVAA
AQALGFPDVVAPLTFTSAPGMQCNRRMFEEIVVGYDTYLQTEEVFEQHRP
IVAGDELVIDVELTSVRRTAGRDFITVTNTFTDGDGERVHTLHTTVVGVT
ADDIDAGVKVAVQKAMMHDMNILDIPGTDAEYEKDVRPEGEIRISDGGLT
RTPGTVSFDDLKVGDEIPVHHTRLSRGDLVNYAGVAGDANPIHWDEDIAK
LAGLPDVIAHGMLTMGLGAGFVSAWSGDPGAVTRYSIRLSQPAIVSAKEG
ADIEYSGRIKSLDPETRSGVVLVGAKSAGRKIFGLASVHVRFR
315446676YP_004079555.1 4-alpha-glucanotransferase [Mycobacterium gilvum Spyr1]MAAAHGVATAYRNERREPVDVDADVVIKVLGLLDVDASTEDACRAELARL
AERDRAGVLAPTLARRLDGTPQPLPGAVLLVAEDGGQIEVRDELPADLAP
GWYRVHTRDGQEATLVAAPPRVPASPVTWGWMLQLYALRSEDSWGIGDLG
DLRAFVDWTAGEHGAGAVLLNPLHAPGPTHPVQPSPYTPSSRRFANPLAL
RIEDIDAYRRADPGTRAEVDALRVSATTQRIDHDLVWAAKRAALELLWRS
EGRPDRLDDPSASDGLRDWATYCALAERHGGRWSRWPEDLRDVTGPAVAR
ARRELAPRLAFHAWVQQQCEQQLTAVRTAARESGMSLGVLHDLAVGVDAD
GADAWALSDVLASGVSVGAPPDNFTPRGQDWGLPPWRPDRLADTGYAALR
DMLRAVLSHADGLRIDHVAGLWRLWWIPPGDGPDKGTYVHYDADTMLAVL
ALEAHRAGATVVGEDLGTVEPEVTEALAGNEMLGCAVAWFTRDLEAPGEP
LLPPQRWPSRAAATLSTHDLPTAAGFLRGEHVRVRAELDLLDDVPAEQAT
ADRERAEWVALLRSEGLLPDDGTEPSEQDIIVAMHRLLAATPSRLKLISP
YDVIAEVRQPNLPGTVDEYPNWRLPLPLTLEQLQADPRVGAVTAAFR
315446674YP_004079553.1 hypothetical protein Mspyr1_51920 [Mycobacterium gilvum Spyr1]MAAERSVTPQTLGAWVIKCNPGRTPVDAMRRSGRADARWCVAANYRSQLM
RPGQRVLFWVSAHRLRGFWGAGRITGSPSTVDGRLSVAVRIPLFAEPLTA
VEVSRCSALRSLEVFRSPQQSNPSWVSTDEWAVLEPLLPQLGIPGEQAKL
EAT
315446672YP_004079551.1 signal transduction histidine kinase [Mycobacterium gilvum Spyr1]MKLATRLAILCGTALLAIIMANALNTLQTNRIGALYEQRQQAREAQVTAL
DVARDLQALLATYSQTLFQEDPAERAELSGEVDEWDRMIDEDLRAAARDT
ADPNTRNQYQQALTAWESFQRSYRSDMQNVRTAQDAAAAISQVDGDVALL
ENQLSQIDEETSRRVAEVNRAAGDSIRTSRAFLWTFVSGIVLVLGILMFF
SSRNIHRTVTESALQNEKARRAKEIQAELMTDVQSVDDITAACGIILSGS
AKAVGAKHAALYLQQPDEPGRYALTASYAFHRRKGLPNSYGLGDGLVGQC
ALEGVRIEVTDVPGDYVEITSGLGKSRPASLLLVPIKFESEVVGVIELAA
HRLFSDDDTDLLDSIALGAGVALSAIESAQKTRELLTVSQAQTEELQTQE
EELRAANEQLTQREDMLSAQNAELEETTEELRTQKEELRASSERLEAQAH
SLEEKNEELQHLSASLEAKAEELAVSSRYKSEFLANMSHELRTPLNSILI
LAGLLTESDEPLNAKQHEFAETIQQSGKDLLNLIDEVLDLAKVESGSLYV
DNEPITIAELVTFLERTFRPIAGDKGIEFLVSVDDSAPGQITSDYTRVKQ
IAKNLVANAIKFTDTGSVSVKFSGCVDTDGSPGDGYLSMAVVDTGIGIDE
KDHHLIFESFQQAGRGSAKQYGGTGLGLAISRELARHLGGDIALRSALGE
GSTFTCYLPVDSPAEPDAAAPAPARPAPARPAPARPAPAQQTADVDAPGD
TADRFGPVDTSDVAWPQGDKPVLLIVEDDPTFARMLSGLAAEAGFDSVIT
ASGRMALALAKQHQPAAITLDIGLPDMAGWVVLDVLKHDLATRHIPVNVV
SGTEDDGRGMRMGAIRTVNKPAEISDLRSMFSSIADFLKPGPRHVLVAED
DANQRQVVKHMIESDDIAITCVGTGAQVLDELSGGTSYDCLVLDLGLPDI
DGIDLIERIKDQLKEKRLPVIVHTGRELTAAETERLENLAAAIVLKNARS
PERLLDETALFLHRVADDMPNSAREILANPRRVDESLEGNTVLLVDDDVR
NVFSLGSALKRYGITVLPARNGQAGLDALGEHPEVGLVLMDIMMPVMDGY
EAMRRIRAEPRWRHLPIVALTAKAMKGDRQKCLEAGASDYVTKPVDMDQL
TSVLRVWLAGAPRGQRKPPET
315446670YP_004079549.1 chemotaxis response regulator containing a CheY-like receiver domaiMAGPDLVVIGGSAGGMKALRDILTSLTDIGDCVVCVVMHRPPDPSPLIEV
LRTYTAIPVHEPPDSPWPCPPGALTVAPAGYHLLVGRGRRLSAEPHAAIA
PYETVPGVRAHLALDPPVAHSRPSIDVTFAGAADFAGSAIAVLLSCANED
GAAGCAAVKAAGGRVVLQNPTTCEAPVAVNAALRRLTPDHIADPAGIGRW
LKLALGATPG
315446668YP_004079547.1 phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthasMEGLLVPGQTCWQVATADRFAPIVDGADYLTHVKAAMLRAQRRIMLIGWD
LDYRTTFEPAGATMSGPNQLGPFLHWLLWAHRDLKVYLLKSNLRLLPALD
GFWFGVTPVALLNQITSRRMHFAVDGAHPAGAVHHQKIVVIDDAVAFCGG
LDLTIGRWDTRAHEPEDPGRQTAGQPYGPRHEVAAAVDGAAARVLSEQAR
NRWQAATGEALPGLTARESVWPHTLQPALRDVEIGVARTLPALPGSEEVR
EVEALNLAAIAAARSVIYLENQYLASRSLVEALAARLREPDGPEIVIVLP
RSSESRLEQESMDSARERLLRVLWEADEHDRLGVYWPAVAGGESVYVHAK
VMVIDDRLLRIGSSNLNNRSLGFDSECDLALESTPGGREDVRRLILHTRD
DLVAEHLGVPTETFAREFARLGSFVAAVDALRGTGRSLRKFTEFMISADV
SPFAENDLMDPDRVPRSITRSAWNVATTAITWPLMRTAPGLYSLIRAAAT
RS
315446666YP_004079545.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium gilvum Spyr1]MSVDPSPLTDDDLELLRRPLYGFFSAAAAPSPPQPRPVWYEVTPAGEIQL
FTGPDAVKVRRLARDPRASLVVAAPVGERERWVSVTGRATVAADGGPDLV
TRLARRYWDLDDPVRARDLEDLLAESWVRIVLHPDRVARYRM
315446664YP_004079543.1 AraC family transcriptional regulator [Mycobacterium gilvum Spyr1]MTDELRHNADPGAKTVVFALYDKVTLQDVAAPMEIFARANDFGASYRVLT
VSPSGRPVGTTAFATLNVDVALDAAPDAFDTLLVPGGVPADFSFTPGLHD
IPEEPTPDSVADACDMVRRLAPRARRIASVCTGSFVLAALGLLDGRRATT
HWAHCQTLARQYPAVMVDPDSLFVQDGPFITGAGITAGIDLALAMVESDF
GPAVARRVARWMVVFLQRPGGQAQFSVWAESALPVTGGLRAVVDSVIADP
AGDHSLAAMASRAAVSERHLVRVFRDQVGMTPARFVEQARLEAAKVLLAT
GDHSQDSVARRSGFGTPDTMRRTFRRNLGISPGVYRNRFRTTGVDA
315446662YP_004079541.1 hypothetical protein Mspyr1_51800 [Mycobacterium gilvum Spyr1]MDSRSALTLSIGVLGGIAVAFTATLVTVPIWVVFLAWASFFFVGGGPAGW
VRSVCSNLVGVAIASASLYAAHLLGGSLTATAIAVGVGSAVMVQASWVGL
LSTTPAVVVGFASTVSTVAGTGQLVTATSISHPGLVAACACVLGATFGIA
SEYLATLMTRSAPVDRPDTEGVTA
315446660YP_004079539.1 nitrile hydratase subunit alpha [Mycobacterium gilvum Spyr1]MTEQFAYPSEREQLSADRVAALERLLIEKGVITGQTVDKVLSYFESEMTP
LNGKKIVVKAWTDPDFAARVVVDTPAAIAELDLPEGMAGAEGEHLQAVAN
EPGVHNLVICTLCSCFPWPVLGLPPYWYKDPVFRARAAREPRTVLAEVGV
DLPDDTEIKVWDSSGHSRWFVIPERPAGTEEFTDEQLMDLVTTESMMGVA
LAGRTS
315446658YP_004079537.1 hypothetical protein Mspyr1_51760 [Mycobacterium gilvum Spyr1]MHIEPGIVDGAKIALSYASAAGAGGYALTAAWRHVRERGGASLILGSAAT
TALTLLFFEVFPHFPVGVSEVHLILGSTLFLLFGAAPAAAGLAAGLLIQG
LLVAPFDLPQYGMNVTTLVAPLLALQYVAKRTIAPHTRYVDLKYRQALTL
SATYQAGIVSWVTFWALYGQGVSVETLTSVATFGAAYLLVIVLEPLADLA
VLAAAKNAQRFKDGAWLEPRLFAPA
315446656YP_004079535.1 formate/nitrite transporter family protein [Mycobacterium gilvum SpMSQTSQRELGDTDSPIEDALENAFNRMLDEGTQRLHRSWHEVLVTGFFGG
TEVAMGVLAYLSVLQATGNQLLAGIAFSIGFLALLLGRSELFTEGFLIPV
TTVAAKRAGIGQLAKLWGGTLIANLAGGWLIMWLVMTAYPKLHEKTTTSA
EHFVNAPFNAETVALALLGGMVITLMTRMQHGTDSVPGKIAAAVAGAFLL
AGLQMFHSILDSLLIFGALTAGDAPFGYLDWLSWFGYTLVLNVVGGLALV
TLLRLIRSKDRLKEERRDAESPTAE
315446654YP_004079533.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMKFGISTFPNEDTIDPVSLARAVEERGFAALAVAEHTHIPASRESAYPLG
GELPKIYYRTLDPFVTLAAAAAVTSEIELITGIALLIQRDPIITAKEAAS
IDVISGGRFVFGVGAGWNIEELRHHGTDPKTRGALLDERIEAIKVLWTQE
PAEYHGRFVDFDASYQRPKPVRKPHPPILIGGDSDATVRRIIRHGAGWIA
NPLPIDHLSRRIEQIREGAGGDVPLCQFGTPVKPEYWQAAEELGFGQLNL
LLPTKSRDVSLRLLDDYAEQVARYVG
315446652YP_004079531.1 hypothetical protein Mspyr1_51700 [Mycobacterium gilvum Spyr1]MTAAPNPEAEHAIADIARRHGLSRDSVLAMAAALRNGGGTMAQFSIPELG
GSGQWMRGGMTMVGDMFDHSLKARVDALCNELAQLLSTTQVFPEQTNWWP
ADLGVPSSTGGQNDTRYAVFPAARRLAVQMRGVTRVFDTAEHRIGGVQQQ
QGGPSGTVHFTSQLGTFDISSLREVGGAAPPTPAAPVGDDPATIIAAIES
LAGLHARGILSDDEFATKKAELLARL
315446650YP_004079529.1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium gilvuMAGFGDVLGWVKHEVSSRVPKADLDQRDADYIREQLPGLWLLASLYFRAD
VQGLDRIPADGPVLLVGNHSGGNLPPDTFVFTLAFCSYFGVERPFYQLAH
NLVVSMPGLGSLRKFGTVAANHDNATLALKSGAALLVYPGGDYEVFRPSW
KRHEVDFGGRKGYVKLAREAGVPIVPVASVGGQEAALFLDRGQWLASLLG
VDRIARLKSVPILLAPPWGLAVSDMIPRLPLPTKIAIEVQEPISADDIAG
EDDDTVNERVLASLQSGVDRLAAQRRFPVLG
315446648YP_004079527.1 acyl-CoA thioesterase [Mycobacterium gilvum Spyr1]MSSSLGDVLASMQLRSVGDGLFAGAQLPAPANHILGGHISAQALLAASLT
APGRAPHSVHTYFLRPGDSRHAVTFEVVKLQEGRTFSARRVTARQGDEIL
LEALSSFKLPTEAPGGVTYQPPCPDVPAPESLPVVAPHSAESHSAEGTWA
SLRWFERRVVDAATGPPAPARIWLRPDGEVPDDPVLTASLVAYLSAVTLT
EPAYAARSGLVMAAQRDHSVWFHAAADLSDWMLYDMASPSSADTLALARG
TLFNRSGELVCTVRQEMYFPPPRG
315446646YP_004079525.1 hypothetical protein Mspyr1_51640 [Mycobacterium gilvum Spyr1]MSAVSLITGGAGGMGLATAKVVGRDHSVVLCDVRQERLDAAAAELAGLGI
SATTVHCDVTDRDAVGRLFDGAAVAGTLASVIHTAGVSPSMGDAEYVMRT
NALGTVNVGEQFFARAGEGAALVNVASMAAHILPAELIPTAVFPAALQDP
DTFMAEMLTACEIAPEEARSGIAYALSKSFVRWYSVAQAERFNGKGLRIL
SVSPGSIDTEMGRLEEQAGAGAMVADAAVPRWGTAEEMADLLAFCASRKA
GYLTGTDILNDGGVIASMTERTRLASQ
315446644YP_004079523.1 thioesterase [Mycobacterium gilvum Spyr1]MSDYGYFLQITTRWMDNDVYGHVNNVTYYSYFDTVANHFLIREGGLDIHT
SPVIALVVESKCSYLAPVAYPDDLRAGLRVDKLTNRSVTYGVAIFAGDGD
DPVAHGYFVHVFVDREHRRAVPIPETVRAALERLRGQ
315446642YP_004079521.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium gilvum Spyr1]MSLRVAVTGPTGEIGISTISALEALPEVTEIVGMARRPFDPAAQGWTKTL
YRQGDILDRDAVERLVEDADVVVHLAFIIMGSREESARVNLAGTRNVFEA
VVAAARPRRLVYTSSVAAYGYHADNPVPITEDVPVRGSAEHYYSEQKAAC
EAALREVTAGSDLEVYVLRPCIVAGPKATALADAMPWNQLPMPVQRVAQA
LPLLKPPFPDPGTPLQLVHHDDVAAAIALAVTTTTAPPGAYNIAGDGVLS
MSALGEALGARPVPVPRAAAVAASEVIARLPFVPSSLEWLHAGRTSVVMD
TGKARDQLGWRPKYSAAETLSALAAARGHGG
315446640YP_004079519.1 cobalamin binding protein [Mycobacterium gilvum Spyr1]MSALNPDCLALQERLWAAVMDGDEYTASTVVFGALDAGLDPEDVLLDVIA
VVQRRVGTEWAANRITVAQEHAATAINDRVIAALAHHPKARRRPDAGRVT
VACVDGEWHALPARLLAEVLRLRGWQVDFLGAQVPTPHLIAHVHQHGPVA
VALSCSIPTRLPTAHAAITACQAAGVPVLAGGAAFGFDGRFARLLGADAW
ASDARTAADLLRGGVRPAQSTATHQPIDDLPHLADQEYTMVRSTATTLVQ
TTVEELEDRYPAMRDYNPAQRERTAEDIAHIVAFLSTALYTDDDDLFTEF
VCWTAEILVARAVPAESLYPALDSLSGQLREFPRAQRLLTAAHAALHQST
TTNPPLFA
315446638YP_004079517.1 hypothetical protein Mspyr1_51560 [Mycobacterium gilvum Spyr1]MSPNAEVGRRAVLKVPVVVGAGLAISRTPRASAETARWSPERAHRWHRAQ
GWLVGANFIPANAINQLEMFQPGTFDPRRIDTELRMAKHLGLNTVRVFLH
DLLWVQDRAGFQRRLARFVDIAAHHRIKPLFVLFDSCWDPHPRLGTQRGP
VPGVHNSGWVQSPGAEHLGDPAYRRVLRDYVIGVISQFRHDKRVLGWDLW
NEPDNPADVYRAVERRDKVERVAELLPQVFGWARSVDPVQPLTSGVWDGE
WGDPARRSAVVRTQLDLSDVISFHSYADPKGFEDRLAELTPLGRPMLCTE
YMARTLDSTVESILPIMKRRNIGAYTWGFVAGKTQTFLPWDSWERPVLDP
PLWFHDLLHGDGSPYRAGEVTTIRELTGRNRPN
315446636YP_004079515.1 MarR family transcriptional regulator [Mycobacterium gilvum Spyr1]MCYAYFVRCRYDQLDDLLTRLHLARQRPQWRRRVLGPDSPVSGVSTIRVL
RAVEQFDESGGASVRDVADFLAVEQSTASRLVAPAVAAGLLTKSSAADDQ
RRRTLVLTEVGRKELAEIAERRRELVAETVADLPDSDVDTLVELLGRITD
RFERAAR
315446634YP_004079513.1 hypothetical protein Mspyr1_51520 [Mycobacterium gilvum Spyr1]MTAQSDNDRLGNVAPGDLIELTLPGSAVRQFKVVHKESSGETVIMTLEGD
HGETRDVELPADTVVVRTLESKWESPQSPTPSDGSV
315446632YP_004079511.1 hypothetical protein Mspyr1_51500 [Mycobacterium gilvum Spyr1]MTICDTCGNHYDKAFTVTFHDGRSATFDSVECAAAQLAPECGHCGCRILG
HGIETDEGIFCCAHCARKDTNADVNDRYPVPSGA
315446630YP_004079509.1 iron-binding hypothetical protein- CDGSH type [Mycobacterium gilvumMSDLPPRLVRVVPGGPVMVEGPVCVELPDGSTVESDRFMVAICACRRSKT
YPLCDTSHRRRQRAGGGAQSEQGSVESSAQG
315446628YP_004079507.1 hypothetical protein Mspyr1_51460 [Mycobacterium gilvum Spyr1]MATTTAISIESTTATLIAQLRTVLDLTHTEIQVAETRVAQARTDAVRREL
TQNAENARIRAEAIEKAIRDLGGFPDVIGPFLGRAAAAVKALTEQAEPFD
EALLGDLALEGQLLDRSRYVKALAVAAKHQDVADLATRLITAHTATVEWL
TTVLAEDALGGPAALRRTPVQAAAGLAVKLANMPFTWSTRGAERIAEAVR
SVRPAVSGLVERGARTGEIAGKALSGARDGALESAERVTREQGAEDAADA
IHAARGASGTLDADELPITGYDELTVTDAANAVKELTEPSDIRVIIAYEE
AHKNRQRVVSAAQARVAAIAQEVVGINN
315446626YP_004079505.1 hypothetical protein Mspyr1_51440 [Mycobacterium gilvum Spyr1]MTSIRATARQLLGTTLTMGAAGAAGWFVTLQIAEPVPPQPTAQISTAPAT
HLVTPAAAGTAPQHFERVGQVTAVSPHSLTTVNAQGESTTFRITPDTTRI
GQSVANGTVVVVGIVQNGVPVATAIADTASIGPDGPPMDYDLPT
315446624YP_004079503.1 small-conductance mechanosensitive channel [Mycobacterium gilvum SpMDDTLELASATHVASAAAWIAGAVAIAYAVGLAISWLLQRLGRRSTLLHH
AAELTRMPLRATLVVIAASAAVRRTVDADTGWRGFVDHLLVITLIATITW
TIASLVRVAERQAISRFAGGDEGLTDADRHRRKIKTQVLTLRRIAVAIIV
MLGAAAALMTFPAFSDIGKTVFASAGVLTVVAGLAAQTSLGSVFAGIQIA
FSDAIRVGDVVVLEEEWGRIEEITLTYVVVHLWDERRLVLPCTYFTSTPF
QNWTRNATELLGTAELDVDFTVPFDQMRAELDRLLRANPLWDGRVGVLQV
TDAVEGRVRVRMLVSASNAGQLFDLRCDVREGMVAWLQRTNPGAMPRTRI
EHRTDTDTPRGDDAVPVPGRSQADSGLFSGSIAADRRNRDLTWAHDAR
315446622YP_004079501.1 hypothetical protein Mspyr1_51400 [Mycobacterium gilvum Spyr1]MVKTLAVSCGAALALSACSFSIGGLDYDKLESGITEQLNNSYSSLGLSVS
SVECPETSPGPKKGESLECSAQVGGQTVRVDATVTDDDYNVNFKTIDKLY
DLPTVADTLTESVSEQVGFDVTVDCGSGLKAVEVGTTFDCTAADPQGEER
TVQVTAAPVGEDDSWELLG
315446620YP_004079499.1 hypothetical protein Mspyr1_51380 [Mycobacterium gilvum Spyr1]MGSTRYAALLRGINVGGRNKITMADLRAAFSEAGFGGVSTYIQSGNVAFE
SGRRRASLESDIETLLADRLQSPPVVVVRSHAEMRAIVEEAPADFVARTV
DHHRDVVFLKQPLTADRALEVIQVRDGVDEVWPGPGVVYFTRVSAERTRS
MMNRIVGKPEYRLMTIRNWATTSQMLSILDGMG
315446618YP_004079497.1 diguanylate cyclase domain-containing protein [Mycobacterium gilvumMVLGPTEDGVGADRYTGAELPVLRALLHISDAVLRAQYFDEVLEVIADQA
RVALRAATVSICRMEPELSALRILHNAGRLAPQEQRWPQNDLYPVAPDST
IHTLLAKGIAYANSLDDPGCPVESREVLTSLGKESEVAAPVMVGGSMWGT
LWVTGVDGRRFDDGDILLLQAIAAQTALAIGRSELLSTVWRYAFEDPLTG
IANRRAIDQRLAEIDWDTTYPVVLMCDLDDFKRINDRNGHPAGDDLLRVV
ATELKRLTETIDGAFAGRLGGDEFCVLLPDATLVAAQIFALDATKALRSA
TDLDVTLSWGAAAAGPQVRSGSDLLAAADAALLEAKRQGPARFSTGMSTP
VVHSGLDRRARDVKRTAGVTELVGDLVTILDEQPGLTTVGALEVLAVQVQ
QVLGTAAWALSECGEDRHTLRSLRSVDSVLHEDSGLSVLTDLGPSSYALA
DYPASARAVSDGTAFVAAVDLENSDPAEKALVTQLGYRAVLGVGVPAGST
SYLLEFFSRDGHRDLVEIAPLVRVLASYCVSRVSGTR
315446616YP_004079495.1 hypothetical protein Mspyr1_51340 [Mycobacterium gilvum Spyr1]MGLVIRLAELLLILLPLIGVGYATVRAITSTRGGASGEARGAAQRILDRA
VDEHDRTDTRWLDYELDAATLLDHPMVTDMREPLTQRFHRAKLRADLLRP
ARAADLVDDREATRDYVEAVQEYTTSFDIAEAEAMRRRRDGFSVDEQGRI
DRAQRLLRVAADASATRQEWAGAYRVARRELDGLIVLPARARAALERGIS
GELT
315446614YP_004079493.1 transposase family protein [Mycobacterium gilvum Spyr1]MRVSTAFNRLLAIPGASVTDVVIGERDVEVTLRPTARLLTCPCGKRQPSV
YDRRRRRWRHLDLGVKRLWLVNEIRRLNCPDCGVITEAVPWARPGSRFTR
DFEDMVLWLAQRSDRTTVSTLMRCAWESVTAIINRGVAELLDKRRLQTLY
RIGVDEICYRHPHRYLTIIGDHDTGTVVNIRPGRSEQSLTDFYTAQPDSM
LKQIQAVSMDVSKPYIGATRSKVPEAIICFDGFHIMRWINRALDAVFSEA
AAGPDKVHMSSAQWRTTRWALRTGENRLTDTKRELVNQIAKQNRRVGRAW
ALKEQARDLYRYDHQPGVARALLKAWITAAKRCRIPAFVALGKRLAVYFD
GILAAIELGISNALAESINAKIRLINARGYGHHTAETLTSMIYLCLGGLQ
VKLPTRT
315446612YP_004079491.1 diacylglycerol O-acyltransferase [Mycobacterium gilvum Spyr1]MSANSVRLGLQDLMFIYGETSSSKMHVGGLLPFTPPADAPRDYLRGMIDE
ARRQEVVAPWNRRLAYPRLQFSPLHSWVTDEDFDFDYHVRRSALASPGDE
RELGVLVSRLHSNHLDLTRPPWELHVIEGLEGGRFALYMKIHHALVDGYS
AMRMLGRSLSTDPASRDTRMFFNVPSPTRSRRDQGAAESSNPVTATLRAL
GGVSSAVTGGVSSAVDLANALVNTQIRRDGENAHIAGSVSAPHSILNARI
SRNRRFATQQYEFDRLKKLSSQHGATLNDVALAIIGGGLRKFLSDFDKLP
DRSLIAFLPVNVRPKGDEGGGNAVGAILAPMGTDIEDPVERLETITTATR
AAKGQLQSMSPAAIIAYSAALLAPAGSQIAGALTGVQPPWPYTFNLCVSN
VPGPREPLYFNGSRLEATYPVSIPIHGMALNITLQSYADTMNLGFVGCRD
RLPHLQRLAVYTGDALAELEAASQI
315446610YP_004079489.1 hypothetical protein Mspyr1_51280 [Mycobacterium gilvum Spyr1]MTTSTRRLAALLTMIVALLAACTGVEPTPGSTTGASGSSSATTTTSRSPF
EPTTTPTPPDTSIPLLAYRASDEIGLVEGTTVVASVKGSFDPSNDLITTE
DDRFVFARTSDGLLATLEVATGKGDTREVPVGPNVGTAGGSAILWWEQPN
RLMRLDLADPASQPEVQQVVDLPPVAGVRPGDPRLLIARGGTAVVARTEA
PPSPFGGPDTLYAIRGPGAPVPLGQVDANSPVSVARLSPDGAQLSYALYR
ATDNACGTAAVVTSDADGAQETFDVAGPDADAGSRITKLWWPATGAPKLS
LTTWTCGRPQTYPPVVWQVSGDQIAQTDPPTSALQTAEVAPGQRALILPS
TAAPGEPAGVLVVEDSSRRISVKGLEQGAVDAIAVIPPSP
315446608YP_004079487.1 hypothetical protein Mspyr1_51260 [Mycobacterium gilvum Spyr1]MALVRGAGAALAVSSAVLHASSPTVLTAVMAAVCLYCAYELWRFDSIRSW
LLVAVMNIAMIAVHLPATGHRHGDAGTAAATDMAVAMQLATAVAATEIVF
AAAVLYVRTRAPR
315446606YP_004079485.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMKAVSCLGGALEVVDLPSPRPEAGQLVLDVLRCGICGSDIHAKDHADELT
EVFAEGGYHDFVRSDTPVVMGHEFCGVIAERGRGVGSEFREGTTVVSFPL
VKADGGVHLTGLSPKAPGGYAEQVLAEAALTFAVPNGLDPATAALTEPMA
VAYHAVRRSEIANKDVAIVLGCGPVGLAVICHLKARGVRTIVASDFSPGR
RALATRCGADVVVDPAEESPYDAVPAKQRGLTELPALYELGVGSMEKLRR
IPGWSHVYRVADRLGGTAPKRPVIFECVGVPGMIDGVITAAPLSSRVIVV
GVCMGDDRIRPAMAIGKEVDLRFVFGYTPLEFRDTLHMLADGKLDASALV
TGTVGLDGVAGAFEALGNPEEHAKILIDPSRQR
315446604YP_004079483.1 NADH dehydrogenase- FAD-containing subunit [Mycobacterium gilvum SpMTQSRRVVIAGLGDVGVLTAIKLARHADVVGISAKPGLVSGQELGWRLAR
PGDWARHNWIPFSRFRGLDRVRTVHGTLTAVDLDARTVAVSCADGESTVV
PYDVLVIATGVSNGFWRHPGLQTSEQVDADLRDPHEKLSAAQSVAIVGGG
AAAVSSAAQIATAWPDKRVELYFPGDRALAGHHPRTWKTVQRRLTEAGVV
LRPGHRAQLVPGFTGTELTTDPVRWTTGQDPATADVVLWAIGRVRPNTGW
LPGELLDADGFVRVTPQLQVPGRPEVFAVGDVAATDPLRSSARNRADGLL
AGNIRAFFDGKPLRAYRPPTRRWGSVLGIQPDGLEVFAPNGRAFRFPAWT
FDRVLMPVIVRWGIYRGVRAGGSRR
315446602YP_004079481.1 hypothetical protein Mspyr1_51200 [Mycobacterium gilvum Spyr1]MRLTRPAALGAAAAASCLLLAPVASAQPEPTPAPDAEGPKTTIDASGSYA
VGTEILPGVYQSAGPVDDGACYWKRVAGEELVDNALTKKPAFVQIMPTDT
TFTTSDCQAWTLTNAPMPPQPSPASLLGELTKAIGSGMFSGGPPP
315446600YP_004079479.1 glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily [MyMPVKLDLLSPGIEVGLVTTDLAPMVAFYEDFLELEPQGEIEFDGGTQRRY
SLGGSVLKLVTYTTPPPAPAAPGGGRAQAGLRYFTIGVNGLRAVGEAFET
SGYEVVEPVTEFAPVPGMGWMFVADPDGNHIELFGTL
315446598YP_004079477.1 haloacid dehalogenase superfamily protein [Mycobacterium gilvum SpyMLGLPDRIHACLFDLDGVLTDTASVHRRAWKAMFDEYLSDIADGAEDPDA
RYTPFDAGADYETYVDGKPRADGIRSFLGSRLIDVDEATVTRLGDRKNEM
FRKTLKSDGIEVFDGSRRYLQATADAGLRRAVVSSSANTREVLELTGLDR
YVEVRVDGVTLREENLPGKPAPDTYLRAAELLGVDPAEAAVFEDALSGVA
AGRAGDFGLVVGVDRTGQAQALRDKGADIVITDLGELLT
315446596YP_004079475.1 arabinose efflux permease family protein [Mycobacterium gilvum SpyrMEVQRDSDIRRVVTGASIGNAVEWFDFAIYGFLATFIAAQFFPAGNDTAA
LLNTFAIFAAAFFMRPLGGFFFGPLGDRIGRQKVLAVVILLMSAATLCIG
LLPTYDAIGVAAPLLLLVLRCLQGFSAGGEYGGGAVYLAEFASDRRRGLT
ITFMAWSGVVGFLLGSVTVTLLQALLPAEAMESYGWRIPFLIAGPLGLVG
LYIRLRLGDTPQFAELAKADKKAESPLREAVATSWRQILQVVGLFIVFNI
GYYVVFTFLPTYFIKTLGFTKSYSFLSITLACLVALILILPLAALSDRIG
RRPLLIGGAVAFIVLGYPLFLLITSGSPVAAIAGHCLLAAIESVYISCAV
SAGVELFATRVRFSGFSVGYNICVAVFGGTTPYVVTWLTATTGNSIAPAF
YLIAAAAVSLAAVLTLRETARRPLTQVPYNRADEAPGVALRQHRDR
315446594YP_004079473.1 hypothetical protein Mspyr1_51110 [Mycobacterium gilvum Spyr1]MGIVVRQRATLDVPAEDGISAVMFQTLIRRPLWWAGTAAAIAGFVFQALA
LANGSLLLVQPILVSALLFALPLSARLAHRKVSRGEWAWAVLLTVALAVF
VVLAKASPGDYEASLTTSIMVAVVCTVAVLACVIVAARFVGWVRAVLLAV
AVGVLFGVVAVLTKLVMHMLVHEGLVAVLTAPVLYLLALLGVVAMLIQQS
AFHAGSLQTSVPTMLVLEPVIAVVLGAVVLGEHLNAGHWDLVAIAVATIA
MAAGTVALGRGEGAYEEQLEADQRTAQAASKSG
315446592YP_004079471.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium gilvum Spyr1]MTDPGAFDAPGVFAEAPVAMLATAGTDAVPHLVPVVFALPAGRSDVLYTA
VDAKPKSTQRLRRLRNIEENPSVSLLVDHYDDDWSKLWWVRADGVASIHH
SGVEMATGYALLRGKYPQYQRVELDGPVVTVEIRRWSSWTGG
315446590YP_004079469.1 ABC transporter permease [Mycobacterium gilvum Spyr1]MSLARRLRDSLPLLPFLIVVVIFLIIPTVTVVIGAVYSDGVFSLDRIAAL
FTGTALSALADSVLLSGSTALIGAFLGAVMAWLIVSSPPASMLRRAVLSL
CSVLAQFGGVALAFAFLATVGLNGVLTLWVQQAFGFNLAGSGWLYSLAGL
TLVYTYFQIPLMVIVFIPALEGLRGQWREAAVSLGASTWAYWREVAIPLL
TPAFLGSALLLFANAFAAYATAAALVSQGSPILPLLIRASLVSEVVLGQA
GFAYALALEMIVVVAVVMVAYNLLVRRSSRWLT
315446588YP_004079467.1 ABC-type spermidine/putrescine transporter- ATPase component [MycobMTNRGVSVQFDELTRVYGATRALDGLTLHIEPGELVALLGPSGCGKTTAL
RILAGLDEATSGTVSVGGVDVGRVPANKRDMGMVFQAYSLFPHLTVLDNV
AFGLKMRGKGKSDRLSRAADMLDLVGLGELGGRYANELSGGQQQRVALAR
ALAIRPRVLLLDEPLSALDAKVRTQLRDEIRRVQLEVGTTTLFVTHDQEE
ALAVADRVGVMNQGRLEQLAAPADLYAHPATPFVADFVGLNNKVPASVSG
GTATLLGVSVPALPGSVDGDGVAMVRPESVTVTADPAGTATVATVSFLGA
ITRVGVTMPDGSLLSAQMSSTAARALTPGDPVTVGVEPGGVLVTRPL
315446586YP_004079465.1 heme iron utilization protein [Mycobacterium gilvum Spyr1]MTTAGPTRDHGDPGDAPTIPPPLSEPANPARPSAAEEARTIAASTNSGTL
ASLTADGDPWASFVTYGLWGGAPVLCVSNLAEHGRNLAGDPRASIAIVAP
AMVSNPSATDPLANARITLAGHVEAPTGAERDAAREAHLAAVPAARYYID
YSDFTLWVLRVSRVRWVGGYGRMDSATGEAYAAAEPDPVAPASAGAVAHL
NDDHADSLAAMARALGGYPDTVSATCTGADRYGLDLRVDTERGMAYTRIG
YAAPLDSIDQLRSAAVELTRRARGDN
315446584YP_004079463.1 trehalose biosynthesis protein [Mycobacterium gilvum Spyr1]MTLAFGEWIIHRRWYAGRTRELASVEPAAVTALGGGLDHVLLDVAYTDGS
TERYQVLVQWESEPVDGYGEAALIGTASGPDGTRVAYDALFNPEAAGRLL
SLINRSETIGELTFSREPDVTLPVDAPAKVSGAEQSNTSVIFGKDAMLKV
FRRVTPGVNPDIELNRVLARAGNPHVATLLGAFETSSCALGMVTAFAANS
AEGWDMATASVHDLFANEVGGDFADESRRLGAAVASVHATLADTLGTSVT
QFPIDTVLERLRSATRAAPELAPYAPQIEQRFRRLADQPIRVHRIHGDLH
LGQVLRTPESWLLIDFEGEPGQPLEERRRPDSPLRDVAGVLRSFEYAAYQ
QVVTGGGDPQMADRARSWVDRNVDAFCAGYAAVAGEDPRASGDVLAAYEL
DKAVYEAAYEARFRPSWLPIPMRSIQRLVS
315446582YP_004079461.1 nicotinamidase-like amidase [Mycobacterium gilvum Spyr1]MSTPATTRALVIVDVQNDFCEGGSLAVDGGAAVARGISTLLGSLGIDGSH
SYHHVVATKDFHIDPGAHFSDQPDYVDSWPVHCVAGSEGAEFHPDLDTAA
VEAVFYKGHYSAAYSGFEGTDDDGTSLADWLRERNVAAVDVVGIATDHCV
KATAADAATAGFATRVLLDLTAGVSPSTTGAAIDALRAAGVVILP
315446580YP_004079459.1 hypothetical protein Mspyr1_50970 [Mycobacterium gilvum Spyr1]MTAQILAHGLGGSTDLPIPLTYALIGAAWTLTATFAVVAFAWRTPKFDAA
RPGRALPPWVTRSVDAPATRWVLAAAALGLTGWVAVAAVRGPQTSENPLP
GVFYVLLWVGVVALSLAIGPVWRVLSPVRALHRFLGGRNLGRRYPDALGY
WPAAAGLFAFVWLELASPDPGSLGAIKIWLVVYLAVTLAGALWCGPRWNA
RADPFEVYSVVASRFSLFGRNPDGRIAIGNPFNRLLTLPVRPGVVAVLSV
LLGSTAFDSFSAMPQIRRLVDELTDSALAATALRTVGLVLFVGIVAATFT
LAARCTGGVDARTRRELPGLLAHSLIPIVLGYVFAHYLTYLIERGQQTVY
RLFGSADAEVVYVFSMHPGLLASLKVGFVLFGHVAGVIAAHDRALAVLPR
QHQLTGQLAMMLVMVGYTFTGLYLLFGG
315446578YP_004079457.1 hypothetical protein Mspyr1_50950 [Mycobacterium gilvum Spyr1]MTASAQEVVILADHPIWLAVPAFAPALIIAGVIVYIAARNRRRPDQEKEQ
315446576YP_004079455.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MTFDITPTAAQHDLARRAHEFAEDVVRPVAAEYDQRQEFPWPVLEEAAAR
GFYSPLFYRDLIGDPTGLSLPMFMEELFWGCAGIGLAVVMPALALSAIGQ
AASPEQMLQWAPECFGTPGDLKLAALAISEPEGGSDVRNLRTTARRAGPE
PDADWIIDGHKMWIGNGGIANVHVVNAVVDQELGHKGQALFVVPGGTPGL
DMVRKLDKLGCRASHTAELKFNSVRVPADHLLGGQEKLDHKLARAREAVE
GGRHSGSATLGTFEQTRPMVAAQALGIARAALEYVTEYANRREAFGAPII
DNQGISFPLADLATGLDAARLLTWRASWMAATGVPFERGEGSMSKLAASE
LAVRATERAIQTMGGYGYVKDHPVEKWYRDAKLYTIFEGTSEIQRIVISN
ALGAAEGRPPLHVDLDPTGGPFNRLLGRGTPARTRAGARALTLKDRVPAP
VMQMAMKVLKPPRK
315446574YP_004079453.1 hypothetical protein Mspyr1_50910 [Mycobacterium gilvum Spyr1]MSSKKEVIAALDAVDRAHRAAAALPFQSLAPADQRALLVRLDAVAKQLAV
TQRRLLGQMVAGPPPVELAGAPWAEVLARRLRISVGEAQRRISEAAAPID
S
315446572YP_004079451.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MRIALLSYRSKTHCGGQGVYVRHLSRGLVELGHDVEVFSGQPYPEILDPR
VRLTEVPSLDLYREPDPFRIPRPSEIRSSIDLEELLTTWTAGFPEPKTFS
MRAARLLAARRGDFDVVHDNQCLGTGLLTIAESGMPVVATVHHPITRDKV
LEVAAAKWWRKPLVRRWYGFAEMQKDVARKIPELVTVSSTSAADIAEDFG
VTPEQLNVVPLGVDTQLFQPAEHRVRNRIIAIASADVPLKGVSHLLHAVA
RLRVERDLELQLVAKLEPNGPTEKLIAELGISDIVHISSGLSDSELAGLL
ASAEVACIPSLYEGFSLPAVEAMASGTPIVASRAGALPEVVGADGQCARL
VKPADVAELTSVLGELLDSPRELRRLGDNGRRRALEVFSWESVAAQTVAV
YERACERVATC
315446570YP_004079449.1 hypothetical protein Mspyr1_50870 [Mycobacterium gilvum Spyr1]MHDIPGVPGVFTPAQCRQTAESIAATQESSGAIPWSVGGHTDPWDHIENA
MALTVAGLWEPARAAFEWSRTTQRADGTWPIQLRDGVIEDANSDSNFCAY
IATGVWHHVLVTGDRAFAATMWPVVSKAIDFVLELQSGTGEIAWARGQGG
IADEALLTGCASIYHSIRCALALADYVDDPQPEWEVAVGRLGHAIADHQD
AFVTKDRWSMEWYYPILGGALRGPRAQARIDERWNDFVVPGLGIRCVDDR
PWVTGAETCELVMALDAIGDRARAHEQFAAMHHLREEDGSYWTGLVYADG
KRWPVERTTWTGAAVILAADALSSTTPGSGIFRGADLPRGLEGVYDCECV
ISER
315446568YP_004079447.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSDPTLESTRRRLTARQADTVDRLGRAAVDLLRRDGFGALTVRRVAAEAG
VGAATAYTYFSSKEHLVAEVFWRRLTSSPRCEYGAADRAARVIEVLGHIS
LLVADEPQFAGAVTTALLGRDPDVEVLRQRIGLDIRDRLADALGPDTDPD
VLDALEMLYSGALVRAGMGYASYEEIADKLERSARLILGG
315446566YP_004079445.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MTTVHSSTSQSSPVLPVRLPPTPRIPRFLQGLGFSLSRQWTVAQVVRRYG
DVFTMTLPVFGKTVLVTDPALAKQLFMANTDDVGNIQPNLSRVLGSGSVF
ALDGTDHRLRRKLLTPPFHGKSIKNYERIFEEETLREAASWPEGQPFETL
EPMMRITLNAILRAVFGADGAHLDELRRIIPPWVTLGSRLAVLPTPHRTY
GRFSPWGRLARYRRRYDEVIGRLIDAVQADPNFESRDDVLALLLRSTYED
GSSMSRQDIGDELLTLLAAGHETTAATLGWVFERISRHPDVLARLQAEAD
TDGNEYRQAVILETQRVRTVIDFAGRHVYAPTFELGEWVIPQGYSIVVAI
GQVHHREQDYLDPEDFDPQRFVGQRPSTLSHIPFGGGTRRCVGAVFANVE
MDIVLRTVLRHFTIETTTAPGEKMHSRGVAYTPDDGGRVVMRRR
315446564YP_004079443.1 methionine-R-sulfoxide reductase [Mycobacterium gilvum Spyr1]MTLPYNKNPAAVNALSPEQYHVTQQNGTERPFTGEYWDNHEPGIYVDVVS
GEPLFASVDKFESGSGWPSFTRPIDSGNVVEKRDFSHLMIRTEVRSAHGD
SHLGHVFKDGPREAGGLRYCINSAALRFVHLDDLEEQGYGQYRGLFVAET
ATEEEQA
315446562YP_004079441.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium gilvum Spyr1]MSAPVLVIGANGYLGSHVTRKLVAAGNDVRVMVRDGANTVGIDDLAVTRY
VGDIWNSDVLREAMTGCEVVYYCVVDTRGWLRDPAPLFRTNVEGTRNVLD
VAVEPGIAATLRKFVFTSSYVTVGRTRGRVATEADVISDPADLKSLTPYV
RSRVQAENLVMEYARERGLPAVAMCVSTTYGAGDWGRTPHGAIIAGSAFG
KLPFVMGGIELEAVGIDDAAQAMLLAAQKGRAGERYLISEKMISNADVVR
IAAEAAGVPAPTKKIPLVLSYAMAALGSAKSRLKGTDERMSLGSLRLMRA
EAPVDCSKARRELGWQPRPVEESIREAAKFWVGLKAAKRQRTA
315446560YP_004079439.1 hypothetical protein Mspyr1_50770 [Mycobacterium gilvum Spyr1]MTDRPIHEPSPSHPITVVPTGRHVVVRVNGDVVAETDAALTLQEASYPAV
QYIPIGDVLPGRLSPSDTATYCPFKGDAGYFDVTAGGSTVTDAVWTYREP
YPAVAQIAGHVAFYPDKADVSVDDG
315446558YP_004079437.1 DNA-binding ferritin-like protein [Mycobacterium gilvum Spyr1]MTTFTVPGLSDKQGAEVAELLQKALSRYNDLHLTLKHVHWNVVGPNFIGV
HEMIDPQVELVRGYADEAAERIAALGTAPLGTPGAIISDRTWDDYSVNRD
TVQAHLAALDLVYTGVIEDTRKSIERLGELDPVSEDMLIGHAAELEKFQW
FVRAHLENSGGELVNEGATSEKAAASKAKNKS
315446556YP_004079435.1 glutamate synthase (NADH) small subunit [Mycobacterium gilvum Spyr1MADPRGFLKYTHRETAKRRPVDLRLKDWKEVYEDFSHDTLKVQATRCMDC
GIPFCHNGCPLGNLIPEWNDLVRTGRWRDAIERLHATNNFPEFTGRLCPA
PCEGSCVLGINQDPVTIKQVEVEIIDNAFDEGWVVPLPPTKLTGKTVAVV
GSGPAGLAAAQQLTRAGHRVTVFERDDRIGGLLRYGIPEFKMEKHHIDRR
LDQMRAEGTEFRTGVNVGKDITAAQLRQEFDAVVLAGGATARRDLPIPGR
ELDGIHQAMEFLPWANRFATGDLKDSVLDEDGEPPITAKGKKVIIIGGGD
TGADCLGTSHRQGAVSVHQFEIMPRPPETRADSTPWPTYPLMFRVTSAHE
EGGERVYSVNTEAFVGSDGKVTGLRAHEVVMNAGKFEKVEGSDFEMDADL
VLLAMGFTGPEREGLLSDLGVEFNERGNVTRDDAFATSVPGVYVAGDMGR
GQSLIVWAIAEGRAAAAAVDKYLMGNSALPAPIKPTAAPQR
315446554YP_004079433.1 hypothetical protein Mspyr1_50690 [Mycobacterium gilvum Spyr1]MIDMTAACAGTAGLLDRVRDDQLSAATPCSGMDLGALIAHIGGLALAFDA
AARKEFGPLTDTPPEMGDGVEDGWRESYPSRLASLASAWREPAVWEGMSR
AGGVDFPADVGGLIALTEVVVHGWDVAVSAGLPYEVDGETLAAVHGHLAA
FTADGPVEGLFDAPVPVPDDAPLLDRVIAMTGRDPSWSAA
315446552YP_004079431.1 ArsR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPHRSPAEQQRPLYEIKANLFKALAHPARIRVLEILATADDPVSVSDMLA
DTGFEATLLSQHLAVLKKHQVVTARRVGNSVFYELAHPLVSELLVIARTF
LADTLAGRRDQLRSIKALPPLPGRA
315446550YP_004079429.1 nucleotidyltransferase/DNA polymerase involved in DNA repair [MycobMFVSGIASSGPSGRTAAILHADLDSFYASVEQRDDPSLRGRPVLVGGGVV
LAASYEAKAFGVRTAMGGRQARALCPQAIVVAPRMRAYSDASAAVFEVFR
DTTPVVEPVSVDEAFLDVSGLRRVSGTPVQIATRLRERVRDEVGLPITVG
IARTKFLAKVASQEAKPDGLLLVPPDRELAFLHPLPVRRLWGVGAKTADK
LRAHGIETVADVAELSETTLSSLVGGAMGRQLFALAHNVDRRRVVTGQRR
RSVGAQRALGRAGSAMTADEVDAVVVNLIDRITRRMRAADRTGRTVVLRL
RFADFSRATRSHTMPWATASTDAILDAARGLVAAAAPLIGERGLTLIGFA
VCNIDRDGAQQMELPFASPAEARDPLGVDLAIDRVRGRYGNAALTRGVLL
GRDPGWEVPMLAE
315446548YP_004079427.1 RraA family protein [Mycobacterium gilvum Spyr1]MALTPRPTADLVDEIGPEVRSCDLQMRQFGGRSEFAGPITTVRCFEDNAL
LKSVLSEPGDGGVLVVDGDGSVHTALVGDVIAELGRSNGWSGLIINGAVR
DASTLRTLDIGIKALGTNPRKSSKTGDGVRDAVVEFGGVVFTPGDIAYSD
DDGIVVVTAD
315446546YP_004079425.1 copper export protein [Mycobacterium gilvum Spyr1]MTHRRAVAGGVLVTVAACVMAWGLAYAASPLGPAVVRAVADAAGVATLGL
VVVPLLDGPRYRAELSRRAWLPLVVASATWVVAEVVRLTITAAGAAGTGA
TSLGLRTAVEFATRTAPGRAGLLTILAAALVCALAVLRIGSVPTVVASAG
AAAVGIVGHPLTGHLADSPFGGVAIAVHALAAAVWCGVLAAVVLTVDHRG
QWARILPRFSRLSFGCVAALLAGGVVGGVAMLASAADLYATGYGRVLTAK
IALTVVLFVLAWRNRRIWLPAARTHRSSAVLSRSRAHVEVALMAAALAAA
ATLSVTG
315446544YP_004079423.1 hypothetical protein Mspyr1_50590 [Mycobacterium gilvum Spyr1]MRGTAAGLLTAALTVAAHSVGGGGLPFGVDVVALGVVAVTVGAVLASASR
GGDVRILAVVLAAGQVAGHAVLAAPGHLHAAAALPAWSMVTAHVVAVVAG
AALIGIGEHLARALSRVVPSAAPAGAAPIAPSRQPVARSSDHPLLSTLLL
AFSMSHRGPPVSTR
315446542YP_004079421.1 hypothetical protein Mspyr1_50570 [Mycobacterium gilvum Spyr1]MGSRARSTAATCLVVSGLLLGGGTAQADPAESSGDESVAATAPAGSRPDR
PARAPDSERPSRIERAASGNSEDVAADRDPEPARRTPRKPDAGERPLERP
DSPLPGPCCDEPAWECPPSVSSQDRDRSVGMPPTIPAPALGPQRSDVLDV
VPGISVGSADAEELPINAPIVIAGPAGFGPAAVAPGGAGPASAALPPASA
AAPASPAAPAAPGRSMPASAGDRVTIPASASRAGYGEYLRGAGVSQIAAL
ALPGLAGILLLTGAGGLLGYRQAKAAQGVRTTGIARFMN
315446540YP_004079419.1 hypothetical protein Mspyr1_50550 [Mycobacterium gilvum Spyr1]MIVWVIAGLLGLATGLRIGWALVNKQSLVSTAMILALGSLGVVAALNWEP
LTLLIDTMLRWPNISMGLSQVALIACAAGSAVMITTVASSRTPATAKKLA
FIQYGVAAVIAAVSLGIFLAAEQQPEMSPEEYLRRNLSGGGNMLPWLLPL
LYVLVALSLVAAAGLRHSNRTRRGRALFVFTIGIVLIVLALAFFLLRAVG
TSGLVGVGAAATLLGCAMLIVAAGSLLPSLEDWVGARRELRTIAPLLEEL
GRRHPDVGIGVRPRGPLVFRVAERMSLISDALFLEATAADGALRPVDSAG
AEVMDLDDLVERAELEAPDVAPSEQARAVAAWIWDGREKFPGLAWLRQPA
RYSDREWILEIARQYRELSTGFSAGD
315446538YP_004079417.1 hypothetical protein Mspyr1_50530 [Mycobacterium gilvum Spyr1]MDFGSGRAIEIAPFHSRGSLKGFVVSGRWPDSTKEWAQLLMAAVRVASLP
GLLSTTTIFGVREELPEQPEPGTVGLVLAEGTVVGESAVPPGHFADRQPP
ALMMLHPPSETTPSLPECTGAASGCVLLPGLPHLGLEHRAAWVEAESDGT
VTSMVSRVGVDPISHPDTAILAMLLAA
315446536YP_004079415.1 hypothetical protein Mspyr1_50510 [Mycobacterium gilvum Spyr1]MRPTLEPGDGLIALRGGRPKEGQLRVFPDPTLATRFLVKRVGRVRRSSCG
ATFEALSDNARAPGVVDSRQFGWVPAASSYRVIWTVPGARK
315446534YP_004079413.1 Rhodanese-related sulfurtransferase [Mycobacterium gilvum Spyr1]MDDPDVPQAAISDVPSTFGDGVVLLDVREDDEWQRGHAPQARHIPMGDVP
ARLAELDADAELYVVCHVGGRSQRVAQYLARNGFRPVNVTGGMLAWAGAG
RPVVTDAGNVGTV
315446532YP_004079411.1 glycerophosphoryl diester phosphodiesterase [Mycobacterium gilvum SMSSGATLGGHPFVVAHRGASADRPEHTLAAYQLALEEGADAVECDVRLTR
DGHLVCVHDRRLDRTSSGTGLVSDMTLAQLRELDFGAWHPSRRDDVSGGD
TGLLTLDDLVSLVMDWNRPVKMFIETKHPVRYGGLVESKVLALLHRYGIA
SPASADMARAVVMSFSAGAVWRIRRAAPMLPTVLLGETSRYLGGGAATTV
GATAVGPSIATLREHPELVDRAAAQGRALYCWTVDHYEDVQYCADLGVAW
IATNHPGRTKAWLQNGLTGAGRD
315446530YP_004079409.1 cell envelope-related transcriptional attenuator [Mycobacterium gilMTHERPPFPERREPPQVIRRDPNRRPPWPPNPPTPARRPIPPPHRARAVP
PPPPPRRPPPPRPPAPRPPPPRPPAPVAAAPRKPRRVRRWFRIALACLLL
IAVAGVAVGAWIDSSLSRLPALTDYAGRPPAGAGTTWLLVGSDGREGLTP
EQQAELTTGGDLGASRTDTILLVHLPGIGSSTPATMVSIPRDSYVPIPEY
GSDKINAAFSLGGPPLLAQTVEQATGLRIDHYAEVGFGGFAGMVDAVGGV
TVCPAEPINDPLAGIDLPAGCQELDGRNALGYVRSRATARADLDRMANQR
QFMSALIERASSPAVLLNPLRWYPLASAAADTVAVGDGDHVWDLARLGWA
LRGDVTTVTVPIGEFTENSAGSIVVWDSETAQRLFAALASDSPVPADVLE
AGNR
315446528YP_004079407.1 hypothetical protein Mspyr1_50430 [Mycobacterium gilvum Spyr1]MASPAPTAAPTTAERIRSACVRPGGAMIAVEGLDPSTTSVHHLLGDGSVA
ITVPVDGPLAASVVSAGNAGIQAVLEMTDYAPLPLREPVRSLVWIQGVLR
DVPTAEVPALLDLIAAADPNPALLQVNPGPEETPHALMRLEIESVVVADS
TGAESVALGELLGARPDPFCAMESCWLQHMESAHRDVVDRLAARLPASLR
QGRVRPLALDRYGVQLRVEGADGDHDVRLPFGKPVDDVTSLSRAIRVLMG
CPFLNGLRARGV
315446526YP_004079405.1 fructose-2-6-bisphosphatase [Mycobacterium gilvum Spyr1]MTGRLVLVRHGQSHANVERRLDTRPPGAELTDLGRDQARTFARTLARPAA
IVTHSIATRAVQTAGHIAAEFGGALSAGAMAFEGLHEVQVGELEDRTDEA
AHDEFNAVYRRWHGGELDVALPGGETAQQVLDRYVPVLDQLRMRYLDDET
WHGDIVVVSHGAAIRLVSALLAGVDSRFAVDHHLANTESVVLAPITDGRW
SCVQWGKLTPPFVGDAPVTTTAGDAPRSADPMG
315446524YP_004079403.1 hypothetical protein Mspyr1_50390 [Mycobacterium gilvum Spyr1]MSPHRFEELVGDALDLIPAGLAKAIDNVVILVADRHEEEPDLLGLYEGVA
LTERDSWYAGSLPDTITIYREALLDMCGDEQEVVDEVAVTVIHEIAHHFG
IDDERLHELGWG
315446522YP_004079401.1 seryl-tRNA synthetase [Mycobacterium gilvum Spyr1]MIDPKVLRENPDAVRASQQARGEDPGLVDALAEADSARRAAISAADNLRA
EQKSASKAIGKASPDERPALLAAAKELSEKVKAAEADQAAAEAAYTAAHM
AISNVIIDGVPAGGEDDFVVLDTVGEPRVIPDAKDHLELGEALGLIDMER
GAKVSGSRFYFLTGFGALLQLGLFQLAVRTATENGFTLMIPPVLVRPEIM
RGTGFLGAHADEIYHLAEDDLYLVGTSEVPLAGYHSDEILDLSGGPLRYA
GWSSCFRREAGSYGKDTRGIIRVHQFDKVEGFVYCRPEEAEAEHDRLLGW
QRQLLAAIEVPYRVIDIAAGDLGSSAARKYDCEAWVPTQQTYRELTSTSN
CTTFQARRLAVRYRDENGRPQTAATLNGTLATTRWLVAILENHQQPDGSV
RIPEALVPHVGTDVLRPKK
315446520YP_004079399.1 Zn-dependent hydrolase of beta-lactamase fold protein [MycobacteriuMQVTSVGHAGFRIDTKAGSILCDPWVNPAYFASWFPFPDNTGLDWPALGA
VDYLYVSHLHKDHFDPKNLAEHVNKDAVVLLPDFPVPDLRRELEKLGFHT
FFETTDSVKHRISGPKGDLDVMIIALRAPADGPIGDSGLVVSDGVTTVFN
MNDARPVDLDMLHADFGQIDVHMLQYSGAIWYPMVYDMPARAKEAFGTQK
RQRQMDRCRQYIAQVGATWVVPSAGPPCFLDPELRDLNDDHGDPANIFPD
QVVFLEQMRNHGHDGGLLMIPGSTADFTGSQLNSLEHPIPDDDVLAIFTT
GKADYIADFAERMAPVLAAEKASWAPAEGEPLLEPLRELFEPIMLQSDQI
CDGIGYPVELRLGDGDRHETVVLDFPKRAVREAIPDEKFRYGFGIAPELV
RTVLRDREPDWVNTIFLSTRFRAWRVGGYNEYLYTFFKCLTDERIAYADG
WFAEAHDDTASITLEGWEIQRRCPHLKADLSKFGVIEGTTLTCNLHGWQW
NLTNGRCLTTKGHELRSTKLG
315446518YP_004079397.1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium gilvuMEPVFRTLEITAEALVRATGTEITFRGLENLPATGGAVIAINHTGYVDFL
PAALAAKRRGRRMRFMIKAEMQDVPVLGWLIEHTGTIPVDRQAGAGAYAA
AVQSLLRGEIVGVYPEATISRSFELKEFKSGAVRMAVEARVPIVPLIVWG
AHRVWTKDHPRALGRRRFPVTVSVGAPLEPAAAAADAGAVLRAEMTRLLH
EVQDDYGQPPGAFWLPRRLGGGAPTPEEARRMEEAELAERARRRNGRR
315446516YP_004079395.1 LuxR family transcriptional regulator [Mycobacterium gilvum Spyr1]MKAVDDFLAGLQQLQPAGLLIEGEAGIGKTTMLAGVVDAARQAGFRVLSA
HGDQSGSGLAHAAIADLFAGVQTDILDGLPELQRRAADGVLRRGDGTGGP
TDERVIAAALLGAVHGSATRTPVLVAVDDVQWLDPSSVAVLAFVARRVKG
RVGFVVAERPGVGPGLPAATWLQVGTGALTRLPVAPMSLGALHTMLSSRL
GRRFSRPQIVRIAEVSGGNPLYALELARVADGAGSRPGQRLPESLSELVR
LRVDGLAEDVRDVLLVAASATSPTVDLLAKAVGVTPAAVTGLVEAAEVEG
IVVIDGNRIRFTHPVLANGIYAGADPQRRREVHRRLADLKTDPELRARHL
ALASTVADETTLTTLDAAADAARARGAPAAAAELLEWAMQLGGDSVSRRI
RAAEHHVVAGDMRRAATLLEQALVDLRPGVLCAIALNLLAGVRMVEDDYI
RAVELLERARADADNDAVLVTTLLSLGFCLGMTGSFTAQLATVREAVAVA
ERAGVPALTSRALAMWVHVSFQAGNGLDSAALLRAVDLEDPEDNTPIPFR
ASAARGLSLALTGRLAEADGQLAAVAQRSAQRGAEQDVMAVLGYRTLVAI
WRGRYAEADAYAADTMERAEQLGGSMVIAFSICAAVAAYRGREDQARDQA
AGALAQGGDYVALTVWASATLAFLEVSRGNYEQALEAAEPLVDLYRDFPG
TELMSACFMPDAIESLIAVGRLDEAEPLIAAFERNGAELDRPWQLAIGNR
CRAMLLSATGDLDGALAAAERAMAEHARLPMPFERARSALTLGEVLRRLR
RRDAAAAAVRDALAQFEELGVPLWVARARIALSGLAVSGSAVGSELTDSE
RRIAELAASGMSNRDVAETLFVSVKTIETNLSRVYRKLGIRSRAQLGRML
R
315446514YP_004079393.1 GLTT repeat protein [Mycobacterium gilvum Spyr1]MPNRRRRRLSTALSTVAALAVASPIAVIAVSELSASTLAGRDGAPQHREF
VQAATITDLPGELMTALSQGLSQFGINLPPLPTGLLTGTGASSPTTLSPG
LGTAGLTSPGLMPGLSAAPSLTDPSLANPALTSPIGATPGLTTPGLTTPG
LTTPGLTDPALASPGLTTPALTDPGLTTPGLTTPGLTTPGLTTPGLTTPA
ALTDPALGLPATGEIPISAPVGLDPALGSYPILGDPSLAATQPVATSSGG
LLGDLTSAANSLGAGEAIDLLKGVLMPAIMSAVKPPVPPVPAAPLATAAG
EVAPVEAGLGAAEASFETGAEPGA
315446512YP_004079391.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MSDIPSGALEAGPSRAVSPLARIILPRPGEPLDVRKLYIEESETNARRAH
APTRTTLEIGAESEVSFATYFNAFPASYWRRWSTLESVVLRVELTGSARV
DVYRSKSTGARITVGGAPVHSTEGSDVPAVAEFEIELTPFEDGGWIWFDI
TTDAKSTLHHAAWYAPVPAPGRANVAVGIPTFNRPSDAVNALAALTSDPL
VDEVIGAVIVSDQGTSKAKDHPGFDEAAAALGNRLTIHNQPNLGGSGGYS
RVMYEALKNTDCEQILFMDDDIRVEPDSILRALALNRFAKVPTLVGGQML
NLQEPSHLHVMGEMVAAENFMWTNAINTEYDHNFAKYKLNDEEEYRSRLL
HRRIDVDYNGWWMCMIPRQVAEELGQPLPLFIKWDDAEYGLRAGEHGYPT
VTLPGAAIWHMAWSDKDDAIDWQAYFHLRNRLVVAALHWDGDVKGLIASH
FKATIKHLICLEYSTVAIQNKAMDDFLAGPDHLFSILESALPEVRRMRKD
YPDAVVLESATALPPPSDKTWRKKVEIPTNPLAISLRLGRGIAHQLKPHD
PVHHQRPQINVATQDARWFSLCKVDGVTVTTADGRGVVYRQRDREKMFEL
LRESLKRQAKLARKFDRMRKVYRAALPTLTSKDEWERVLNSTSGSGHG
315446510YP_004079389.1 4-hydroxybenzoate polyprenyltransferase [Mycobacterium gilvum Spyr1MSTSEVARDANSTAGPPKNIVTGVIKAIRPRQWVKNLLVLAAPIAALGGD
IRYDYDEMAINILIAFVAFSLAASCIYLVNDSRDVEADRQHPTKRFRPIA
AGVVPEWLAYTLAVVLGLAALGISLLASVNLTLVIGVYILMQLAYCFGLK
HQAVLDICIVSSAYLIRAIAGGAAAGIPLSQWFLLVMTFGSLFMVAGKRY
AELQLAERTGAKIRKSLESYTASYLRFVWTVAATSMVVCYSLWAFERDGA
AASWYAVTIIPITIAILRYAVDVDGGLAGEPEEIALKDRVLQLLLLTWIG
TIGAAVFLG
315446508YP_004079387.1 esterase [Mycobacterium gilvum Spyr1]MVALAAIVLPGLISAVGGSATAGAFSRPGLPVEYLMVPSAGMGRDIKVQF
QSGGPNAPGVYLLDGLRAQDDFNGWDINTPAFEWYLDSGLAVVMPVGGQS
SFYSDWYSPACGKAGCSTYKWETFLTQELPAYLAANKGVDPNRNAAIGLS
MAGSAALTLAIYYPQQFQYAGSMSGFLNLSEGWWPALVNISMGDAGGYDA
NDMWGRTEDPNSAWKRNDPMVNIGKLVANNTRIWVYCGDGKPAEVNGNVA
GNNLPAKFLEGLTIRTNRTFQEEYIAAGGKNGVFNFPANGTHDWPYWGQQ
LQQMKPDIQRVLGAVPQPSAPAAPVAAEAPGAGG
315446506YP_004079385.1 hypothetical protein Mspyr1_50210 [Mycobacterium gilvum Spyr1]MIAGMEPEVETAPPHGRSTAVLPGPDSPGTRSNALIVSPHQQSYLDALAD
AGVEPSSELSALSIGSYVCQARAAGQTDQAVWDFVEPLVRNDIRDADAAA
EIRAELPSPDAAHSTTADYIRIATDRLC
315446504YP_004079383.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MAFHNPFLKDGLIKFPDNGNLVRHVERWAKVRGDKMAYRFIDFSTERDGV
ERDLHWADFSTRNKAVGARLQQVTEPGDRVAILCPQNLDYLVAFFGTLYS
GRIAVPLFDPNEPGHVGRLHAVLDDCTPSAILTTTAAAEGVRKFFRTRPA
KDRPRVIAVDAVPDEVGATWEPVDVQHDTIAYLQYTSGSTRIPTGVQITH
LNLATNVVQVIEALDAEEGDRGVSWLPFFHDMGLITVLLSPMLGHHISFM
TPAAFVRRPGRWIRAMARKPDDTGGVISVAPNFAFDHAAARALPKDDEPP
LDLSNIKCILNGSEPISAATVRRFNEAFSPYGFKPEAIKPSYGLAEATLF
VSTTPIHEHPKIISVDRDELNSHRFVQVPDDSPKAVAQAGAGQIGIAEWA
VIVDNDTATELPDGQIGEIWISGQNMGTGYWNKPDETIATFQNLLKSRTT
PSHAEGADADATWVRTGDLGAYHDGELFITGRVKDLVIIDGRNHYPQDLE
YSAQEATKALRTGFVAAFSVPANQLPDEVFDNAHAGIKRDPDDSSEQLVI
VGERAPGAHKLDMGPIIDDIRAAIAVRHGVTVRDVLLTPAGAIPRTSSGK
IGRRACRSAYLDGSLRSGKVANAFPDEVD
315446502YP_004079381.1 acetyl-CoA carboxylase- carboxyl transferase subunit alpha [MycobacMTERTTAELLADLREKLELAKEPGGEKAVAKREKKGIPSARARIHSLLDP
GSFLEIGALAKTPGDPDALYGDGVVTGHGTINGRPVGVFSHDQTVFQGSV
GEMFGRKVAKLMEWVAMVGCPIIGINDSAGARIQDTATSLAWYAELGRRH
ELLRGLVPEISLIFGKCAGGAVYSPIQTDLVVAVRDQGYMFVTGPDVIKD
VTGEDVTLDELGGADAQARYGNIHQVVESEAAAFQYVRDYLSFLPANTFD
DAPIVNPGLEPEITPHDLELDAIVPDSDNQAYDMMEILLRIFDDGDVFQV
AEQAGPAIITAFARVDGRPVGVIANQPMYMSGAIDNEASDKAARFVRFCD
SFNTPLVFVVDTPGFMPGVEQEKGGIIKRGGRFLNAVVEASVAKVTITIR
KSYGGAYAVMGSKQLTSDFNFAWPTARIAVIGADGAAQLLVKRFPDPTAP
EVQKIKADFIEGYNANLAVPWIAAERGFIDGVIEPHETRLLLRKCLHLLA
DKQINRVHRKHGLTPI
315446500YP_004079379.1 serine/threonine protein kinase [Mycobacterium gilvum Spyr1]MPLSAGEVISGYTISRMLGAGGMGEVYLAKHPRLPRYDALKVLSASVSTD
SEYRERFNREADIAASLWHPHIVQVHDRGEFEGRLWISMDHVEGTDAARL
LAERYPDGMPPALVARLVTAVGEALDYAHQRGLLHRDVKPANILIADPET
ENERIMLADFGIARRVGEVSALTGTNMTVGTVAYSAPEQLTADEAIDGRA
DQYALAATAFQLLTGKAPFQHSNPAIVISQHLTAQPPSIAVHRPELSGLG
AAFQKALAKSPADRYDRCVDFARALSNRSTVTAAGDPDATAHAPATPTGP
RHAKPAAPTAQASASRGRILVGAAVVLAVVAVVAVVLLAVFEKDEIRSEA
RPTTAVPVVVVGADCATLGAAGITGDGKSAYCARLSSTGEPLWSLYDGEI
PHPSATPEPGSAAPAEAPVLVCVEQTGQSQADCHGDIQQENSDPTANDNQ
G
315446498YP_004079377.1 cell wall arabinan synthesis protein [Mycobacterium gilvum Spyr1]MPAPSARLVAVLAGLAGMVLCGLAPLLPVTQTTASITWPQPGGPGNQTQS
AGTDGFVSDITAPLVSGAPRSLAVTIPCTAVASLPADGGVVFSTNPADGI
DAGRNGLFVRANADVVYVAFRDTVAAVAPRDAVDSGACSELRVWADVGTV
GADFVGIPDATGTLPPDKRPQVSGVFTDLRVAPGAGLTARIDIDTRFITT
PTALKLAVMTLGVVCVLASILALAILDRAHGRQVPRALRRGRSAGLWTWL
TDAAVIGGLLLWHVVGAQSSDDGYNTTIARVSGEAGYITNYYRYFGASEA
PFDWYQSVLAHLASISTASVWLRLPATAAAIGTWLILSRCVLPRLGRRLA
GNRVAVLTAGAVFLAAWLPFNNGLRPEPLIAFGVVAAWMLTELAIGRRRL
VPFAVAIVIAVFCVTLAPQGLVAVAPLLVGARAITRIVAARRATHGLLAA
LASFGAAASLLFVVVFRDQTLATVAESVRIKYVVGPTIPWYQEFLRYYWL
TVEESVDGSLARRFSVLILLVCLFGVIALLLRRGSVPGAHNGPVWRLVGT
TGIGLLLLTLTPTKWAVQFGAFAGLAGALGAVTAFGVARVGLHSRRNLAL
YVTALLFVLAWATSGINGWFYNANYGVPWFDKQPVILSYPVTTIFLVLAI
ACGLLAGWLHFRMDYAGHTQVADTGRNRAIASTPLLVVAVIMVVLELGSM
VKATVGRYPAYTIGSANIAALRGDRCAMADDVLVEADTNAGMLSPVPGQR
FGEYGPLGGENPVGFTPNGVSDTLEPAEPVGANPGTVNSDGPVDKPNIGV
GYTAGTGGGYGPEGVNGSRVFLPFGLDPQTTPVMGSFDQNDVAAKATSSW
YQLPPRTPDRPLVAVAAAGAIWYYNEDGSFNYGQSLKLQWGVHNPDGSYQ
ALNEVDPIDIFTQKAWRNLRFPLSTAPPEANVARIVADDPNLSEDQWFGF
TPPRVPVLQTAGEFLGSETPVLMDIATAANFPCQRPFSERLGVAELPQYR
IMPNFKQIVVSSNQWQAAEDGGPFLFIQALLRTESIPTYLSGDWYRDWGS
LERYLRVVPADEAPDAVIEEGSTRVFGWSRGGPIRALP
315446496YP_004079375.1 hypothetical protein Mspyr1_50110 [Mycobacterium gilvum Spyr1]MRGALATLGQMLVGAVVAAVVATVSLIAIARVEWPAYNSSNQLHALTTVG
QVVCLLGLLAAGILWRRGRQTVARIGSALFLSAFTVVTLAMPLGATKLYL
FGISVDQQFRTEYLTRLADEPGLRDMTYIGLPPFYPAGWFWLGGRLAALT
GTPAWEMFKPWSIISITIAIVLAFVLWAAMIRFEYALVVSTATAAAALAY
SPAEPYAAIIAVLLPPVFVLAWSGLAGRERSGGWAAVIGTGIFLGVAGLF
YTLLFAYAAFTIAIMAVLLAAARRHWDPLLRVVVIAVLSGLIMLLTWGPY
LLAALRGTPAESGTAQHYLPKDGAELSFPMLQFTLLGALCMLGTVWLVVR
ARSSTRAGALAVAVLAVYAWSLLSMLTTLVGTTLLSFRLQPTLTILLAAA
GAFGFVEVARMAAARVRPPNARRVVAVATAVGAIGAVTFAQDIPDVLRAD
IVVAYTDTDGYGERADRRPPGAEQYYREVDARILEVTGRPRNETVVLTAD
YSFLSYYPYYGFQGLTSHYANPLAEFDKRAGAIEGWSMLTDADAFIAALD
AMPWEPPSVFLMRRGANDTYTLRLAEDVYPNQPNVRRYHVSLDDALFDDP
RFDVSTIGPFVLAIRKPITI
315446494YP_004079373.1 FAD/FMN-dependent dehydrogenase [Mycobacterium gilvum Spyr1]MLSTEFPTTAQRLTGWGRTAPSVAQVLSTPDPEVIVKAVTRAAENPGRGV
LARGLGRSYGDNAQNGGGLVIDMSSLDRIHSMDADSRLVDVDGGVNLDQL
MRAALPLGLWVPVLPGTRQVTIGGAIACDIHGKNHHSAGSFGNHVRSIDL
LTADGQVRTITPDGPESPLFWATVGGNGLTGIILRATIEMTPTETAYFIA
DGDVTTSLDETIAFHSDGTEDNYTYSSAWFDAISPPPKLGRAAISRGSLA
TVDQLPKKLQKNPLKFDAPQLLTFPDLFPNGLANKYTFGPIGELWYRKSG
TYRGKVQNLTQFYHPLDMFGEWNRAYGAAGFTQYQFVVPTTAVDEFKAII
VDIQRSGFYSFLNVFKLFGPGNQAPLSFPIPGWNVCVDFPITAGLNEFLN
VLDKRVLQFGGRLYTAKDSRTTAETFHAMYPRIDEWIAVRRNVDPDGVFA
SDMARRLELL
315446492YP_004079371.1 hypothetical protein Mspyr1_50070 [Mycobacterium gilvum Spyr1]MFDSLVPEPGALAGLSDAELVDAAGAAARAENAVCARKLAVMAELFTRRV
DLAPEDRLNWWVDPDAAVAAEIAAAVTITQGLATHQTYRAVVLRDRLPKV
GALFLQGLLSELLVRAIITRTDLITDPELIAAVDADLAADILGWGPLSAK
KTEAAIDHIVERHDPDAVRQSRQHDVGRTIEIGNPGDAPGYTTVWARMFA
GDAAAGHRTLTTMAYSVCDNDPRTLDERRNDALTALFHGITTLACRCAND
DCDAATNPRPPRELTIYALTDQTTADAVSEEPRGDATAESDNEDAPETDG
VAAADADCTPAQHPTPPPTSSPPTAPTAPTAPKPRRSKPTLLPGRSGYLF
GSGFMSAPLFDALLDGAKIREILHPGQAGPEPRYTPSTALADFIRCRDLT
CRFPGCDTPATEADIDHTVAHPVGPTHASNLKCLCRFHHLLKTFWTGPGG
WHDRQHPDGTITWTSPTGHTYITHPGSRLLFPTLCRPTATLWTGDPPRNP
TSNNRGSMMPRRAKTRAQNRATYITAERTRNAAHRTDSPRGNDPPPF
315446490YP_004079369.1 GntR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSSWSNSGSRDLHLDLREALRPGVRGSRNALVAALREAVRSGRLSAGTTL
PPSRTLAADLGLARNTVADAYAELVAEGWLASRQGAGTWVVDTARASSQP
PPVPPRPHGARAAPVHNLMPGSPDVAEFPRSQWAASARRALTRAPTDAFR
MGDPRGRPELRSALAEYLARARGVRTSPESLVICAGVRHAVELLARTLGG
PVAVEAYGLFVFRDAIAACGVQTVPIGVDDDGAVIADLDDTDARSVLLTP
AHHNPLGMPLHPSRRAAVIEWATRTGGYILDDDYDGEFRYDRQPVGALQA
LRPDRVAYLGSTSKSLSQALRLGWMALPAELVDQVVETAGGQQFHVDVVS
QLTLADFLTAGHYDRHIRRMRMRYRRRRDMLVSALSPFAVGIGGLAAGVN
LLVTLPDGAEPELIRRAGEAGIALVGLSMMRHPLAGSGVSDRDGLIVGFA
AAPEHAFPAAVSALCEVLRASGL
315446488YP_004079367.1 transposase- IS30 family [Mycobacterium gilvum Spyr1]MPSGVAVGWPVKREFFDLVCDGMPTTEASLAVGVSRRTGWFWWRQAGGMK
LRKGGDGLGGLADAGDLERPGGRGRRLSFAERFEIDRGLQAGRSYAEIGR
ELGRDRSVIAREVKRNCLPDGRYHALMAHAAASQKARRPKTFKLDNPVLC
ALIAGWMDEGWSPKLISQVLAEVYAGDKLMQVSHETIYQCLYVQTRGQLR
ADLHKCLSTKRQARSPRGHRGRTGVYDPDTIFTISDRPAEANDRAVPGHW
EGDLILGARHGSAIGTLVERSTRFVILLHLPVDHTAQSVAAAMIEAMGEL
PAHLRRSITWDRGSEMASWKHIQMQLNSPVFFCDPHSPWQRGTNENTNRL
LRFWFEKGSDLSVHTRDDLNIVAAKLNNRPRPTLDLDTPAQRMAALLSQA
A
315446486YP_004079365.1 ABC-type polysaccharide/polyol phosphate export systems- permease [MTIMDAAARSRTFGRAWGDLVAGFGKRELWLHLGWQDIKQRYRRSVLGPF
WITIATGTTAVAMGGLYSMLFKLELSEHLPYVTLGLIVWNLINASILEGA
DVFVANEGLIKQLPTPLSVHVYRLVWRQMLLFAHNIIIFVIIAIIYPKPW
SWADLSVIPALLLLALNCVWVALCFGILATRYRDISPLLGSLVQLLFFMT
PIIWNESTLQAQGAGGWAKIVELNPLLHYLDIVRAPLLGAEQELRHWVVV
LVLTVVGWGFAALAMRQYRARVAYWV
315446484YP_004079363.1 polysaccharide/polyol phosphate ABC transporter ATPase [MycobacteriMTRPADEPFIETRNAWVEFPIFDAKTRSLKKAFLGKAGGAIGRNDSNVVV
IEALRDITLSLKMGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGVAEVRGR
VAPVFDLGVGMDPEISGFENIIIRGLFLGQTRKQMLAKVDEIAEFTELGD
YLNMPLRTYSTGMRVRLAMGVVTSIDPEILLLDEGIGAVDAEFLKKAQTR
LADLVARSGILVFASHSNEFLARLCDTAMWIDHGTIRMQGEIEDVVRAYE
GEDAARHVREVLEENKRENRSA
315446482YP_004079361.1 cysteine desulfurase [Mycobacterium gilvum Spyr1]MAFDVARVRGLHPSLGDGWVHMDAQNGMLLPDSVGRAVSTAFRGSMPTTS
SAHPAARRSAAVLAAARQAVADLVNADPAGVVLGADRAVLLTSLADAASG
RVGLGYEVVVTRLDDEANIAPWLRAADLFGAQVKWAEVDIETGELPTWQW
ESLVSRPTRIVAIASASATLGTVTELREVTKLVHEVNGLVIVDHSAAAPY
RLIDINEIDADVVAVNALAWGGPPIGALVFRDPSLISAFGSVSLDPTATG
AARLELGAHQFGMLAGVVASIEYLATLDDSAQGSRRERLAVSMRSASAYL
SALFDYLLTSLRSLPTLTVIGSPEVRIPVLTFAIDNVSAERVVQRLADNG
ILAIANANSRVLDVIGVNDVGGAVTIGLAHYSTAAEVDQLVRALASLG
315446480YP_004079359.1 MarR family transcriptional regulator [Mycobacterium gilvum Spyr1]MEGIIGGRTASDTPGLDIAEQRAWQNFLDAALRLYATMNRSLSDEHGLTL
NDVRLLDLLAKSPTGSARMGDVAEALMSLPSRVTRQIHRLEVQGLVGRVA
SPDDGRGVLASITAEGRTALATAMQTYGSAVRTHFLDRLSRPQVTAMGEN
CRRISAGLKAGGPPAKIGRV
315446478YP_004079357.1 hypothetical protein Mspyr1_49920 [Mycobacterium gilvum Spyr1]MTVLFLVTIVCVVANAAIAIADYAKAGFVLRNSAQVHVPVSALPYLATAK
LAGAVGLVIGLVAVPWVGVAAGIGLVLFFIGAVGAHGRARVFHNIAFPGF
YLLLSAASTVYMAQLAGGG
315446476YP_004079355.1 hypothetical protein Mspyr1_49900 [Mycobacterium gilvum Spyr1]MKTHVRVTAAALVGAGLVLGLTTGCSRTTEGVVAQTTEPGPPLPSQGAPG
QPGEPGLPGLPGLPGMPDIEIPNLPLPTRNTDVPEVPAPANSLDMTCDEY
NGLDEATRVAVVREILSQEGNPLGPDGEFIGQILADAACQFIRSATVSEV
LMGGTPP
315446474YP_004079353.1 cytochrome C oxidase subunit I [Mycobacterium gilvum Spyr1]MTAESSVDKLPALTPRRPFPARVGPKGNLIYKLITTTDHKLIGIMYVVTC
FVFFLIGGIMALFIRTELAMPGLQFLSNEQYNQLFTMHGTAMLLFYATPI
VFGFANLVLPLQIGAPDVAFPRLNALSFWLFLFGALIALAGFITPGGAAD
FGWTAYSPLSDAIHSPGVGVDLWIFGLGVGGLGTILGAVNMVTTVVCMRA
PGMTMFRMPIFTWNILVTSILVLLIFPLLTAALFGLAADRHLGAHVYDPA
NGGVILWQHLFWYFGHPEVYVIALPFFGIISEVIPVFSRKPIFGYTTLVY
ATFSIAALSMAVWAHHMFATGAVLLPFFSFMTFLIAVPTGIKFFNWIGTM
WKGQLAFETPMLFSVGFILTFLLGGLSGVLLASPPLDFHVTDSYFVVAHF
HYVLFGTIVFATYAGVYFWFPKMTGRLLDERLGKLHFWLTFIGFHLTFLV
QHWLGDEGMPRRYADYLPTDGFTTLNGISTIGAFMLGASMLPFVWNVFKS
WRYGEVVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYP
HMRERMRAEAHAGRSHGPDDGDVTRLDEENVRT
315446472YP_004079351.1 phosphoesterase [Mycobacterium gilvum Spyr1]MSRLGCVRLLLIADTHLPKRAKDLPAEVWDAVDDADLVIHAGDWVEPDLL
DRLEARAKRLVACWGNNDGPELRRRLPERADVVLDGVRFTVTHETGASSG
RDARMAKAYPDTDVLVFGHSHIPWDTIAASGLRLLNPGSPTDRRRQPHCT
YMTATVQDGELRDVELHRLGAPAGG
315446470YP_004079349.1 alkyl sulfatase-like hydrolase [Mycobacterium gilvum Spyr1]MDSKPPAPTIEAAHREHLGTLPFEDTRDFADADRGFIAAQQPCVITAADG
RVVWDNDVYAFLTGEAPPTVHPSLWRQSTLVAKQGLYEVVPGIYQVRGFD
LSNITFVEGDTGIIVIDPLVSTEVAAAALALYRQHRGDREVRAVIYTHSH
VDHFGGVLGVTTQADVDAGRVAVFAPEGFTAHAVQENVYAGTAMTRRAAY
MYGTVLERGPQGQVGCGLGQTPSTGEVAIIVPTVDIRETGEVHTVDGVEI
EFQMAPGTEAPAEMHFYFPRFRALCMAENATHNLHNLLTLRGALVRDPHG
WAGYLTEAIDTFVDRADVVFASHHWPTWGSERIVEFLSLQRDLYAYLHDQ
TLRQLNQGYTGIEIAESFAMPPALENAWHARGYYGSVSHNVKAVYQRYMG
WFDGNPGRLWPHPPEAIGPRYVAAMGGIDRVVELAQAAVDEGDFRWAATL
LDHAIFTDENHAGTRALYADTLEQLAYGAETATWRNFFLGGATELREGNF
GTPVQADSAAMLGQLSPEQMFDVLAISVNGPRAWDLDLAIDVTFLDTDTN
YRLTLRNGVLVYRKVAADEESAHATLRLASKLRLLTLAAGDDSSPGLEIA
GDAGVLSSLVSVLDKPDPNFNIVTP
315446468YP_004079347.1 fructose-2-6-bisphosphatase [Mycobacterium gilvum Spyr1]MQLLLVRHALPMRSEPGQGSDPSLSPEGVEQARRLPDALARFPITRLVSS
PQVRAIETGQPVADKLGLTIEVDDRLAEYDRDLPHYIPIEQIAKENPEEL
QRLVDGHLPSSVDETQFLARISAGIDDLVASADRDDTVVVFSHGGVINVL
LHQILGTERLLSFHVDYASVTRLLWSASRERLAVAGVNGTEHVWDLLPRN
HRW
315446466YP_004079345.1 transglutaminase-like enzyme- cysteine protease [Mycobacterium gilvMKRDVGAELDVEITDPTTLEFQIAVAPQPGAEVTESLSFVLDGREIPLSE
IHEISGDHGNRIHKLEAPVGNLKVSYSATVIGQADPAPVRDLDLSTYLRP
SRYAEADKFFGFAGTEFGDIADSATILEKISSWVGARLNYVPGSSDPIDG
AADTLLAGSGVCRDYAHLVVALLRAVNVPARLVSVYAPGCQPMDFHAVAE
AFVDGQWRVVDATLLAPRQSLVRIATGRDAADTAWLDNHKGQITVNNMEV
FATVDGDLPRDSIDQLVSIR
315446464YP_004079343.1 glycine betaine/choline ABC transporter substrate-binding protein [MTVTRRTGAAYVPVVLALIAVLLAACGSSNPLGGGEISGDLKTIKVGSAD
FTESKIIAEIYAQALEANDFTITRQFGIGSRETYIPAVQDHSIDLIPEYT
GNLLQYFDADSTATTPDEVLLALFNALPGDLSILYPSPAEDKDTLAVTEE
TAQRWNLTSIADLAARSPEVKVGAPSEFQTRYTGLVGLKEKYGLDIAPAN
FVAISDGGGPATVQALSSGAITAANIFSTSPAIEQSRLVVLDDPENVFLA
ANVVPLVASQKMSAELKTVLDAVSAKLTTEALIELNTSVEGNQGIDPDEA
AQKWIADNGFDRPIGG
315446462YP_004079341.1 ABC-type proline/glycine betaine transporter- permease [MycobacteriMRYLFTHLDDLWVLTLIHLRLSLIPIVLGLLIAVPLGALVQRTTALRRLT
TVTASIIFTIPSLALFVVLPLIIPTRILDEANVIVALTLYTVALLVRAVP
EALDAVSPAVLDAATAVGYRPLTRMLKVELPLALPVLIASLRVVAVTNIS
MVAVGSVIGIGGLGTWFTEGYQANKSDQIIAGIVAIFVLAIVIDTLIMWL
GKLLTPWTRAQPRTTRTQKAGVSA
315446460YP_004079339.1 hypothetical protein Mspyr1_49710 [Mycobacterium gilvum Spyr1]MSEADRSGTQSWPAVLTWRAHDEPRMESVRVQLSGKRVKAYGRVVAAATS
AHPAFSASYDLVTDELGATKRLSLTVTLAERERQLSIARDEENMWLVQEH
SGQTSRSAFDGALDVDMVFSPFFNALPIRRLGVLPGSGESVTVPVVYVRV
HDLSVVVESISYAATDSGISLTSPVADTSITVDADGFILDYPGLAERI
315446458YP_004079337.1 hypothetical protein Mspyr1_49690 [Mycobacterium gilvum Spyr1]MGAQSAQKQERVTDVPDGFGVAVVREDGKWRCTAMQKAALTSLTAAETEL
RELRSAGAVFGILDIDDEFFVILRPAPSGTRLLLSDATAALDYDIAAEVL
EKLDADIDDDELERCDPFEEGDLAVLSDIGLPEAVLGVILDESDDLYADE
QVGRIAREMGFADELSALLDRLGR
315446456YP_004079335.1 hypothetical protein Mspyr1_49660 [Mycobacterium gilvum Spyr1]MNDTAHDLPSPDEFRRKMAHLDREFADARRYLSRLSAEDYESLSALMAEI
HRNGRAMTVLAAMAVQALDFAQLAADRLDGGVQKWLDESVMAQDTAENER
DQSELGGEA
315446454YP_004079333.1 CsbD-like protein [Mycobacterium gilvum Spyr1]MGADDKASNKIDDLGGKAKEGLGKLTGDKGTENEGKFDQAKSSIKDAGEK
IKDAFKN
315446452YP_004079331.1 PTS system mannitol-specific transporter subunit IIC [MycobacteriumMSQTTVDDAPARTGVRVRVQKLGTALSNMVMPNIAAFIAWGLITALFIEQ
GWLQGIFAGLKDPDGWVAKIGGWGSYDGAGIVGPMITFLLPILIGYTGGR
MIHGNRGAVVGAIATVGVVTGADVPMFLGAMIMGPLGGWCMKKIDAIWDG
KIRPGFEMLVDNFSAGILGMILAVFGFFGIGPIVSAFTRGAGNAVDFLVD
NDLLPLTSILIEPAKVLFLNNAINHGVLTPLGTTQALETGKSILFLLETN
PGPGLGILLAFTFFGKGVARASAPGAAIIQFFGGIHEIYFPYVLMKPKLI
IATILGGMTGVFINVLFGSGLRAPAAPGSIIAIYAQTAGGSFLGVTLSVL
GATTVSFVVAAFLLKTDKAAEEQDLAAATASMESMKGRKSSISSQLVGAS
SGGPRGPIKSIVFACDAGMGSSAMGASVLRRKIQQAGFGDVKVTNSAISN
LTDSYDLVVSHRDLTARAGQRTGSAIHVSVDDFMSSPRYDEIVEQLKQSN
GGGSEAEPAVDDGSAGSSDGDVLALSSIVLNGSASSAADAISEAGRLLVD
AGAVEPSYVDAMHERESSVSTYMGNGLAIPHGTNEAKGAIRRTGLSLVRY
PEPIDWNGKPAQFVVGIAGAGKDHMALLSKIAQVFSKPDEVARLRGAQTP
EEIRSILMGS
315446450YP_004079329.1 hypothetical protein Mspyr1_49600 [Mycobacterium gilvum Spyr1]MDGDIDEGGPDDTLSPSESLDSDEVRNDDGDIVVDPPDRWIEPEEHQTLD
EQLAAEVPDTTAAVDLPDDRPTRQDHGQIDGTPEDGDSFFTVVDEDEKQR
VPGDPEADSIIED
315446448YP_004079327.1 dihydrodipicolinate reductase-like protein [Mycobacterium gilvum SpMYRVIQWGTGAVGVEMMAAILDSRSDLELVGARVYSDAKDGADLGELLGR
APIGVRATTDADAILALDADCVLYTPRTARVDDVCAVLASGKNVATTAFM
FHPRRMAPVDRDRVLAACEAGASSVHGSGLNPGNLSGVLPLALSGMSRRI
DSITLQERADWSVYESTGITFDNMAFGQPVDSIGPTSTEFLAFNSSIFSE
QVWFLGDALGADLDEVTADVEAVAAQRDHDIFGHPLRAGTTAGQRWSWKG
LRAGETRVEIETLWTVGNEYPGHWPTPRHGWTLTIEGDPSMQTHFVSLAS
FTRAAEMAEHVRSANVATAMQVLNAVPAVCEAEPGFATSASLPLIYNSEA
FGRQP
315446446YP_004079325.1 hypothetical protein Mspyr1_49560 [Mycobacterium gilvum Spyr1]MKSLVRALLLTAVPSAVLIGAPAANADTVAYLVNVHVRPGYNFPNAEAAI
GYGNSVCARVAGHMSYRELVDQVKADFRTTDYYQAGYLINQAVNELCPAQ
IWQLRQSAAGYTPF
315446444YP_004079323.1 hypothetical protein Mspyr1_49540 [Mycobacterium gilvum Spyr1]MSTRWTLAASTAVAALAVAGCASSPPEYEPAPGTLVAGTAQITVNGNDLG
ITDTVQCDPAGTLTMMRTRDPDDPDAPGISAIIASEDELVVRGVGINDLG
GFTGSYNRGLGGEATVSMTGRTYDISGTADGFDTDNPSFRTTGNFQIKIA
C
315446442YP_004079321.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MTTAAEPQSLLLQMLDPAHRADPYPLYARIRAQGPVQLPANNLTVFSTYA
ACDEILRHPHASSDRLKSTLAQRAIADGAQPRPFGPPGFLFLDPPDHTRL
RRLVSKAFVPKVVKALEPEIVALVDALLADAGGTFDAIEGLAYPLPVAVI
CRLLGVPLADEPEFSAASALLAQSLDPFATVTGSAGDGFEERMQAARWLR
GYLRELISQRRRDPGEDLMSGLIQVEESGDQLTEDEIVATCNLLLVAGHE
TTVNLIANAILALLSNDGQWSALAADPARVGAVVEETLRYDPPVQLVGRI
AAEDMTVGTTTVPKGDNMLLLTAAAHRDPDAVDRPDEFDPDRESFRHLGF
GKGPHFCIGAPLARLEAAVALTALTSRFPGAQLAGEPSYKQNVTLRGMSE
LPITL
315446440YP_004079319.1 amino acid ABC transporter ATP-binding protein [Mycobacterium gilvuMTTDTCVAAREVHKSFGPLEVLKGVSFTVARGSATAIIGPSGSGKTTLLR
TLNALDVADSGVITVGDVEIDFARPVSKDQLRRYRAQSGFVFQAHNLFPH
MTVLQNVTEGPVVAQRRPRDEVEAEALELLDQVGLKDKRDAYPFQLSGGQ
QQRVGIARALALKPKVVLFDEPTSALDPELVGEVLGVIRDLAVQGWTLVV
VTHEIQFARGVSDQVLFTDQGVILEQGSPAEVIGDPKEERTRQFLQRILN
PL
315446438YP_004079317.1 glutamyl- or glutaminyl-tRNA synthetase [Mycobacterium gilvum Spyr1MRSTRTAGAGRFAPSPSADLHIGNLRTAVLAWLFARSTGRRFLMRVEDLD
DRTHTDIADRQLADLAALGITWDGDATRQTDHPERYDAVVDGLAGSGLLF
ECYCTRRDIAQAPRAPHAPEGAYPGTCRDLTDAERDQRRDETGRPPALRL
RTDTTSHTVHDVLHGDYTGLVDDFVVRRGDGVPAYNLAVVVDDAASGIDQ
VVRGDDLLSSSPRQAYLARLLGHPEPVYAHVPLVLNADGARLAKRDGAVT
LAEIGLSKALAQIADSLGYAARSVEAMLDEFDPQRLPRQAWVYQPG
315446436YP_004079315.1 hypothetical protein Mspyr1_49460 [Mycobacterium gilvum Spyr1]MFTSLQGRSAAVTGGSKGIGRGIAETFARAGINVVITARTQDDIDATVAD
LAGLAGTVTGVAADVTSPEDCRRVVETAIERHGGLDIVCPNAGIFPSGRI
ADLTPDDIEQVLGVNFKGTVYIVQAALDALTASGHGRVIITSSITGPITG
FPGWSHYGASKAAQLGFLRTAAIELAPKKITVNAVLPGNILTEGLVEMGQ
SYIDQMAAAVPAGKLGEVADIGNAALFFATDEAAYITGQSLVVDGGQILP
ESPEALADL
315446434YP_004079313.1 hypothetical protein Mspyr1_49440 [Mycobacterium gilvum Spyr1]MALSEAPSSAPTRTDIRVYLLVEDLQQQFAAYLGTPTRARGYPPYAGEHA
LIVEVSPALAIERVIDLALREVPGIQPGILYVERQFGVLEIHSGDLADVR
RAGEAILTGTRSSASDQLRPRVLYHDVIEDITDQHAVILNRNRQASMVLP
GQSLLVYEMTPALFAAVAANEAERAAPGLTLVDVQMIGAAGRLYISGSTE
DVVVARDRITEVLAAIEGREH
315446432YP_004079311.1 carbon dioxide concentrating mechanism/carboxysome shell protein [MMIRGTVIGQVWSTRRIDGIPAGAFLEVEVDGSGSRLIAFDVLGSGVGEHV
LVTQGSVAASWFTGTPPPVDALIIGSIDPTG
315446430YP_004079309.1 BMC domain-containing protein [Mycobacterium gilvum Spyr1]MAELRSFIFIDRLQPQTMSYLGTWIKGALPRAGVAAQIIEVAPGLDIEGV
TDVALKHAEVQAGVLVVERQFGYLEFHGDTANVEAAADAALAELGRDAGS
ATAPQILASRIISSIDQQHAFLINRNKIGSMVLAGESLYVLEVSPASYAI
LATNEAEKAADVKVVDFRMIGATGRVYLSGSESDIRQAAAAAEEALARSV
R
315446428YP_004079307.1 ornithine/acetylornithine aminotransferase [Mycobacterium gilvum SpMYDYGTFSFDSKAQVLERAKEFWNPDKTQFWTDTGVDLVIDRRQDYFLWD
MTGRRLIDMHLNGGTYNLGHRNPEVMQAITDGMAHFDVGNHHFPSVARTA
LAQKLIESAPQSLSKVAFGSGGGEAIDIALKSARHATQRRKIVSIVKAYH
GHTGLAVATGDDRFAKLFLADRPDEFVQVPFGDTDAMEQALRGRDVAAVI
METIPATYGFPLPPLGYLEAVKDLCVRYDALYIADEVQTGLMRTGEMWGI
TKHGIEPDIMVTGKGLSGGMYPITAALLSDRAAQWLHQDGFGHISTFGGA
ELGCVAALKTLEITSRPEVRSSVHYIADIFAQGLAAIQADHPGWFVGIRQ
NGVVIGLEFDHPEGAKFVMRELYQNGVWAIFSTLDPRVLQFKPGLLLNRD
LCEDVLDRVEVAVGRAKLAATGRRKP
315446426YP_004079305.1 propanediol dehydratase- large subunit [Mycobacterium gilvum Spyr1]MADELGRFRVLNSKPVNLDGFSVPDAALGLVAMSSPHDPAPSLVIRDGAV
VELDSKDVAEFDVIDEFIARYGIDLSVAEEAMALDDETLARMVVDINVPR
AGVVRLIGGTTPAKLARVVALLSPVEMQMAMVKMRARRTPSNQAHVTNQL
DDPLLIAADAASAVAYGFREVETTVPVLGDAPSNAVALLIGSQVGTPGAM
AQCSIEEALELRLGLRGLTSYAETISIYGTEQVFIDGDDTPFSKAILTSA
YASRGLKMRVTSGGGAEVLMGAAQKCSILYLESRCVSLARALGSQGVQNG
GIDGVGVVASVPEGMKELLAENLMVMMRDLESCAGNDNLISESDIRRSAH
TLPVLLAGADFIFSGFGSIPRYDNAFALSNFNSDDMDDFLVLQRDWGADG
GLRTVSPEHLEAVRRRAAQAVQAVYRDLGLADYDDARVEDVVAANGSRDL
PAGHPKMVAEAAASIEARQLTVFDVIAALHRTGFTEEAEAITTLTRERLR
GDQLQTSAIFDEQFRVFSKLTDPNDYRGPATGYALTEQRRAEIDAIRQAR
SGAELTVDQEEHRGHVVVTDVEPAHQGSDPREVCIGLSPAWGRSVWLTLC
GLTVGEVLRQIAAGLEEEGCIARTVRVCSTIDTGLIGLTAARLSGSGIGI
GLQGKGTALIHRRDLAPLANLELFSVAPLLTAKMYRELGKNAARHAKGMA
PVPIFTGGTDESISARYHARAVALVALERDACEPGRAPVTVKVEAR
315446424YP_004079303.1 Diol dehydratase / glycerol dehydratase reactivase large subunit [MMVAGVDIGNHTTEILLAQVHGGTVTTVAHGQAPTRGRKGSRESVEGAAAL
LHRVEVDAGRRADELLLAALRPVDTATAPIPPAYSPSAPVRSLRRPDAST
PAGAGHAVGLHVLLTALQHGVSGGPVVVSVDETTDFEVAAQQISAAVDRG
WQVVGVIAAQDDAVLIRNRIPVDVPVVDEVDLTGLAPGARVALEVVEQGR
SYRAMADPIALSAALELPAGSLVDVAEFCRELADTAAIAVTPRTDTHRSP
PPDDDYVDLRDGGSVVRYSPAEANPVMRRVIPGSVREVRLKAVPSAAGGL
AVHDAFFTDLSGIDNGAWLRRGVADTQGTVVALLAAEEAADAADTLGTLT
GRRARTLSSEPEAAAWGARTTPGIPADTVICDIGGGTVDLIGIDRAVVAA
GAGESITVAVARVLGIPRALAEKVKRTPAVRVEGPHIAHEEDGRRVFLDS
PASADAIGRLCTRGGAGLVPFSDRLAAEEWRSLRLAVKQETVAANIVRCL
RAFEQPPAALVLAGGGALDDELMRTVGEALRSVPVVVGRTDVDGVHGPRF
AVARGLVAMYAQS
315446422YP_004079301.1 hypothetical protein Mspyr1_49320 [Mycobacterium gilvum Spyr1]MSDRAATAQPAATARSMTWGWIALTAITLGSWWLAPAHFTTTVAASTPIT
ALVLVLAIVKVRLIFRYFMEVHTAPRWLRHATDAWIAVLFGAVFVVYLL
315446420YP_004079299.1 hypothetical protein Mspyr1_49300 [Mycobacterium gilvum Spyr1]MSLLSPARLRDATSLAPGGKRDVRLVTWFFPAWYAVFGVIICILARVTPP
PRPDVTAADKVAFFASNGLTIQIGFAVLLILLGGAAVTNGLVAYQIMRMS
VGSVFAYGYLGGMSVGALPGFLLVGVCFLTATFRADRDPEMVSLLYDLGM
LSYNGSLGCFTAAYLVLAVAILYDKNEVFPKWFAYVSIWQIITEVIATQM
FVFYSGPFAWNGSVSFWLAVVVFSIWLGALIVLLRHACVREPADAPAVG
315446418YP_004079297.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MLKSRTPERGRKGEQTRERLLGAAIAEFKRDGMAAADIGAIVSAAGVAHG
TFFFHFPTKEHVLVELENREQERMAAELTRFYRRPHDVRATLTKAVTVLE
ALERRLGSRLFKDFLALHFSTRRPPSEEWSAHPVIVAVVEDLERARDRGE
IPADVDVMLRGVSFLVGLYALLITMPESREIRAPVIDEYVTTYMDALHAA
315446416YP_004079295.1 choline dehydrogenase-like flavoprotein [Mycobacterium gilvum Spyr1MAVTGYDYIVVGAGSAGCVLANRLSADPAIRVLLLEAGRGDRNPWLHIPK
GAGKLFDSERYMWHYETTPFGPDAHVEQWMRGKVIGGSSAVNGMIYNRGH
RADYDALVQMGNTGWGWDEILPIFKGFENHEFGPSHTRGAGGPLHISVPR
DPDPLCEDMIEAATGAGMWRVRDINESDGERIGYATSTIRGGRRVSAATA
FLKPVLHRPNLTVRTGATVRRVLFDGERADGVEIATGAGTEQVRAAREVV
LSLGSLNSPKLLQLSGIGPSDVLSAAGVPVFVERDNVGRRMREHRCATLR
YRLKEDLGYNKLLATNAGQALTGMKYLATRKGPLAAPSFDVVGFVKGQPD
SERPFGQVMMGPWTLPPYNTGEPVVIEREPGISCLGMVLRPTSQGYVEIT
SADPGAALRITPNYLTTEHDRTATAALVRRMRSIFEQSPIAERISHETYP
GPRVDSDAELVDAALEGGYCGYHAVGTCAMGPDDDDVVDSHLRVRGVDGL
RVVDCSVMPTIVAGNLNGPIMAMAWRAADFILHAS
315446414YP_004079293.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MSDLYYDPWHVDIDIDPYPTYRRLRDEAPVYRNDEHGFWGLSRYADVDVA
LKDTTRLSSAKGDILEVVMADPVMPPGIFINEDPPLHTIHRAIVARAFTP
KKMRAIEDKIRAFCVACLDPLVGGDRFDFVEDLGAELPMRTIGMLAGIPN
SEQPAVREHANEVLRNEAGKPMAIDKDRYFTGEMFGEYIEWRENNPSDDL
ITELLNVEFEDETGTVRKLTKQELTVFLAVVAGAGVETTGRLFGWMGKVL
AEHPDQRKELTSTPALIPSAIEELLRFEPPGPHVARYVATDDVTFHGVVI
PAGSPLLLMLASANRDERQFDDPDRFDIHRKQGGHLTFGRGAHFCVGAPL
ARLEGRVALEEVLKRWPEWDIDMSGARRSRTSTVRGWDSMPAVIR
315446412YP_004079291.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MNPETLRYDFDRHRPDYRDRFLDITHEMHQQCPLAWTDTYDGHWVAASSD
AVFELARCPFVSNDHDVNNERRGYKGISIPRMLEAEGFRGGMLEMDDPEH
RHYRTALNPYLSPAAVKRWEPFVDEIVCACLDDRIESGRIDFVDDLANVV
PAVLTLAMLGVPLQKWEMYNEPAHASVYTPPDSPDAERVRELYMAMGIDL
FTNLMEIRDNPRPGIINALATLRIDGEAPPDIELIGMLNLLIGGGFDTTT
ALTAHALEWLSEHPDERARLSADRDTLLNPATEEFLRYFTPAPGDARTIA
EDVAVNGVELREGQRLWLSWAMANRDPAVFTDPDQIVLDRKGNRHFSFGL
GVHRCIGSNVARTVFKSMLTAVLDRMPDYRCLPKETVHYDSIGVIQGMRH
LPAEFTPGPRRGAGVAETVARLQKICDEQGLARPITELKDAARIEEAV
315446410YP_004079289.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMRIGLTGGGSSVDKIVAQAQQAEADGFAALWYASAVAGDPLVAMAFAGRA
TSTIELGTAVLQTYPCHPLLQANRVAAAANAMGRPGLTLGLGPSHEPIVR
NVLGLNYDHPVRNTREYVQIVTGLLAGADIDLDGTDWTAHSAGRMTALDH
PVPVLLSALSPRMLRVATKFTDGVVLWLATATAIAERIAPAVAGGRIVAG
LPVAVHDDIREAREAIAATAGGYERMSNYQNIIRAGGGASAADVGIVGDE
AAVTRQLVELIEAGATDVWAQPVAVGADRAQRSASVKRTRALLAALAREG
315446408YP_004079287.1 hypothetical protein Mspyr1_49180 [Mycobacterium gilvum Spyr1]MEGRVAVITGGGTGIGRASALVLAEHGADVVLAGRRAEPLKETAAEVEAL
GRRALAVPTDVTDADACQALVDTTLAEFGRLDVLLNNAGGGETKSLMKWT
DDEWHHVLDLNLSGAWYLSRAAAKPMIAQGSGAIVNISSGAGLLAMPQAP
IYGAAKAGLQNLTGSMAAAWTRKGVRVNCIACGAVRTPGLEADAKRQGFD
IDMIGQTNGSGRIAEPDEIGYGVLFFASDASSYCSGQTLYMHGGPGPAGV
315446406YP_004079285.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMHIGFVSMNTPDDIAPDVLARELEQRGFESLWVGEHPQIPVSAAGSMPPA
LLHAQQRIWDPLLSLLAAAQATWTLRLGTAVALPLEHELFTFAKQVATLD
RFSAGRLLLGVGVGVRAELAVSSSIAWADRYRALSDMVAALRVLWTDDEA
EHHGEFYDFEPVWCHPKPQQQAGPPLLAAATGPRAIGDCLPWADGWLPGD
AAYRDLPAAVADFRRRAEDAGRDPATLDLTVMAWGDPSEKRLARYRDLGF
TRVVIGGGRRDGDPSTTVPFLDRYAAMVTELK
315446404YP_004079283.1 short-chain alcohol dehydrogenase [Mycobacterium gilvum Spyr1]MNLAGRVALVTGGASGIGRATAVRLAAEGMQVCVVDIDGSAAEEVAESFG
GIGLRCDVTDPDQVDATFAACAAGFGRLDLAFLNAGVTIDWSGDIGSLDV
AQYRRSVGVNVDGVVFGVRAAVRTMRSLGAGTDLAILATASLAGLMPWHP
DPVYSLGKHGVVGFMRSVAPNLAAESIAVHTICPGITETGVLGDRRPLVE
RIGVPVMEPDAIAEAVMVALDAPADATGTCWVAQYGKPAWPMVFAPVESP
DSRLNVPVRLR
315446402YP_004079281.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MATSSRRVGAETSKTRDTLLDCVETMMLEEGYASVTYRALAAKAGVTPSL
VQYYFPTLDDVFIAAIRRYSERNLAHLNKVMEKRAEDPLRALWEYSWDEA
TGTLMTEFMALGNHRKSIRTEIAAVTESVRTLQLDALTAKFGADARPWGD
LSLPALQLLISSLPKFLNLEKGVGVETAHAELIEAFEGYLDSIEPAVKRK
PAPRKRSR
315446400YP_004079279.1 ATP-dependent DNA ligase [Mycobacterium gilvum Spyr1]MEAVDLPVRPPLEPMLAKAQAKVPDDPGVWSYEPKWDGFRALVFRDGDDV
VLLSRSGKDLGRYFPEVLDAVRDELAPHCVLDGEIVVPREIGGRMRLDWE
SLSQRIHPAESRITLLSEQTPAHFIGFDALALGDTPLMKEPFRTRREALI
DAVTPKQWCHVTRTTEDPQLGTQWLDEFEGAGLDGVIAKRLDGPYLPGKR
EMVKVKHHRDADCVAMGYRIHKSGEGIGSILLGLYRDDGELQMVGGAASF
TAKARLKLLDDLEPLRIGDDLRDGEPSRWNSAADKRWIPVRPERVCEVAY
DQMEGNTEHGRRFRHAVKFLRWRPDRDPQSCTFDQLDVPLHFDLYDVLER
S
315446398YP_004079277.1 hypothetical protein Mspyr1_49080 [Mycobacterium gilvum Spyr1]MPINLLRKLLAAVAIVGMLASGIGIASFMIFGGRGAQDAVTAPVRTPPKP
PPPSVPTVEEFRIGVVVTAQNCDPAGACVYTYTIDPKYIGLHPFPEAPFT
VEYEVLGGHAPQPGKFTVTGDQAQIFKDVQIEGPPGAALTANVVRVFEEP
PAPAPPPPPAPPAEQVPAP
315446396YP_004079275.1 dihydrodipicolinate reductase-like protein [Mycobacterium gilvum SpMPNNAPHRVVQWTTGNVGKSSVAAITANPTLELVGCYAWSDDKVGRDVGE
LVGIEPLGVAATNDVDALLALKPDAVVYNPMWIDVDELVRILEAGVNVVA
SASFITGHNLGDGRAKLADACERGGSTLFGSGVSPGFAELLAIVAGTACD
RIDKVVISESADTTLYDSPDTERPVGFDMAIDDPALQPMAAQGTAVFAEA
VQLVADALGIELDEITCVSEYAQTTEDLPMASWTIKAGHVAGVFASWQGI
YHGRTVIDINVRWKKGQTLEPDWQLDGDGWKITIEGRPTVNMSVGFLPPQ
DMIENAKTLEDFFVLGHIMTALPPIHAIPAVVAAAPGIATYNDLPLPLPR
GVVPAR
315446394YP_004079273.1 hypothetical protein Mspyr1_49040 [Mycobacterium gilvum Spyr1]MGRTAAVIWHASFSIAAGVLYFFFVLPRTPELLGDTSHTLGTALRIVAGA
LIGLAALPVVFTLLRTRRPEFGTPKLALNLRTASIALHVLAAALIVGTAI
SEIWLSVDSAGQWLFGIYGAAAAIGLLGIFAFYLAFVAELPPPPPKPLKA
TKRTGRGRKGDGSEDSADVEGSEGEVLESERTDGVTDADVDTGENGVKAE
DAPAAVSDADDADDADGKLRNRRPTGKGTGLGRRKRTRGGVAVED
315446392YP_004079271.1 DNA polymerase III subunit gamma/tau [Mycobacterium gilvum Spyr1]MALYRKYRPASFAEVVGQEHVTEPLSTALNSGRINHAYLFSGPRGCGKTS
SARILARSLNCEQGPTATPCGVCDSCVALAPNGPGNMDVTELDAASHGGV
DDTRELRDRAFYAPAQSRYRIFIVDEAHMVTTAGFNALLKIVEEPPEHLI
FVFATTEPEKVLPTIRSRTHHYPFRLLAPKTMRTLIEKIVASEQVAVDDA
VYPLVIRAGGGSPRDTLSVLDQLLAGAHADESGTSHVAYQRALSLLGATD
VALIDEAIDALAANDSAALFGAVEGVIDAGHDPRRFATDLLERFRDLIVL
QAVPDAVARGVVDGPEDVLERMREQASQLGTATLTRYAEVVHGGLGEMRG
ATAPRLLLEVVCARLLLPSASDTEAALLQRVERIETRLDLSIPASDEIVA
AAPAVPRKQFVRRSEAAPAASPAPTPPAPAQPPATPPPATPPPAPAPPPA
PPRQAEPRPVPVPAHAPAPEAKPVTPEPDPEPPPPMRAPAAPAVEAPPAT
PAAAVAAGEPNAAAVRSMWTTVREKVRERSRTTEVMLAGAIVRAVEGDTL
LLTHESAPLARRLCEQRNADVIREALKDALGVNWKIVCEPGVAAAPVPSA
PEPVRGGPAEPPPQPDGDDEESMLAEASKVDPAAPRRDPEEAALELLQSE
LGARRIDG
315446390YP_004079269.1 methyltransferase- cyclopropane fatty acid synthase [Mycobacterium MTTFREHTDSSASDPDRKLTLAEVLEIFAAGRRPLKFTAYDGSSCGPEDA
TLGLDLLTPRGTTYLATAPGDLGLARAYIAGDLRLSGVHPGDPHDLLTAL
TERLEYRRPPVRVLANVLRSIGIEHLKPVAPPPQEHLPRWRRIAEGLRHS
KTRDAEAIQHHYDVSNTFYSWVLGPSMTYTCACYPHPDATLEEAQENKYR
LVFEKLRLKPGDRLLDVGCGWGGMVRYAARHGVKVLGVTLSKEQAQWAAD
AVERDGLGELAEVRHGDYRDVRESHFDAVSSLGLTEHIGVANYPSYFRFL
KSKLRPGGLLLNHCITRNNNRSHATAGGFIDRYVFPDGELTGSGRIITEM
QDVGLEVVHEENLRHHYALTLRDWSRNLVAHWDDAVTEVGLPTAKVWGLY
IAASRVGFEQNAIQLHQVLSVKLDERGSDGGLPLRPWWNA
315446388YP_004079267.1 polyketide cyclase / dehydrase and lipid transport [Mycobacterium gMGQVSASSTVLIDADPATVLGAVADYEAMRPKILSEHYSGYRVLEGGQGA
GTVAEWKLQATKSRSRDVKANVDIAGRTVIEKDANSSMVTNWTVAPAGPG
SSVTVKTSWQGAGGIGGFFEKTFAPLGLRKIQAQVLENLKREVEGGKPA
315446386YP_004079265.1 hypothetical protein Mspyr1_48940 [Mycobacterium gilvum Spyr1]MQPGGQPDMSALLAQAQQVQQQLMEAQEALANAEVHGQAGGGLVQVTMKG
SGEVVGVSIDPKVVDPSDVETLQDLIVGAIADAAKQVTILAHDKLGPLAG
GMGGLGLPGM
315446384YP_004079263.1 transposase [Mycobacterium gilvum Spyr1]MIDLSRSTWHYRTNPRPPVSDPLPQKHRAYPSRIDEADRAVIRDKILAGW
EAGSSVDHAFAASWDEGVMLASRRSWWRIAAAIEDQSARPVAPTRSTSKT
PRQAPVLKATGPQQIWSWDITDLRSPWRGVAFKAYSILDIYSRKIVGWRV
EERECDDLAVDMFEAAFAGHGLPAVVHADSGPAMRSTVLKDLLAGLKIGQ
THNRPRVSNDNPFSESEFRTMKYRPNYPGVFTDLDSARAWVSAYVSWYNQ
HHRHSGVELFTPDSVHDGTWAQLWDRRDTALQAYYDAHPERFRNRPRTKS
PSPVVGINLPTENDPDRLQAA
315446382YP_004079261.1 glutamine amidotransferase [Mycobacterium gilvum Spyr1]MSESTVRIGLVLPDVMGTYGDGGNSVVLRQRLRLRGIDAEIVEITLDDPV
PAELDLYALGGAEDYAQRLATKHLIRYPGLQQAISRGAPVLAICAAIQVL
GHWYETSAGERVDGVGVLDVTTSPQPQRSIGEVSATPLVDGLTEPLTGFE
NHRGGTVLGSDARPLGRVTKGDGNLAGGGVDGAVQGSIVATYLHGCCLAR
NPQLADHLLTRVVGPLAPLDLPEVDRLRKERLAAPRRV
315446380YP_004079259.1 DNA polymerase III subunit epsilon [Mycobacterium gilvum Spyr1]MSSTAGRRWGRPAHEDGAGWAVVDVETSGFRPGQARIVSVAALALSDDGN
VEKSLYSLLDPGVDPGPTHVHGLTAEMLEGQPTFGDVVGDLCEVLRGRTL
VAHNVGFDYSFLSAEAELVGAELPIDTVMCTVELARRLDLGLENLRLETL
AAHWGVTQMRPHDALDDAMVLAQILKPVLVRAQERRKWLPVHPVGRRTWP
NGRVTHDEFRPLKALAARMACPYANPGRFVSGRPLVQGMRVALAAEVGHT
YDELIERIVHAGLAYTESVDAFTSLVVCDAAAPEQGKGYQAGEFGVPMLP
SDEFLQRLDAVIGGSAVEEFAEPSPAGDQFALF
315446378YP_004079257.1 hypothetical protein Mspyr1_48850 [Mycobacterium gilvum Spyr1]MSSVDLSRFLLQETTLGAITSWLPWESELSDLAVGDPAFAAASAVVLDGD
LDAGDLDLNLDNLYPRDHQHPLPFLLLVRGSVRARAVVNSDFDGGTHLVV
LGDLDADYLITFDQETFVGGALRLRRAWWGIGEAGNLMVRGPISAPALIA
DGYRVDDERIRARHGVTNTAFLFRDGTDYLPRDHACCVIADKYVCDDDSF
DDEQIPNGVVDWVEPFDVLDAVTGGQDPFAEPICDPTEDLFVPEPDLFGC
SEAELRDRFSAEVSAESVVAVMAHPLVMGRCETYDHDLIDEDRRYSVRRA
SGETPARLTIVRVISDPHLMYRFHHFEARRSPCGTTSVELLTQKSAGARC
EPEPVPEHRVDHYIDALSCFRRLREFLAESV
315446376YP_004079255.1 glycine/D-amino acid oxidase [Mycobacterium gilvum Spyr1]MTETADVVIVGGGLEGAAAAWALSRRGVTDVVVCERSTVGSGMTGKSSGI
VRCHYGVSSLAAMAADGLEVFEQAQDIFGTDIGFRQTGYVVGVGEQNVDA
LRKSLAAQRSVGVETEEIDESEVARLWPFADLTPFAAFGWEARGGYGDAY
QTAQAFSTSARAAGVRVRQGTAVAGLLADADRVTGVRLADGSEISAGTTV
VATGVWTRPFLSAHGIDMPIRVVREQIVMIDPGIDEAAVGRLPVFSDLVS
LQYVRPELGGEILFGNSDLPGYDAIAPADPDAYLNRATDDFVDLTVDKVG
TRFPGFPDASITGSYAGCYDVTPDWNPVISRGPLDGLVIAAGFSGHGFKI
APAVGRLVADLVVDGHGSDPRIPASDFRFSRFAENDPLKTPYPYVGAGQM
R
315446374YP_004079253.1 glutamate synthase (NADPH) GltB3 subunit [Mycobacterium gilvum SpyrMAALRYNLREIPLREVNSALHAPDLDGEFVIENPAGAHNVAVGLNAPVTV
TIAGHVGYYAAGMNQQAEVIIDGNAGTGVAENMMSGSVWVKGNASQSAGA
TAHGGLLVVEGDAAARCGISMKGVDIVVGGNVGHMSAFMAQAGRLVIRGD
AGEALGDSIYEARLYVRGEVASLGADCIAKPMRDEHHQELEYLLKTAGFD
DDDTKSYTRYGSARSLYHFHVDNASSY
315446372YP_004079251.1 glutamine synthetase [Mycobacterium gilvum Spyr1]MPHDLAALAEQSGTRFILALFVDLRGKPCAKLVPVEAVDQLATEGVGFAG
YAVGAMGQEPKDPDLMAIPDPESFTPIPFIKEGLAIVHCDPHVNGKPWPY
APRVILKSLIQRCADAGFEPWVGAEVEYFLLRRNDDGSVSVADAADTASQ
PCYDARGVTRMYDHLTSVSAAMNQLGWSNYANDHEDGNGQFEQNFKFAEA
LTTADRVITLRYLLSMIADERGMIATFMPKPFGDKTGNGLHFHLSLTSAG
TPVFPAEDDNRGLGLSDTAYGFIGGILEHACALQAVVGPTVNSYKRTGAV
ATLSGASWAPRLPTYGGNDRTHYIRVPDGDRIEMRGGDGSANPYLAIAAA
LGAGLDGIKRSTDPGAVGQGVSTQPLPATLLHAVEAFETNPVVTGVLDAA
GEGVASYFAAIKRDEFFAYHSSVSPWEIDYYLTAF
315446370YP_004079249.1 penicillin amidase [Mycobacterium gilvum Spyr1]MNSGATVIAMCTRVVYLGDEDRVVTGRSMDWKVEIGTNLWALPRGVARTG
QAGPDSVEWTAKYGSVVATGYDISTTDGLNEAGLAANLLWLAESQYPANT
GDRPALAISLWAQYMLDNFATVAEAVAALTATPLRVVTAEVPGQERMATV
HLALSDATGDSAIVEYIDGEQVIHHGRQYQVMTNSPTFDKQLAITEYWKE
IGGTVMLPGTNRAADRFVRASFYIDAVPKTDDPLLAAATVFSVVRNASVP
YGIATADEPNISSTRWRTVIDHKSLRYFFESALSPNTFWVELKNLDLSAG
ASALRLQLGEGEKTVYAGDASGRFEPAEPFAFLGLA
315446368YP_004079247.1 aspartate kinase [Mycobacterium gilvum Spyr1]MALVVQKYGGSSVSDADRIRRVAERIVETKKAGNDVVVVVSAMGDTTDEL
LDLAKQVSPAPPVREMDMLLTAGERISNALVAMAIESLGAQARSFTGSQA
GVVTTGTHGNAKIIDVTPTRLRSALDEGQIVLVAGFQGVSQDTKDVTTLG
RGGSDTTAVAVAAALNADVCEIYTDVDGVFTADPRIVPNARKLETVSFEE
MLEMAAAGAKVLMLRCVEYARRFNLPIHVRSSYTDRPGTLVTGSMEDIPM
EDAILTGVAHDRGEAKVTVVGLPDVPGYAAQVFRACADADVNLDMVLQNI
SKVEDGKTDITFTCSRESGPGAVEKLTSLQNEIGFTRVLYDDHIGKVSLI
GAGMRSHPGVTATFCEALANAGINIDLISTSEIRISVLIKDTELDRAVAA
LHEAFGLGGDEEAVVYAGTGR
315446366YP_004079245.1 hypothetical protein Mspyr1_48730 [Mycobacterium gilvum Spyr1]MVAHATPVGVQPLMPGQVLRLGVAAGTGTATADYGIGATDLCEFMEFPSG
TLQVCGDSFAGQAVGFGGWYSPIALHVVGDTLEDPGGVRYNGVTGVDTPL
LAEPTLPGESQLPAGIIEINRENWMLVTTTRDLVPQRSRLVKAEAGQGNW
QTVPGSEREAGFAGGRQTQISGYYDPIPTADSGRGWVYIVANNFDRSSPA
VLYRATPQTFTDRSSWQGWTGAGWGGDPAPLWPDRVGEMSVRQIDGLTML
SYFNATTGNMEIRVASDPTQLGTAPVTTVVVAAPWPDPVDVLPPPHDNRL
AQPYGGYISPGSTPEAVRVFVSQWNTMARGGTPYRVIQYVVNPQKPW
315446364YP_004079243.1 catalase [Mycobacterium gilvum Spyr1]MPEKYTTTDSGAPAPSVEHSLTVGSDGPILLQDHYLIEQMANFNRERIPE
RQPHAKGGGAFGQFEVTHDVSRYTKAAFLQPGITTEMVARFSTVAGERGS
PDTWRDPRGFALKFYTSEGNFDMVGNNTPVFFIRDPMKFQNFIRSQKRMA
ASNLRDHHMQWDFWTLSPESAHQVTWLMGDRGIPKTWRHMNGYSSHTYSW
MNAEGEMFWVKYHFKTDQGIEFLTQEDADRLAGEDADYHQRDLFTAIEDG
DFPSWTLHVQIMPFEDAKTYRYNPFDLTKVWPHGDYPLHEVGRMTLNRNV
VDYHAQMEQAAFEPNNVVPGTGLSPDKMLLARGFSYSDAHRARLGVNYKQ
IPVNEPHVEVNAYSKDGAMRIRNSTDPVYTPNSMGGPEVDPKRASEVHWA
SDGDMVRQAYALRADDDDFGQAGTLVRDVLTDEQRDRLAHNIIGHVSDGV
KEPVLSRVFEYWRNVDPDLGKKVEEGVRGS
315446362YP_004079241.1 30S ribosomal protein S14 [Mycobacterium gilvum Spyr1]MAKNSKIVKNERRLVLVARHAERRAELKAIISSPSTPADARAAAQSELNR
QPRDASPVRVRNRDAVDGRPRGHLRKFGLSRMRVRELAHRGQLPGVRKSS
W
315446360YP_004079239.1 50S ribosomal protein L28 [Mycobacterium gilvum Spyr1]MSAHCQVTGRKPGFGNAVSHSHRRTRRRWDPNIQRKTYYLPSEGRRITLR
VSTKGIKIIDRDGIESVVARLRREEHKL
315446358YP_004079237.1 hypothetical protein Mspyr1_48650 [Mycobacterium gilvum Spyr1]MSIGGDPRPGRCRVLLVALVAAAAALTSAAPATARPSDPGVVNYAVLNKG
SVGNIVGARMGFESTFAAPFQAFYVDNPACNNWADIGLPEVYNDPDLAAF
SGAATQESPTDATHLVKQAVGVFATNDAARRAMYRVVDRTVACNGQTTAM
HLSNFTTQVWTFTAGPTSAADANWVKQEAGTDRRCFVTTRLRENVLLQAK
VCQSGNGGPAVNVLAGAMQNTLGQ
315446356YP_004079235.1 hypothetical protein Mspyr1_48630 [Mycobacterium gilvum Spyr1]MTTRETLAGELIRARDRTLRLVDFDDAELRRQYDPLMSPLVWDLAHIGQQ
EELWLLRGGDPQRPGLLSAEVDQLYDAFVHSRAARVDLPLLPPTDARNYC
ATVRGRALDTLEALPDGHPDEFAYALVISHENQHDETMLQALSLRSGAPL
LDRGDPLPPGRSGVAGTSVLVTGGEFVLGVDAVTEPFSLDNERPAHTVDV
PDFRIGRVPVTNAEWRQFLDDGGYAQRRWWSDAGWTHRQQAGLTRPLFWN
ADGTRTRFGHVEDIPGDEPVQHVTYYEAQAYAAWAGARLPTEIEWEKACA
WDPATGARRRFPWGTAEPTADVANLGGGALRPAPVGAFPASASACGAEQM
LGDVWEWTSSPLRPWPGFTPMIYRQYSEPFFDGTASGEYRVLRGGSWAVA
AGILRPSFRNWDHPIRRQIFSGVRLAWDV
315446354YP_004079233.1 methyltransferase [Mycobacterium gilvum Spyr1]MVFSLENLLAADAAEEALRRDVAHGLTQQPKSLPPKWFYDATGSDLFDQI
TRLPEYYPTRAEAQILRSRASEIAAASGADTLVELGSGTSEKTRMLLDAL
RDRGSLRRFIPFDVDSSVLTAAGAAIETEYPGIEITAVCGDFEEHLGKIP
GDGRRLVAFLGSTIGNFTPGPRAEFLASVAQMMQPGDTLLLGTDLVKDTE
RLVRAYDDGAGVTARFNRNVLAVVNRKLGADFDIDAFEHVAVWNGDEQRI
EMWLRSTRAQRVRIDALDLDVDFADGEQMLTEVSSKFRPSGVEEELAAAG
LRRTHWWTDEAGDFGLSLATL
315446352YP_004079231.1 EAL domain-containing protein [Mycobacterium gilvum Spyr1]MDNGVTTSARRDETAIHAAGPTAHSTSHLDAAVTGEGMVPVFQPVVSLPD
EAVVGYEALARWPAYDSLSPLDVFAHATATGHLDTLDHACIRSSAAAALA
ATSEPGMLLLLNCEPTTRGIDISAGTALAEATTRFTTTFELTERGLLLDP
PALLRKVSALRSGGVRIALDDIGAHPDSLALLDIIAPDIMKIDLGLVQRQ
PDQWQTRTIAAVIAHHERTGAVILAEGIETDEHLEQALGYGATLGQGYRF
GRPGALHTVPRGDAVPGLSVPFQHEPADKTPFELATTGHSARTLRKRTLI
EMSRHIERLAAASESPPIVLFTLQGMDNFQGMTRQNILALAERSPLVVAY
AVGAPQDPERTFKWVDIELHDRMALEWSIVVLGPDTAAALVARELEPAGS
GPENDRRFEAVITFERSRVAQAARSLLNRV
315446350YP_004079229.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MGVDVAARNRRSASVLPYGALDRDHLVKHLLELARRVGVDHVTMRGLAAE
AGTSASSVYYHVKDKAALMDLLAEAVIESIEVPADGDWRRRISALYTNAW
TVMYDIPGVAAMLQQRPLAGAAHAMDRTARAIMAEAGWDGEQISRAHAVL
YIHLLGSIQLAHHLRDSGIDGGSDDGAHSVFQHGLRVILTGLQHTSPLP
315446348YP_004079227.1 methyltransferase family protein [Mycobacterium gilvum Spyr1]MAEVMDWDSAYRGEGEFEGEPPWNIGEPQPELAALWRDGRFRSEVLDAGC
GHAELSLALAADGYTVTGVDISPTAMAAASAAAAERGLSEKASFVAADIT
ALSGFDGRFSTVVDSTLFHSLPVESRAGYLESVHRAARPGAGFFVLVFAK
GAFPADTEQGPNEVSEIELREAVSPYWTIDDIRPALIHTNVPKLPGMPPP
PLDMLDDRGHLRMQAFLLSAHKEP
315446346YP_004079225.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMPRGGPRASCLDRLLETDRQEYLDRASELPADVARKRSVIRALEWTGETF
GHHVRFAEIVLDQISDVPDPKILELGAGHGALSRKLLDWHPTARLTVTDI
EPASVAAIADSDVGAHPRATVRQMDATALDAADGEFDLAVFALSFHHLPP
AAAARVIAEGTRAADTLLIIDLPRPPAPLHLVRLATMLPWAPLVPFVHDG
VISSLRAYSPAALRALAAHAGEDIDIELRGGLFSPQVAVAARR
315446344YP_004079223.1 glycerol kinase [Mycobacterium gilvum Spyr1]MADFVAAIDQGTTSTRCMIFGHDGAEVGRHQLEHEQILPKAGWVEHNPVE
IWERTGSVLATALNATKLATTDLAALGITNQRETSLVWNRHTGRPYYNAI
VWQDTRTDRIASALDRDGRGDVIRRKAGLPPATYFSGGKLQWLLENVDGL
RADAANGDALFGTTDTWVLWNLTGGHRGGVHVTDVTNASRTMLMNLETLD
WDDELLGFFDIPRQMLPEIRPSSSPQPYGVTVETGPADGEIPITGILGDQ
QAAMVGQVCLDVGEAKNTYGTGNFLLLNTGEKIVRSDNGLLTTVCYQFGD
SKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVDDNGGVYFV
PAFSGLFAPYWRSDARGAIVGLSRFNTNAHVARATLEAICYQSRDVVDAM
AADSGVPLEVLKVDGGITANDLCMQIQADVLGVDVVKPVVAETTALGAAY
AAGLAVGFWEGADDLRANWQEGRRWSPQWSDEQRAEGYAGWQKAVHRTLD
WVDVE
315446342YP_004079221.1 oxidoreductase- aryl-alcohol dehydrogenase like protein [MycobacterMDTFPLGSHTVGRVGFGAMQLPGPGVFGPPRDHDQALAVLRRVVELGINH
IDTAQIYGPNVANELIREALHPYADGLALVSKVGGRRDEQGNWLPAQDPD
DLRRQLEENLSTLDTDRLAAVNLRAFNHDDPSLPAVLDRDLFDRQLTAMI
AARDEGLIAGIGLSNVSADHLRVALERTEIVCVQNAYNLLDRTSQPVLDL
SAEHGIAFVPFFPLGSGFVADNPVLKHPAVVREAEKLGRTPAQIVLAWTL
SVAPNVLLIPGTSSVAHLEQNTAVRDITLDDDTRRDLDAAA
315446340YP_004079219.1 PadR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAALGLLAQHPASGYDLLKKFEVSMANVWPGTQSQLYSELNKLADDGLIE
VTAIGARGRKEYAITRPGRDELRRWVMDFHDDPPQRSSALLRVFLLSAVP
SEEAGKYMIAVAEHAERDLARYEALRDAVPWNQSDDDDFYGRAALEFGLR
QAAMTADWARWVADGIRARQK
315446338YP_004079217.1 hypothetical protein Mspyr1_48450 [Mycobacterium gilvum Spyr1]MVGQQQPVVTGDAVVLDIQIAQLPVRALSALIDVSVVALVYVIGVILWAM
TLSQFDPAFSAAVLIIFTVLALVGYPTIFETATRGKTLGKMVLGLRVVSD
DGSPERFRQALFRALAGVIEIWMLTGGPAVLCSLLSSKGKRIGDIFAGTV
VISERAPRQAPPPAMPPQLAWWASSLQLSGLAPSQAEMARQFLARAGQLD
PQIRDQMSYRVTSDVVAQISPPPPPGAPPALVLAAVLAERHRRELARLQQ
PVPGPGWYTTPPTAPPPPPPGTGGGFTPPS
315446336YP_004079215.1 hypothetical protein Mspyr1_48430 [Mycobacterium gilvum Spyr1]MRKVLDEVLRRCNGYATTAALLDVMSRQQLDGLVRRRELVRVWHGVYAVA
QPDSRGRLNSLDAFLGQHAVACLGTAASLYGFDTEATETVHILDPGARVR
PVDGLMVHQRVGAPLRRVDGRLATAPAWTAVEVARVLPRPRALATLDAAL
HSGLCTAVELGAAAREQRGRRGIVKVRELLAIADGRAESPMESEARLVMH
DHDLPRPELQYVIDGTHDDAWRVDFAWPEHHVAAEYDSMDWHSGRVAMLR
DRARYAGIQHARWAVIPIVVTDVRVHPARLAARIADHLLRAAS
315446334YP_004079213.1 MoxR-like ATPase [Mycobacterium gilvum Spyr1]MTQSAQHEGARNALMALRAEIGKVVVGQDAVVSGLVVALLCRGHVLLEGV
PGVAKTLLVRTLAAALQLDFTRVQFTPDLMPGDVTGSLVYDARTAEFEFR
SGPVFTNLLLADEINRTPPKTQAALLEAMEERQVSVDGHPRPLPDPFIVA
ATQNPIEYEGTYQLPEAQLDRFLLKLTVPLPPRDQEIAILSRHARGFDPR
DLSFVQPVAGPAELAAGRDAVRQVLVADEVLGYIVDIVGATRNSPLLQLG
VSPRGATALLATARAWAWLSGRGYVTPDDVKAMARPTLRHRVALRPEAEL
EGASADGVIEGILSAVPVPR
315446332YP_004079211.1 hypothetical protein Mspyr1_48390 [Mycobacterium gilvum Spyr1]MSTVDIDRDAAHDAAQAELSKSIYPKPSPMDLLSEWFDELLYRLTAGAAK
IPGGWFTVAVLIVLLAVAVIVAIRIARRAMRSSRGGDPALFGDQTLSAAE
HRATAERYAAAGDWAPAVRHRVRAIARQLEENGVLDPVPGRTATELARTA
GRTLPALTGAFITAAETFNDVTYGEQPATEPQYRMLAALDDSVGTQRSPS
PSGTDSRDPQQPWAEVR
315446330YP_004079209.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMTRFGYTLMTEQSGPKDLVRYAVSAENVGFDFEVSSDHYFPWLSSQGHAP
YAWSVLGAVAHATERVELMTYVTCPTVRYHPAIVAQKAATLQILADGRFT
LGLGSGENLNEHIVGKGWPTVARRQDMLSEAIQIIRELQTGEMVDWKGEY
FEVDSARLWDVPDVPVRIAAAVSGERSVAQFAPLADHLIAVQPDKSIVDA
WHETRRGTGLPGDVRVIGQIPICWDPDRDAAIDRAHDQFRWFAGGWAVNA
DLPTTAGFDGATQFVRKEDVAESIPCGPDLDAIVEAVREYWEAGFTDIAL
VQVGGETQDQFLAEAATPLLDKLRSASH
315446328YP_004079207.1 hypothetical protein Mspyr1_48350 [Mycobacterium gilvum Spyr1]MRAGVRSCLTASVALVGAGTIAITPVNPLTTDVLPITQHAVSLAAVPNPI
QLYSQVFQRSLDNAGALAQQYFADPFPITGAILRNQGVAVADALAALQAG
DSEAFVAAATDVVLEPFRGTGAALSHLGALLNQPYAVEGFFLIAISPVLA
GVAATQRAFEEVIDALVGFDLVGAAYAVLNIPGRVIDGVLNGVPGASFGI
LEDLPGLLSPLSETGLPPGPIAVGTSLDQDMGAAIPPREPATGVSDVPDL
AAATITLDADEVPAEDSGRSDADDAPAEDTTETEGTDEESGDSADAESSE
GGAESSEGGAEGAEAESGQAAPARTSAKPDSTRSDRTRADAGTSDTE
315446326YP_004079205.1 type I restriction-modification system methyltransferase subunit [MMLPGDTRDDAALRKSRGAFFTPPPVARFLVDWAVRDPGHAVLEPSCGEAV
FLHEIGRRGDGGRPHTGPLVGVEIHPGSAAAAEQSLRAAGVGATIHARDF
FGHNEFGRYDAVVGNPPYVRYQDFAGESRARAREAALRAGVTLSNLASSW
AAFTVHSALHLRTGGRLGLVLPAELLSVNYAAGVRQFLMDHFSSVGLVLF
DERVFPGVLEEVVLLLADGYDAAGGNGATHMQLSQVRDAEGLARLTASRR
WTPPAGGAKWSAGLLSSAGLSAFDAAVGSDAFTVLETWGDTTLGMVTGSN
RFFTLSPAKVAALGLAPSDVLSLSPPGSRHLRGLGLTPQALHTLGADGRS
TFLFRPKGEPSPAAWHYIRSGEDLDVHQAYKCRVRKPWWRVPYLRPADLF
LTYMNADTPRVTSNRAQAHHLNSVHGVYLRDDLRRDGMSLLPLAALNSVT
LLGAETVGRAYGGGMLKIEPREADVLPVPSPELVRRNADGLRAVRSAVAA
RLRDGRLLDAVALVDDALLLSTSSLSVRQLRALRRDHGALTARRVARGKV
NGGR
315446324YP_004079203.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum Spyr1]MDVVICNPVRTPVGRMGGALSPLTAADLATVTLRALIDRTGLGEGDVDDV
ILGNGYANGEAPALGRVAALDAGLGTAVPGLQIDRRCGSGLQAVLYAAGQ
VATGAARTVIAGGAESMSNVEHYALGLRTGVRQGGIALQDRLDRARETAG
GTSHPVAGGMIETAENLRREYGIEREEQDELALRSHRRAVAAHENGSFVD
EMVPVTVPGARGGADTVVDRDEHPRTDLTADKLAALRPIRSRVDAGSTVT
AGNASGQNDGAAMCVVTTRAEAEKRSLEPLLTLRSWSVTGCAPETMGIGP
VSAAAAALERADLTLDEIDLIEVNEAFAAQVLAVLAEWKIDPLDDRLNPN
GSGISLGHPIGATGARILATAAYEARRRDARYVLEAMCIGGGQGLAAVFE
VTR
315446322YP_004079201.1 3-oxoacid CoA-transferase subunit A [Mycobacterium gilvum Spyr1]MTLDKVVGSARGAVDDIPSGSSLAVGGFGLAGIPWFLIEALLEQGADDLT
IVSNNCGVDGGGLGLLLEAHRITRVIASYVGDNKEFARQYLSGELTVELT
PQGTLAERLRAGGSGIGAFFTPTGVGTLVADGGLPWRYHPDGSVALASPP
KEVRTFGGRQMLLEESIVTDFALVRAAVADRAGNCVFHAAARNFNPPAAM
AGRITVVEAERVVEVGELHPDEVHLPGIFVQRVVELSPDQAARKGIEKRT
TRPRIPQEVSA
315446320YP_004079199.1 LuxR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAPVTFVGRSGDLDELIRRTAATVSDGSAVVTVRGTPGIGKTALLRQVAA
TVPNSRWATAVPWESTVDGAVLSQLSPEPGAEQLARALAGDDPTLLVVDD
AQHADSASLQALSSLIRHHRSLPVLLVLVTDGHPLPVPGLDGDELVMTGL
DVREVAALASARGHVLPALMVDRLTRHTAGHPGHVRALLDELPAQTWSRL
DAPLPAPREVVAQVERELAAAGDGGRALAFALAVLGEEATLSEAVLLAGI
DDPLAAVAAATGASLVRAGDPLEPRLRDPLAAAAVLDVCGVQATADAHRR
AADVVTDPVARLRHRVAATPVPDEALADEVDALARSSGADGEWSRAAVLF
RDAARLTAAPLLRDERLTRSVDALVAAGDCVGAAAMVPTVENLRETPLRN
ATLAYLAILRGRATEAEVRLRRAWDIVHIDRDTDTAAFIAQRHVLHALVH
CQGEELVAWADRALALAERDSPAGIEAAAIRGLGLLASGQPRRAAAEYDD
LHERVRHGAQAQRVVMGRGWVQLMRDDVEGARSSLESAVAAAGLGGSTRI
TLWSHAWLARTQFSLGEWDAALASVAHGRRLAETSGIVLVTPLLEWTAGQ
IAALRGDWETAHAAAHAAAVGGEYAMMRIPALLVRAQIAEAQADYATVRR
VLEPLTTLAPGTSLQEPGYWPWVDALANAMVLTGDLAAAEDFLRPHAQRA
KSRGHRSAQARLGWVRGRLLGARGDIASAREAFEQSLALLDGLPLRYETA
RVNFAYGQTLRRAGKRREADTVISAARELYVALGADTYVARCDRELKAGG
LHQSRESRHTVELTPQEEAVSTLVSRGLSNREVAAELYVSPKTVQYHLTR
IYAKLGIRSRSELAALRR
315446318YP_004079197.1 benzoate 1-2-dioxygenase small subunit [Mycobacterium gilvum Spyr1]MTNTDMTTIETNTGTTTLITQNAIEQFLYREARYLDDREFEKWLDCYADD
VVYWMPAWTDDDKLVEDPQRDISLIYYSNKGGLEDRVFRIRTERSSATSL
PEPRTSHNISNVEVIERRGDIVDVRFNWHTMYFRYKTVDPYYGTSFYTID
FGGEQPLIRRKTVVLKNDYIHHVVDVYHF
315446316YP_004079195.1 LysR family transcriptional regulator [Mycobacterium gilvum Spyr1]MELRHLRYFLAVAETCHFGQAAEQLHIAQPALSYAIRQLENSLDATLFTR
TTRHVALTPAGEFLRVEATRILNGVDAAQRGVRRIAAGRSGLLRLGLTGT
AAFSHLPKIARIVRQELPAVALDIHADLLTPDQCEGLRTGALDVGVLRPP
AVGGDVATRTIAAEPLVLAVSADHRLAAEPVVSLADLRSEPFIGYTGQDS
AVNDAVTRSCRAAGFVPHREHSTPGTAVLLALVAADLGVSVVPASVRALP
LHGVVFRDLVDGGTVDLALAWRDGVDNPVVDAVVAVLAGALTSLDHPALQ
EQS
315446314YP_004079193.1 catechol 1-2-dioxygenase [Mycobacterium gilvum Spyr1]MTTIESPINTTSSEASAAASGASATERFRSDKSPFDAVRDTPKERVDLLA
REVLSAVHDTIRRHRVTYDEYNALKAWLISVGADGEWPLFLDVWVEHVVE
DVATDHREGSKGTIEGPYYVPNSPECGARGVIPMRDGEQGTPLVWDGVIT
STDGTPLQGKVELWHADADGFYSQFAPNLPEWNLRGSFSTGADGVFEINT
IRPAPYQIPTDGSCGKLIAAAGWHAWRPAHLHVKVSAPGHELLTAQLYFP
GDPHNDDDIAGAVKPELILNPTEQADGSQRVVYNFVLDPAKA
315446312YP_004079191.1 permease [Mycobacterium gilvum Spyr1]MIAVGVALGALIGVLLGLLGGGGSILAVPALVYGLDLGVEQAIPISLIVV
AAASAVGVLPKIRARQVRWRMAGIFSAAGIPATLAGSAISRHLPESALLI
GFAAVMVVAGIRMLTDQSSTGTACEIREGEVNWRRCAPRSIGAGLVVGLL
TGLFGVGGGFLIIPALVVVLGVEMSTAIGTSLLIIIANSVAGIFSHLQSI
SVDWQVTGLFVAAAMVTSLIAGYVGTKTDTERLQRWFAYLVFVVAGYVLI
DTIFLR
315446310YP_004079189.1 cysteine synthase [Mycobacterium gilvum Spyr1]MSAPDPWSNRSSRPRGSDRSSRPRCHLQSRIWVDNAVRLIEADARRSADT
HLLRYPLPSRWCSEVDVALYLKDETTHITGSLKHRLARSLFLYALCNGWI
DEGTTVIEASSGSTAVSEAYFAAMLGLPFIAVMPESTSASKIALIESQGG
RCHFVKRSAEVYAEAQRLAEQTGGHYLDQFTNAERATDWRGNNNIAESIF
EQLGEETHPVPEWIVVGAGTGGTSATIGRYLRYRRYPTRLCVVDPENSAF
YPSYQQGVDVVIDASSRIEGIGRPRVEPSFLPGVVDRMVSVPDSGSVAAA
HHVSRVLGRRVGPSTGTNVWGAFGLLAEMVAEGRSGSVVTLLADSGDRYI
DTYFCDEWLSSQGIDPSESAGSLAEFERSGRWV
315446308YP_004079187.1 membrane carboxypeptidase [Mycobacterium gilvum Spyr1]MPEQPPTQPPRAVTVIKLAWCVVLASVIVAGLLFPVVGGFGLVSNRASDV
VANGSAQLVEGEVPQVSTMTDSKGNIIAWLYSQRRFEVPSDQIANTMKLA
IVSIEDKRFADHNGVDWQGTLTGLSGYLSGNLDTRGGSTIEQQYVKNYQL
LVIAQTDAEKRAAIETTPARKLREIRMALTLDKTFTKPEILTRYLNLVSF
GNNAFGVQDAAQTYFGINATDLNWQQAALLAGMVQSTSTLNPYTNPDGAL
ARRNVVLDTMIENLPEYADELRAARQEPLGVLPQPKELPRGCIAAGDRAF
FCDYALDYLARAGISKDQVAKGGYMIKTTLDPDVQASVKNAITQYASPDL
PGVASVMSVVKPGKDSHPVLAMASNRTYGLNLDAGETMQPQPFSLVGNGA
GSVFKIFTTAAAMEMGMGINAQLDSPSRFEAKGLGSGGARGCPPATWCVQ
NAGNYRGTMSVTDALATSPNTAFAKLIAQVGVQRTVDMAVRLGLRSYALP
GTARDYDPESNESLADFVKRQNIGSFTLGPIEVNALELSNVAATLASGGM
WCPPNPIAEVYDRYGEPVSVTTETCEQAVPEGLANTLANAMSKDDTGAGT
AAGAAGSVGWNLPMSGKTGTTEANRSSAFLGFTNRYAAASYIYDDSTAPT
ELCSFPLRQCGSGNLFGGNEPARTWFSAMQPIATAFGDVTLPPTDPRYVE
GAPGSKVPSVAGMDQDTARARLREAGFQVADQATPVNSSSRYGTVVGTAP
SGQTVPGSIVTIQISNGIAPAPPPPPAGAPPPGGPPPPAGETVIQIPGLP
PITVPVLGPPPPPPPPPG
315446306YP_004079185.1 oxyanion-translocating ATPase [Mycobacterium gilvum Spyr1]MSTTPPALDMGSILRDTSNRVVVCCGAGGVGKTTTAAAMALRAAEYGRTV
VVLTIDPAKRLAQALGIESLGNTPQRVPLAPEVTGELHAMMLDMRRTFDE
MVVQYSGPGTADAILDNQFYQTVATSLAGTQEYMAMEKLGQLLSEDKWDL
VVVDTPPSRNALDFLDAPKRLGSFMDSRLWRMLLAPGRGIGRLVTGAMGL
AMKAMSTILGSQMLSDAATFVQSLDATFGGFREKADRTYELLKRRGTQFV
VVSAAEPDALREASFFVDRLSEEHMPLAGLILNRTHPTLCELHADKAAEA
ADELQKTDPDSVAAAALRIHAARASTAKREVRLLSRFTGANPHVALVGVP
SLPFDVSDLDALRAIADQITGEAPAA
315446304YP_004079183.1 hypothetical protein Mspyr1_48090 [Mycobacterium gilvum Spyr1]MSEPTRWEYATVPLLTHATKQILDQWGEDGWELVSVLPGPTGEQHVAYLK
RAK
315446302YP_004079181.1 Zn-dependent hydrolase [Mycobacterium gilvum Spyr1]MEHPAYNVLRPVTDTASVLLCENPGLMTLDGTNTWVLRGPGSDEMVVVDP
GPDDKDEHIERLAALGRITLVLISHRHGDHTGGIDRLVDMTGAVVRSVGS
GFQRGLGGTLTDGEVIDAAGLAITVMATPGHTADSVSFLVDDAVLTADTV
LGRGTTVIDSEDGDLGDYLESLRRLRGLGHLTVLPGHGPELDDMAAVSEF
YLAHREERLAQVRGALGALGEDATARQVVEHVYTDVDEKLWDAAEWSVQA
QLNYLRR
315446300YP_004079179.1 Mu transposase/integrase [Mycobacterium gilvum Spyr1]MSLEDHKRRERANAIGLFRYQVICPALEEGLSTRQRGRVVREIAGRRHID
PFGTQVQIARATLDRWIRRYRGGGFEALVPEPRRLATRTDVQVLELAASL
KRENPARTAAQVARILRTATGWAPSESTLLRHFHRCELMGPAAGQSAEVF
GRFEAPDPNELWVGDALHGPRVGDRKTYLFAFLDDHSRLVVGHRFGFAED
TVRLAAALKPALAARGVPASIYVDNGSAFVDAWLLRACAKLGIRLVHSAP
GRPQGRGKIERFFRTVREQFLVEVTDTTAEDLAAAGVDHAGALLELNRLF
MAWVETEYHRRIHTETGQSPLARWEAGFDRLGHPAALPTAADLTEAFLWS
EFRIVTKTATVSLHSNTYQVDPALVGRRVELVFSPFDLQAIEVRDQDRSY
GQAIAHTITRHAHPKARPEISSQTPPAATGIDYLALTAAAHHEQLRDDER
IGYHALYGAQATATDDNQLPGQLALPSLDHKDGVSA
315446298YP_004079177.1 Crp/Fnr family transcriptional regulator [Mycobacterium gilvum SpyrMDEILARAGIFQGVEPSAISALTKQLQPVDFPRGHTVFAEGEPGDRLYII
ISGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVR
AVSMDREALRAWIADRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRV
AKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAH
RGWIRLEGKSVLISDSERLARRAR
315446296YP_004079175.1 DNA-(apurinic or apyrimidinic site) lyase [Mycobacterium gilvum SpyMTVSEPSTGAKSARRSARKWDRETHLGLVRRARRMNRTLAQAFPHVYCEL
DFTNPLELTVATILSAQSTDKRVNLTTPALFAKYRTARDYATADRTELEE
LIRPTGFYRNKATSLIGLGQALEERFDGEVPRTLDELVTLPGIGRKTANV
VLGNAFDIPGITVDTHFGRLVRRWRWTAEEDPVKVEHIVGDLIERSEWTL
LSHRVIFHGRRVCHARKPACGVCVLAKDCPSYGTGPTDPLIAAALVKGPE
TEHLLALAGL
315446294YP_004079173.1 ADP-ribose pyrophosphatase [Mycobacterium gilvum Spyr1]MSWDSREGELIPSAAPPWLAPLVDQPGAVKNAYRRRVPAEVLAALTAAST
TAAVTGTRRDAAVLVLFSGPEEGERGTLPEHADLLVTVRAATLRHHAGQA
AFPGGAADPDDRSPVHTALREAAEETGLDAGRLRPLATLEKMFIPPSGFH
VVPVLAYSADPGPVDVVDTSETAHVARVPVRAFVNPENRIMVYRDENTRR
TAGPAFLLNEMLVWGFTGQVISAMLDVAGWAVPWENDKLYELRDAMALLD
AEDSYGEAQR
315446292YP_004079171.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMTPPDPSVVRIGGPWRHLDVHANGIRFHVVEAQRPSGADDVTRPLTDRPL
VILLHGFGSFWWSWRHQLTGLSGARLVAVDLRGYGGSDKPPRGYDGWTLA
GDTAGLVRALGHNSATLVGHADGGLVCWATSVLHPRVVKAIAVVSSPHPS
ALRASALRRRDQGRALLPSMMRYQVPMWPERALTRHNGAELERLVRSRAS
EKWQVSEDFAETVGHLRRAVQIPSAAHCALEYQRWAVRSQLRAEGRRFMR
SMRAPLSVPMLHLRGDADPYVLPDPVYRTQRYAPHGRCVSIAGAGHFAHE
EQPAAVNAQLSRFLSQVYA
315446290YP_004079169.1 hypothetical protein Mspyr1_47940 [Mycobacterium gilvum Spyr1]MKTTSLRLLIASVIALAGICAGLGAGAASAQTGVPLGGGSGLIVNGETLC
TLTAIGTDNRGDLVGFTSAHCGGPGAVVASEAAPNAGVVGEMVAGNDILD
YAVIKFDPAKVTPVNEVNGFRIDGLGPDPAFGEVACKLGRSTGYSCGVTW
GPGQEPGTILNQVCGGPGDSGGPVTVNNQLVGMLHGAFSEDLPTCVVKFI
PLHTPAVTMSINTQLADITAKGRPGSGFVPVGAR
315446288YP_004079167.1 hypothetical protein Mspyr1_47920 [Mycobacterium gilvum Spyr1]MTSSRDPLAPLTELPGVAAAADEAREALGRAHRHRANLRGWPQNAAEASL
RAARASSVLDGGALQFPPDGTEPVLAGAIRVAEALEGGEGTLVGVWRRAP
LQAIARLHSLAAADLVDDDALGRPREGAGRRLELLADLATGGTRVPASIL
AAVAHGELLTLEPFGSADGVVARGVSRLITIASGLDPHGLGVPEVHWMRR
SNDYRAAARGFASGTPDGLTAWLLLSCEGLHAGAREALSIAQAPSAQG
315446286YP_004079165.1 chromosome partitioning ATPase [Mycobacterium gilvum Spyr1]MDTAEGVLALVEDPTLNSHVERVAAAAGLRMVRTDDPSSRRVWTGAAAVL
VDGAAARRCAARGLPRRSRVLLISAEAPGADDWEAAVAVGAQQIVTLPAE
DRDLMAALSDAAEAARDPRRRGPIVAVLAGRGGGGASVFATAVAQSATES
LLIDGDPWGGGLDLVLGSETEPGLRWPDLSLAGGRVGYAALRDALPRRHG
VAVLSGSRVLSGDRSSNDIDPAPLGAVIDAGSRGGVTVVCDVARRPGAAA
ETAVAAADLVVLVTPADLRSCAASAATAQWVTAANPNTGVVVRGPAPGGL
RPADVARIVGLPVLTAMRPQPGIESALERGGLRVRSRSPLARAAREVLSV
LGLNPHLDRTAETAA
315446284YP_004079163.1 Flp pilus assembly protein TadB [Mycobacterium gilvum Spyr1]MTLAALALAVAVLTAPTDARLRAPVLRRTSTPRRRLPGPLPAAIACLTVA
AVHTPTTAAALGLLLATLGARRRVTRAHRRRTSEATALQDALDVLVGELR
VGAHPVAAITVAGHEARGRIAESLNAVAARALLGADVPAGLRAEGRRSPS
PGHWDRLAVCWQLAQTHGLAIAALMRAAQRDITERERFRGRVESGMAGAR
ATAVILAGLPVLGVLLGHAIGAEPLAFLLSGGAGGWLLLVGTVFVCAGLL
WSDRITVQVLT
315446282YP_004079161.1 hypothetical protein Mspyr1_47860 [Mycobacterium gilvum Spyr1]MIRQRLQELRVRLVLLAVADDGMSTVEYAIGTIAAAAFGAILYTVVTGDS
IVSALTNIINRALSTNV
315446280YP_004079159.1 hypothetical protein Mspyr1_47840 [Mycobacterium gilvum Spyr1]MMCVALLAVTCGAAVLGSAVAARHRAQAAADLAALGAAGRLADGHDAACR
IADQIVRAMRTTLGECAVDGLDVVVRVDAGVSLGGPLVGSASASARAGPA
DGSG
315446278YP_004079157.1 hypothetical protein Mspyr1_47820 [Mycobacterium gilvum Spyr1]MTHDWMLVETLGTEPVVVAHGDHTKDLIPIGTFLRRNPHLMAIQTAIAET
VRAATGLTSITPKNDRVIRTEVVQMSDGRIHGVQLWLGAPDETAPERPLV
GPLLWDLEAGTATDTTESLQVGGWDPARQARRGRAFADDLPRRDLNPNET
EVISMVIRPEPGTTICNTWDVTDYRGEAITVGFVARSLPEVGDDGRERLI
CRAMNWRSVREGAGIQHDVLAQRILDGLAVPGVHRALVDPKHWTLLKWLD
DPVPFFNWRAGGLRSDVVHPQDMPELDAMATEFADGATARVLRLAGNQGG
WVPVHVTINRVPLGKGIDAGLATLRLPTPAELADARLDEPAPAVRNSRKL
FSHKGTETRT
315446276YP_004079155.1 cold-shock DNA-binding protein family [Mycobacterium gilvum Spyr1]MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EVGQSPKGPQATGVRAV
315446274YP_004079153.1 DNA topoisomerase I [Mycobacterium gilvum Spyr1]MADGDRGSGKNGSVRRLVIVESPTKARKIAGYLGSNYVVESSRGHIRDLP
RAAADVPAKYKSEPWARLGVNVDADFEPLYIISPDKKATVADLKDKLKNV
DELYLATDGDREGEAIAWHLLETLKPRIPVKRMVFHEITEPAIRAAAEDP
RDLDNDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRII
VQRERERMAFRSAGYWDVTAELDASVSDAQATPPTFVAKLNTVDGRRVAA
GRDFDSLGAVKKPGEVLVLDEAAANALAGGLRGAQLSVSSVEQKPYTRRP
YAPFMTSTLQQEAGRKLRMSSERTMSIAQRLYENGYITYMRTDSTTLSQS
AIDAARNQARQLYGEEYVHPTPRQYTRKVKNAQEAHEAIRPAGDVFQTPG
QLHSQLDTDEFRLYELIWQRTVASQMADARGTTLSLRIAGQARTGEQVVF
NASGRTITFAGFLKAYVESLDEQAGGEADDAESRLPNLTQGQRVDAKDLT
ADGHTTSPPARYTEASLIKALEDLGIGRPSTYSSIIKTIQDRGYVHKKGS
ALVPSWVAFAVIGLLEQHFSRLVDYDFTAAMEDELDEIAAGNERRTNWLN
NFYFGGEHGVEGSIAREGGLKKLVGGNLEEIDAREVNSIKLFDDSEGRAV
NVRVGRNGAYLERMVADPDNPGELKPQRANLKDELTPDELTLELAEKLFA
TPQEGRSLGIDPATGHEIVAKDGRYGPYVTEVLPEPPDDGEAGATAKKGK
KPTGPKPRTGSLLRSMDLETVTLDDALRLLSLPRVVGVDPANGEEITAQN
GRYGPYLKRGTDSRSLATEEQMFDITLEEALKIYSEPKRRGRQGAATPPL
RELGVDPVSEKPMVIKDGRFGPYVTDGETNASLRKGDDVMSITDARASEL
LADRRARGPVKKKAAKKAAVKKTAVKKAAKKAPAKKAAKKA
315446272YP_004079151.1 DNA polymerase III subunit delta' [Mycobacterium gilvum Spyr1]MAGVFSRLVGQDTVEAELIAAARAARGDSVHDDDPAETGTMTHAWLITGP
PGSGRSIAALCFAAALQCTSEGRPGCGECRACTTTMAGTHADVRRIIPEG
LSIGVDAMRAIVQIASRRPGTGRWQIVVVEDADRLTEGAANALLKVVEEP
PPSTVFLLCAPSVDPEDIAITLRSRCRHVALVTPPADAIAQVLIADGLSP
DEARWAASVSGGHVGRARRLATDDEARERRKRALGLARDAATPSRAYAAA
EELVATAEAEAKALTGDRNEAESEELRTALGAGGTGKGTAGTMRGAAGAL
KELEKRQKSRQTRASRDALDRALIDLATYFRDALLVSAGATDVVANHPDM
ADKVAALAAHAPPDKLLRCIEAVLECREALAVNVKPKFAVDAMVGTVGQA
LRS
315446270YP_004079149.1 hypothetical protein Mspyr1_47730 [Mycobacterium gilvum Spyr1]MAVFDRLSIRVAAVGAGLCGIALAVSPGVAHAGGAECLQTSAGQDPAATA
PCAPVAEMSGVPMALPGPVPPPMAPPPVVPPVVPPLAPPPVVPPVVPPLA
PPPVVPPIPAAGAAGGLPVASMGGLAGKGDLTGPAPSGAPVPGQPIPPGP
TGGN
315446268YP_004079147.1 hypothetical protein Mspyr1_47710 [Mycobacterium gilvum Spyr1]MRFTVARAAGALIALHLVVRAVLAFGGYFYWDDLILVGRAGTQGLLSPGY
LFDDHDGHVMPGAFLVAGAITRMAPLDWAGPAVSLVVLAVVASLALLRAL
YVILGWRPVLLVPLTFALFTPLALPSFAWWAAGLNALPMLAAMAWVCADA
ILLLRTGNQRYALSGALVFLGGLLFFEKAAIIPFVAFTVTALYGHVTATA
GVSQVWRRGARLWTATLALTAGWVGVYLLVVDQQRWSFDLSMTWDLLRRS
FTHGIVPGLVGGPWDWQRWAPASPWATPPVIVMVVGWVALAAVVVVTLLR
KRRLGPVWLAALGYAVACQVPIYLMRSSRFTALELAQTLRYLPDLVLVLA
LLAAVGLCAPNRERSRWLDRSPWRTLAIACCTALFVMSSLYSTATFLTSW
RDNPAQPYLQNARSGLAQAHAGSDAPMLDQEVDPLVLQRVAWPENLASHM
FALLPERPEFASTTTDLRTLDSTGRLTDAQVTWVRSIRPGPEQGCGYLVQ
PDQPVRMPLDGPLLPADWTVEINYLGNSDGSMTLSLSEGEEVRVPVEPGL
NRVFVRLPGAGDAITASANTAALSVCIAAGPVGFVAPAP
315446266YP_004079145.1 hypothetical protein Mspyr1_47690 [Mycobacterium gilvum Spyr1]MTDATAGPSGAVSRASVVRVGVATALSALCGYAVLYLAARDLEPAGFSVF
GVFWGAFGLVSGAAFGLLQETTREVRHPSAGTAHRHTRPLAVAAAVGVAA
AAAIGVSAPLWSAHVFVDARMLSVALLCAGLAGFCVHTTLLGALAGMGRW
SDYGALMVTDAALRVVVAAAGFAAGWGLGGYLWATVAGAFSWLLMLLVSP
ATRAAARVQTTGGTATFLRGAGHSMAAAGASAVLVMGFPVLLAATSGDLG
ATGGVVILAVTLTRAPLLVPLTAMQGNLIAYFIDQRAHRLRALLAPSALV
AALGAGGVVLAAVFGPWLLREAFGAQYRADGALLAWLTVAAVAIALLTLT
GAATVAAALHRAYAAGWVIATAAAALLLMLPLDLEIRAVVALLCGPLLGI
AVHLSALARDRDGVAPTYAAIDD
315446264YP_004079143.1 amino acid adenylation enzyme/thioester reductase family protein [MMDRTPEIPSQFLLSAYAPQPRTLIDILAETARRFPDAPALDDGTVQLTYA
ELLSDVEDSVAWLGARGIGRGDRIGIRMPSGSYALYVAILATLAAGAAYV
PVDADDPQERADLVFTEAGVVAIITERGLVRGPGASRGWRAAAPLSRDDA
WIIFTSGSTGTPKGVAVSHRNAAAFVDAEAKMFLQNNPLGPGDRVLAGLS
VAFDASCEEMWLAWRHGACLVPAPRSLVRSGMDLGPWLVSRDITVVSTVP
TLAALWPAEALESVRLLIFGGEACPPELAERLAAGPDSAGREVWNTYGPT
EATVVACAARLDGGSGGQERSDQGNRTAAVSIGLPLPGWDLAVVDKAGEP
VAVGEVGELIIGGVGLARYLDQDKDAEKYAPFPTLAWSRAYRSGDLVRLE
TDGLYFVGRADDQVKVGGRRIELGEVDNALMNLPGVTGAAAAVRRTASST
PLLVGYLAVAPGLETPFDISRARAQLSEALPAALIPRLVVVDELPTRTSG
KVDRDALPWPVDSAEKDTADGSDLGGGTLGWLAGVWRDVLAAPIDGPEAD
FHALGGGSLSAAQLVAALRQRYPQVTVADLYDHPRLGSLAGYLDELDPPA
AVETRTVTPVSRLTQAVQVALTVPLAVLTGLQWVVWLAVANNIAAEFSLV
DWVSPVNWWWVLAGFLVFVTPPGRMSIAVFGARVLVGNLQPGTYARGGSV
HLRVWLAERLADASGAENMAGAPWLVYYARALGNRVGSGVDLHSAPPVTG
MLTLGHRCSIEPEVDLTGHWIDGDLFHVGPITVGNDATVGARTTLLPGAV
VGKNADVAPGSGVIGKVKNGQYWKGSPAVKSGKAKHPWPDHRPPRAPVWV
AMYGITSMLLAALPLTALAAGLAVIGWGVRGTSTVTSAIVPALLWAVPAT
AAAVLVYATLTVIGVRLLAIGLTEGYHPVRSRPGWQLWATERLMDSARTY
LFPVYAGLLTPWWLRLLGATVGKGTEISTALLIPKFTVIEDGAFLADDTM
VASYELGGGWIHVARATVGKRAFLGNSGITQPGRRVPDDGLVAVLSATPR
KAKAGSSWLGSPPVRLRRRPTAADALRTFHPSVRLKMLRATVEMFRFVPV
VVTFTLGIAVLFAIQAAAVHVGWPWAALAAGPVLLTAGAVAGAIAVIAKW
LVIGRITAIEHPLWSSFVWRNEVADTFVETVAAPWFARAASGTPVMNLWL
RGLGATIGRGVWCETYWLPEADLVTLDDGATVNRGCVVQTHLFHDRIMRM
DTVVLEAGATLGPHCVALPAARIGAGATVGPASLVMRGDEVPPSTRWQGN
PIAVWNPPRKKRESDPKPKKSAAA
315446262YP_004079141.1 hypothetical protein Mspyr1_47650 [Mycobacterium gilvum Spyr1]MSELTDNQRGDQQIVRVAAPDLQKARKVCARIREDARDVAVILDVTVSVA
GDFRAAQRVRGPATDTDADTVHYVGTLDGLANLISDIASAGVADGVTLIP
ASPRQDVETVGRDILGRLTGRDQPRAS
315446260YP_004079139.1 inorganic pyrophosphatase [Mycobacterium gilvum Spyr1]MQFDVLIEIQKGSRNKYEVDHESGKVKLDRYLFTSFGYPTDYGYIEDTLG
EDGDPLDALVLLPEPVFPGCIVEARPVGMFRMEDEKGGDDKVLCVLADPR
WDHIQDIGDVSDFELDAIKHFFVHYKDLEPGKFVKAADWVGREEAEAEIN
RSIERFKTEGH
315446258YP_004079137.1 hypothetical protein Mspyr1_47610 [Mycobacterium gilvum Spyr1]MTPKTHSDSGTSRFSVGHAVDWNLAATVGGKLARQEPKATDYTRRQTIEQ
LAQSARDSEIPVREVTGLIEGGEIPEARIVNRPDWIRAATQSMRAMTGGT
HDRDVKPRMITGRIAGAQTGAVLAFVSSGILGQYDPFSGDGELLLVYPNV
IAVERQLRVVPGDFRMWVCLHEVTHRVQFRANPWLAEHMSGALAVLTEDG
GEDLTKMVGRLADYVRDHQVVVKNGEPELNSTGIIGLLRAVQSEPQRQAL
DRLLVLGTLLEGHAEHVMDAVGPAVVPSVATIRARFDQRRQRKQPPLQRL
LRILLGVDAKMSQYTKGKAFVDEVVGKVGMERFNAIWTDADTLPQPREID
EPQRWIDRVL
315446256YP_004079135.1 hypoxanthine phosphoribosyltransferase [Mycobacterium gilvum Spyr1]MPAHTADLYSGDIKSVLLSEDQIRAKTAELAALIADDYQDRESGQDLLLI
TVLKGAVMFVTDLARAIPLPTQLEFMAVSSYGSSTSSSGVVRILKDLDRD
INGRDVLIVEDIIDSGLTLSWLLRNLATRGPKSLRVCTLLRKPEAVRAEL
DVEYIGFDIPNEFVVGYGLDYAERYRDLPYIGTLDPKVYEP
315446254YP_004079133.1 hypothetical protein Mspyr1_47570 [Mycobacterium gilvum Spyr1]MPIPAHAKTVRNSFIAAAVAALTVAGSTACDARSTAPAPGTDSRQVTVVG
AGEVQGTPDTLTVNASMEFLGPDATAAMNQTDERQQAVIDGLVGLGIDRA
DIATTAADLQPQYGSNGTAIAAYRATNTVNVTIRDLAQASDAISLVVNTG
GDAARINSIAYSIEDDSELVRDARARAFEDAKDRAGQYAELSGLSLGKVI
SIAESGGAPPPVPMQAPRAMEAAVPMEPGQQMVGFSVTVVWELT
315446252YP_004079131.1 membrane protease FtsH catalytic subunit [Mycobacterium gilvum SpyrMNRKNVIRTLTVIAVVLLLGWSFFYFSDDTRGYKPVDTTIAIAQINGDNV
NSAQIDDREQQLRLELKNGNGDTENSTQILTKYPTGYGATLFESLQDKNI
KTNTVVNQSSIFGTLLIYMLPLLLLVALFVLFSRMQSGGRMGFGFGKSKA
KMLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQ
AKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRQ
GVILIAATNRPDILDPALLRPGRFDRQIPVSSPDLAGRRAVLKVHSQGKP
IAEDADLEGLAKRTVGMSGADLANVINEAALLTARENGTIITGPALEEAV
DRVVGGPRRKSRIISEHEKKITAYHEGGHTLAAWAMPDIEPIYKVTILAR
GRTGGHAMAVPEDDKGLMTRSEMIARLVFAMGGRAAEELVFREPTTGASS
DIDQATKIARAMVTEYGMSSKLGAVRYGSEHGDPFLGRTMGNQADYSHEV
AQIIDDEIRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRVELEA
IFGDVKKRPRLTMFDDFGGRVPSDKPPIKTPGELAIERGEPWPKPVPEPA
FKTAIAQASRAAAEAAPKNGGNGANGAHAPGPDYGAPAGWHAPGWPPPPG
GPQQQQPPQQQGYWYPGPPQQQGWQGNAPTPAYPGYPPYQPYPQPGQHAP
HGGAPAPNPTDDPGQDRGRENGHRDTERRDTDPHGPANG
315446250YP_004079129.1 dihydropteroate synthase [Mycobacterium gilvum Spyr1]MTCAVQVMGVVNVTDDSFSDGGLFLDRDRAVAHGVELVAQGAAIIDVGGE
STRPGATRVDPEVEISRILPVVKELAQQGITVSIDTMHAAVAHAALDSGA
KIVNDVSGGRADPDMVRVVADAGVPWILMHWRSVDGDNPHEVPAYGDVVA
EVRDELLSGVDAAVAAGVHPDKLIIDPGLGFAKTGQHNWALLHALPDFVS
TGIPVLVGASRKRFLGTLLAAPDGEPRPPAGRETATAVISALAGWHDVWG
VRVHDVRASVDALAVVAAWRGGAS
315446248YP_004079127.1 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinaseMTSVVLSIGSNLGDRLAHLQSVLDALGPAVTGVSPVYETDAWGGVEQSPF
LNAVVLAEDPALDAHGWLRRAHELEDACGRTREQHWGPRTLDVDLVSCRD
GDAEIVMDDPDLTLPHPYAHVRAFVLVPWSAVDASAASAASAVSAHLAAL
DPAERAGVRLTELVLRPRSAG
315446246YP_004079125.1 hypothetical protein Mspyr1_47490 [Mycobacterium gilvum Spyr1]MTVLLVLAIAASSALVFTSRVELLRLAVILALWAAVVAAFVSVIYRRQSD
SDQAKVRDLKLVYDLQLEREISARREYELSVESHLRRELASELQAQSSDE
VASLRAELAALRANLEYLFDADLSHRPALETERTAGRVTSSRIDTEDDVV
AAAEEPDAPETEESPIIDVPAEPHPPEHEWAAAVDEHGGAHRRSGEQETA
RRHRADAAAQPQWAPPPPPQQHPQQPPQPPQMPPPPMPPPPQPPPPQTPP
PGPQFPWLPPQQAPPQQAPAQSSQWQPVPAEGQYIPAGAPGSNWVAPPAE
DGHDEYVGRRRAPEQPSEDRRPPRGRHSAAGEQPQEPAVPDEEPEQPDES
DADGGAHTGGQSVAELLARLQATPSGGGGRRRRED
315446244YP_004079123.1 pantothenate synthetase [Mycobacterium gilvum Spyr1]MGMGGAPKFVAGQLNLYHRPTDVSAVTRALRATGRRIILVPTMGALHDGH
LSLVRAAKRASGAVVVVSIFVNPLQFGAGEDLDAYPRTLDEDLALLREEG
VEVVFAPTANDMYPNGMRTTVHPGPIGAELEGAVRPTHFAGMLTVVLKLF
NIIAPDRAYFGEKDYQQLALIRQMVSDLDLDIQIQGVPTVREADGLAMSS
RNRFLAAEEREQAGALSAALLAGMYAASAGVAGALDAARAVLDEVPTLQL
DYLEIRNPMLGPPPAEGPGRILVAARLGRTRLIDNIAIDIGASAGIDGHP
RTAHGKSSEIPWRN
315446242YP_004079121.1 pantothenate kinase [Mycobacterium gilvum Spyr1]MLLAIDVRNTHTVVGLISGSGSHGKVEHHWRIRTESEVTADELALTIDGL
IGDDAELLTGAAGLSTVPSVLHEVRVMLEQYWPSVPHVLIEPGVRTGIPL
LVDNPKEVGADRIVNCLAAYQKYGSAAIVVDFGSSICVDVVSAKGEFLGG
AIAPGVQVSSDAAAARSAALRRVELTRPRSVVGKNTVECMQAGAVFGFAA
LVDGLVNRIREDVDGFGGDDVTVVATGHSAPLVLEDLSTVQHYDRHLTLD
GLRLVFERNRDNQRKLKQAR
315446240YP_004079119.1 lysyl-tRNA synthetase [Mycobacterium gilvum Spyr1]MTSPDSPDDIPEQFRIRQAKRERLLAEGREPYPVKVDRTHTLAELRQAYP
DLEPDTKTGLKVGVAGRVIFARNSGKLCFATLQEGDGAQLQVMISFAEVG
QESLDAWKADVDLGDIVFVHGEVISSRRGELSVLADSWQIVSKALRPLPV
AHKELNEETRVRQRYVDLIVRPEARTIARQRIAVVRAVRSALERRGFLEV
ETPMLQTLAGGAAARPFVTHSNALDADLYLRIAPELFLKRCVVGGFDRVF
ELNRNFRNEGADSTHSPEFAMLETYQAYGTYDDSATVTRELIQEVADEAI
GTRQVPLADGTEYDLDGEWQSLQMYPSLSEALGEEITPATPAEKLWQIAD
RLGVEIPRDRGYGHGKLVEELWEFTVGDTLWAPTFVRDFPVETTPLTRPH
RSIEGVTEKWDLYVRKFELATGYSELIDPIIQRERFEAQARAAAAGDDEA
MALDEDFLAALEYGMPPTTGTGMGIDRLLMALTGLSIRETVLFPIVRRHS
N
315446238YP_004079117.1 chaperone ATPase [Mycobacterium gilvum Spyr1]MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYQGKET
AEAGTGGRGGEAGNPSTSLVLDQFGRNLTAAAMEGKLDPVIGREKEIERV
MQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGDVPETLKDKQLYTL
DLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG
AIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEP
TVAHTIEILKGLRDRYEAHHRVSITDGAIAAAATLADRYINDRFLPDKAI
DLIDEAGARMRIRRMTAPPDLREFDEKIADARREKESAIDAQDFEKAASL
RDKEKQLVAQRAEREKQWRSGDLDVVAEVDDEQIAEVLGNWTGIPVFKLT
EEETTRLLRMEDELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFI
FAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPG
YVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDG
QGRTVDFKNTVLIFTSNLGTSDISKAVGLGFTQGGGDNNYERMKQKVHDE
LKKHFRPEFLNRIDDIIVFHQLTQDEIIQMVDLMIGRVGNQLKAKDMAME
LTPKAKALLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEELGPGQLV
TVDVENWDGEGQGEDAVFTFSGARKPVEVAEPDLAQAGAGGAGPAAE
315446236YP_004079115.1 hypothetical protein Mspyr1_47380 [Mycobacterium gilvum Spyr1]MEKQIIWRGLLAGAVAGVLAFVFARIFVEPQIELAIGYEEGIGAAHDALQ
HGHGGHGGHGHSHDGEGGITRAIQMNVGLGLGLLAFSVAIGALFSVVYAV
AYGRIGTVSARLTSLYVAGGMLLSLYIVPSLKYPASPPALSLDETIRQRT
LLYLATVVLSVALLVAAVYLGRRWAARLGAWNASVAAAGAYIAAVAVMML
VLPSINETPGPLRDDNGAIVYEGFPADLLYEFRLYALGTQVVVYATIGLV
FAAMISRLLGERKQSVPA
315446234YP_004079113.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MRKVRTGSGAVAVQVVRKHRGQRTILAHVGSAHTDAQLGILLERARQIAA
EDQGVLDIEVPARTQSIDTIADWRAGTLSLSPGGPQGAPVPAGRTAATHS
RLLYDVLGTVYDWLGFDVVDDAVFRDLVIARIVEPTSKADAARVLADLGA
EAMSYRTIQRHLGKAKSNRYREQIAARCFTHAADRGGLSLLLYDVTTLYF
EAENEDDLRKVGYSKERRVDPQIVVGLLVDRSGFPLEIGCFEGNTAETTT
LIPVVTAFAERHDLGDTPMVIAADAGMLSATNLAALNDAGLGFIVGSRMT
KAPGDLESHFHWHGDVFTDGQIIDTVTPRHANSTVNDAAHRAEPIWDPDE
HTNAWRAIWAYSAKRARRDQKTVYAQEARARAVINGERAAKSTRFVKTAA
GDRILDEAALARAQSLVGLKGYVTNVPATIMPAGEVIAHYHELWRVERSF
RMSKSDLRARPMFHRTRDAIEAHLTIVVTALAVAHNIQERTGLAIANVVK
QLRATALGDDRHQRDHRDLPTPSPRGPTENPGQPQHPRTGALSQMS
315446232YP_004079111.1 biosynthesis of extracellular polysaccharides protein [MycobacteriuMSDKTPVVKINAIEVPPDAGPELEKRFAHRAHAVDNQPGFLGFQLLRPVK
GENRYFVVTQWESDEAFQAWANGPAVEAHAGERKNPVATGASLLEFEVVL
NVAGTDTDA
315446230YP_004079109.1 hypothetical protein Mspyr1_47310 [Mycobacterium gilvum Spyr1]MSTALAFLILVSPFALATLLTWAAHRSGSLRMHLDQFRVSGPMTGRLFDH
RDSDSYRVQHDLDAIRTRFEEQPAWPGPAVSSERR
315446228YP_004079107.1 A/G-specific DNA glycosylase [Mycobacterium gilvum Spyr1]MIDPNELIRWYATAQRDLAWRRPGVSAWQILVSEFMLQQTPVARVEPIWL
DWVARWPTPSATAAASAADILRAWGKLGYPRRAKRLHECATVIATEHGDV
VPDDVDTLLTLPGVGTYTARAVACFAYRQRVPVVDTNVRRVVARAVHGLH
DAGPPSTRDLADVAALLPDDDTAPHFSIAVMELGATVCTARAPRCGVCPL
THCAWRSRGFPAGTGPARRVQRYAGTDRQVRGRLLDVLRDNASPVTRAEL
DVAWTTDPAQRDRALDSLLVDGLVEQTADGRFALAGEGDQT
315446226YP_004079105.1 hypothetical protein Mspyr1_47270 [Mycobacterium gilvum Spyr1]MTWAYRVDVLDLEPHGPLPRQIYWRRRALAAGIAALVIAVVVAVITVVVL
NTRSTEQPAASESAAETGQAAPPPLPGENPDVKSPIQPPAQQAPPPTPTP
TAAVVPPPILKEGDDCPDSTLAVKGITNQPQFIVGDQPKFTMVVTNIGLV
ACQRDVGAAVLAAYVYTLDNQRLWSNLDCAPSNETLIKTFQPGEQVTTEV
TWTGMSSAPNCPLPRQPIGAGTYNLVVQLGNLRSAPVPFILAEAAAMPPP
VEGAPHLPVPGPAPVG
315446224YP_004079103.1 DNA repair protein RadA [Mycobacterium gilvum Spyr1]MARTNSKVRSQYRCSECHHTTAKWVGRCSDCGTWGTVDEVALTAVGGATR
RAVAPASPAVPISSIDPGTTRHFHTGISELDRVLGGGLVPGSVTLLAGDP
GVGKSTLLLEVAHRWASTGRRALYLSGEESAGQIRLRAERTGCSHDEVYL
AAESDLQTALGHIDAVRPSLVVVDSVQTMSTTEADGVTGGVTQVRAVTTA
LTMTAKTTGVAMLLVGHVTKDGAIAGPRSLEHLVDVVLHFEGDRASALRM
VRGVKNRFGAADEVGCFLLHDNGIECVSDPSGLFLDQRPKAVSGTAVTVT
LDGKRPMIGEVQALIGASASGSPRRAVSGIDSSRAAMITAVLEKRARLPV
GTNDIYLSTVGGMRLTDSSSDLAVALAIASAYTDLALPTTAIAIGEVGLA
GDLRRVTGMDKRLAEAARLGFTVAVVPSGAVGAHAGLKVLQADNIGSALQ
VLRRISQNDASQGRADD
315446222YP_004079101.1 CarD family transcriptional regulator [Mycobacterium gilvum Spyr1]MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPA
DNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGD
VNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAENTDDAKA
STILDEVLAAAS
315446220YP_004079099.1 cysteinyl-tRNA synthetase [Mycobacterium gilvum Spyr1]MTDRPAAGMRLYDTLSGGVRDFAPLRPGHVSIYLCGATVQGLPHIGHVRS
GVAFDVLRRWLTAKGFDVAFIRNVTDIDDKILIKAADAGRPWWEWAATYE
RAFTAAYDALGVLPPSAEPRATGHITQMVELIDRLIERGHAYCADQEGNG
DVYFSVSTLPDYGKLSGHRIDDVHQGEGVATGKRDQRDFTLWKGAKPGEP
SWPTPWGRGRPGWHTECVAMCEAYLGAEFDIHAGGMDLVFPHHENEIAQA
EAAGDGFARFWLHNGWVTMGGEKMSKSLGNVLAIPAVLQRVRAAELRYYL
GSAHYRSMLEFSENALQDAARAYSGVEDFLHRVRVRVGAVVPGEWTPKFG
AALDDDLAVPAALAEVHAARAEGNRALDAGDHDAALTHAMSIRAMMGILG
ADPLDERWESRDETSAALAAVDVLVHAEVRRREDARARRDWAEADAIRDR
LKEAGIEVTDTGDGPQWSLLDGTDK
315446218YP_004079097.1 Na+/H+ antiporter NhaD-like permease [Mycobacterium gilvum Spyr1]MALTLSVAALAAVLACALLRPRLQAIVAGLAAALVIVAGATTWRAAVGEI
SELAPVVAFLAAVLVLARLCDDEGLFRAAGTLMARATSGGQSRLLTTVFA
ISAAVTAILSLDATVILLTPVVLATARALAVPARPHAYATAHLANSASLL
LPVSNLTNLLAFSAAGLSFLHFAAAMTLPWIAAIVVEFLLLRWLFAKDLA
TEPQRAVSVEPLDVPKFTLAVVVLTLAGFAVTSLLGFSPAWAALAGALVL
GVRALADRRTTMSRIVVSLDIPFLIFVLCLGVVVDAVMRNGLESAMQQVI
PDGHGLLALLGIAAVAALLSNVVNNLPAVLVLLPLVAGSGPAAVLAVLIG
VNIGPNLTYVGSLANLLWRSVVRRDVKAGFGEFSRIGVVTTPLVLVAAVL
GLWTYVRLIGL
315446216YP_004079095.1 arabinose efflux permease family protein [Mycobacterium gilvum SpyrMVAIDRSIGETQRWAYPLLLVLSGVALGVSGLPAPLYGIYETNWHLSPLA
TTIVFAVYAVAALAAVLVSGRISDVVGRKPVLLGALVALLIGLGVFLIAD
SMAMLLLARAIHGVAVGSIVVAGAAALLDLRPDHGVRVGQLSGVAFNIGM
TIAIFGSALLAQYAPHPLRTPYAVVAVICLIVGVGVLALREPHTARTRGP
IRIARPAVPAEIRADFWFSALGAMASWSVLGVLLSLYPSLAAHHTHIDNL
VFGGAVVATTAFAAALAQLAATRVPARYAAIIGDAGMAAALLLTIPVLLT
HQWQLVFVAAALLGATFGLGFGGSLRHLSNVVPPARRGETMSAFYLLAYS
AMAVPTLVAGWAATRWELASVFPWFAGIVSAACLGAAVAGLRSIRVARAA
315446214YP_004079093.1 rhodanese-related sulfurtransferase [Mycobacterium gilvum Spyr1]MSRADVFVTATDLSRMIAEDRPVSVLDVRWRLDAPDGRQAYAQGHVPGAV
YVSLDDELSDHSVPDRGRHPLPSGVALQAAARRWGLREGVPTVVYDDWNR
AGSARAWWVLRAAGIEDVRILDGGLAAWAAAGGDLEAGEVSRPPGDVVVR
CADLYRGALPTLTVDEVAEFDGLLLDARAPERFRGDTEPVDPVAGHIPGA
TNAPSTGVLDGDGVLLPTEELVAFAERVGADGDSAVGVYCGSGVTAAVTV
AALMATGVPARLFPGSWSQWSADPSRPVATGH
315446212YP_004079091.1 ABC-type metal ion transporter periplasmic protein/surface adhesin MLRSTRRGRALAGIAASAALVLTACGGSGNTGAGDEASAGDCPAAPVDVV
VSVDQWGDIVSQLGGVCTRVTTVVAGSSVDPHDFEPAPSDAVAFEGAQLV
VVNGGHYDEWATKLAQTSAPDAHLIDAVALSTGHSGHEDHGHEGHDHEGH
DHADEGNPHVWYRPSAVTEVVDAVTAELTALSADAAGYFADRHRAFVESM
KPYEDTVAAIRAGATGKTYAAAEGAFDDMAAALGLTNRTPPGFQVAAANH
SEPSPADLDAFLNLLSERGVDVLVYNTQTEGSVPEQIRRAAEQSGVPVVE
VTETLPSDAGSFQDWQVAQLDSLAEALGVGT
315446210YP_004079089.1 ABC-type Mn2+/Zn2+ transporter permease [Mycobacterium gilvum Spyr1MTQTVLAVGYQQNWVDIVGSLFMRNAWLGGTIVALAAGLMGYFIVVRHSS
FAAHALAHIGLPGATGAVLIGVPAAVGLGVFCVGGALVIGALGKRAADRE
VATGTVLAFATGLGLFFNSLATKNSSTLTNVLFGNLLAISGQQLLSFFAL
LLLTAAGMAFIFRPLLFTSVNSRVAEAKGVPVRGLSVAFMVLLGLTVTMA
VQAVGTLLLFALVVTPAATALMLTARPVLAMGLSAAIGLVSVWAGLVLSA
MFNLPPSFVIVTIACAVWLVVWGGSRMPRRGRKEAVAQPIG
315446208YP_004079087.1 trehalose 6-phosphatase [Mycobacterium gilvum Spyr1]MSALLPELESALSAAARTPRLLVASDFDGTLAPIVNNPADARPLPGAAEA
LIALATLPSTAAALISGRALATLRELSSMPDSVHLVGSHGAEFESGFSRD
IDRDLLQTITDGLDAIAAGRPGVAVETKPASVALHVRNASPADGDAALAA
AWDAARDWDAHITTGKAVLEFAVISTDKGEAVDILRERLQATTVVFLGDD
VTDEKAFVRLGESDVGVKVGPGDTAAAYRVESPADVATALRHLVDTRASQ
SPQPAP
315446206YP_004079085.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MPVPTSATITDEQADARELVRSWATASGSFEAAREVEQGDAAAWQAPYGR
LAELGIFGVALPEAHGGADGTVADLAAMVDEAAAALVPGPVATTALATLV
LPDGQADLLESLATGQRWAGVALNADLSYADGRVSGTAAYVLGADESAVL
LLPAGETWLLVDAGADGVTVEPLQATDFSRPLARVSFDGAPAEALPVSGQ
RVVDLAATLMAAESAGLARWLLHTATEYAKVREQFGKPIGSFQAIKHMCA
EMLLRSEQASVAAADAARAASDPAADAAQLSIAAALAASVGIEAAKANAK
DCIQVLGGIGITWEHDAHLYLRRAYGIAQFLGGRSHWLRRVAALTQQGVR
RELHIDLESVADLRPEIASAVAEVAAAPEDGRQVALAETGLLAPHWPKPY
GRAAGPAEQLLIDQELASAGVVRPDLVIGWWAVPTILEHGSPELIEQFVP
PTLRGELTWCQLFSEPGAGSDLAALRMKAVRAEGASASGAKVSGWKLTGQ
KVWTSAAQKAHWGVCLARTDPEAAKHKGITYFLIDMKSPGIVIRPLREIT
GDELFNEVFFDDVFVPDEMVVGEVNQGWRLARTTLANERVAMAQGTALGN
PMEELLRVIAELDVDGAQQDRLGHLIGTAQVGTLLDQRIAQLAVEGQDPG
PQASARKLIGVRYRQALAEFRMELSEGAGAIVNQQVHDFLNTRCLTIAGG
TEQILLTMAGERLLGLPR
315446204YP_004079083.1 flavodoxin reductase family protein [Mycobacterium gilvum Spyr1]MTDVAADEPLGAHVLELEIADVIDETSDARSLVFRSPADAPVAPEKLRYS
PGQFLTLRVPSEKTGSVARCYSLCSSPFTGDPLTVTIKRTADGYASNWLC
DNAHAGMKMHVLAPSGTFVPKNLDTDFLLLAAGSGITPMLAILKSALSEG
SGHVTLVYANRDEKSVIFAETLRDLANKYPDRLTTIHWLESVQGLPSVSA
LTALFAPFTSREAFICGPGPFMAAAEEALTASGAAADKIHIEVFKSLDSD
PFAAVTIDDADDEGDSGPATVVVTLDGETHEVSWPRKAKLLDVLLNKGLD
APFSCREGHCGACAVLKKSGDIEMEVNDVLEQQDLDEGLILACQAHPTSD
SVEVTFDE
315446202YP_004079081.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMTSFAAEAAQQQEITFESTSRYAQVREDMRLHYHEAGVGNPKTVVLLHGG
GPGASSWSNFGRNIPVLAKHFHVLAVDQPGYGHSDKHTEHEQYNRYSATA
LLNLFDHLGIEKAALVGNSLGGGTAVRFALDNGKRAGKLVLMGPGGLSVN
LFSPDPTEGVKLLGRFAAEPTRENIEKFLRIMVFDQAMITPELVEERFQI
ASTPESLAATKAMGKSFAGADFELGMMWRDVYKLRQRVLLIWGREDRVNP
LDGALVALKQIPRVQLHVFGQCGHWAQLEKFDEFNKLTIDFLTN
315446200YP_004079079.1 hypothetical protein Mspyr1_47010 [Mycobacterium gilvum Spyr1]MGSPPIDPRTFRNVLGQFCTGITVITTVHDDAPVGFACQSFAALSLDPPL
VLFCPTKASRSWAAIEASGTFCVNILHENQQHVSARFGSREPDKFAGIDW
APSKLGSPVIEGSLAHIDCTVHSVHDGGDHFVVFGAVHSLSDVPKKKPRP
LLFYHGQYTGIEPDKNTPADWRNDLEAFLTATTDDTWL
315446198YP_004079077.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPPPVRTPRRSWIDAGLALLAQEGPDAVRVEVLAQRLGVTRGGFYRQFEG
RSDLVTAMLDEWEQRSIDEVRARVEAEGGDVQSRVTRAGALTFSDELVPL
DLAVRDWARRDSDVAARLRRVDTRRIGFLRELLGAVCEDADEVEARALLA
FSLAIGTHVIAADHPGPRQRVVRDATRLILDGVTPV
315446196YP_004079075.1 LysR family transcriptional regulator [Mycobacterium gilvum Spyr1]MQLPSPAMVKTAGWFCENAEMSPLGRRPSADDLLVLLAVGRTGKYTSAAD
ELGLNHTTISRRIAALEQAMGGRVLARVAGGWELTDLGRDALAAAEVVET
AVRSLATDPAGQRALEGVVRISATDGFSAYIAAPAAAAVQRRHPGVAVEI
VATTRRATQQRSGMDVEVVVGEPKVRRARALRLSDYCLGLYGSRDYLATR
GTPATIAELQKHPLVYFIDSMLQVDDLDLATSFTPAMRESVTSTNVFVHV
EATRAAAGIGLLPCFMADRHDDLVRVLPGQVSITLTYWLVTRAETLRRPE
VAAVVDAIRARVRDQHHMLLGAG
315446194YP_004079073.1 hypothetical protein Mspyr1_46950 [Mycobacterium gilvum Spyr1]MSESGVNDLRSRTAVVTGGAGGIGAACAKALAERGVTVTVADIDEVGAKT
VAEEIGGKAWALDLLDVAALESLQLETDILVNNAGVQNISEIAEFPPEKF
RSMMALMVEAPFLLIRAALPHMYRNEFGRVINISSIHGLRASPFKVAYVT
AKHALEGLSKVTALEGGPHGVTSNCVNPGYVRTPLVTKQIADQARTHGIP
EDQVVSDILLKESAVKRLVGPEEVGSLVAWLASPAAGMVTGASYTMDGGW
SAR
315446192YP_004079071.1 hypothetical protein Mspyr1_46930 [Mycobacterium gilvum Spyr1]MFESLFDIDEGASQAELRAVVERCERLKSAAAAAQARATALWAAKRAAAE
EAAGVPVRRRGKGLASEVALARRDAPVKGGQHLGFAKALVHEMPHTWAAL
ECGALSEWRATLIVRESACLSVEDRRRLDEELCADVSTLEGWGNKRVEAE
AKKIAARLDVAAVVERADKAAAQARVSCRPAPNGMVYFTVLLPLAQGIGM
YAALKHHADTTFDGRSRGQVMTDTAFERITGRSAGTAVPVALNLVMADTT
LAGDDDCPGWLDGYGPVPAGFCRALTGDAVADKGARATLRRLYRHPRSGQ
LVAMESRARIFPKGLATLIDRRDQTCRTPYCDAPIRHHDHATPDRAGGKT
SAENGLGECAACNYAKEAPGWQVSAGTQDGSHTARWVTPTGAVHYSIAPT
LPGPPVRRRISDTEGRLSIDLITFDKPDAA
315446190YP_004079069.1 aspartate/tyrosine/aromatic aminotransferase [Mycobacterium gilvum MTPSQRSGIPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPTAVRDA
AVAALHRNQLGYTVALGIPELRTAIAGSYQDRHGLEVDPGDVVITTGSSG
GFLLAFLACFDVGDRVAIASPGYPCYRNILSALGCEVVELPCGPDTRFQP
TLQMLTELDPPVSGVIVASPANPTGTVIAPEELAAIAAWCETSGVRLISD
EVYHGLVYPGAPATSCAWETSRESIVVNSFSKYFAMTGWRLGWLLVPDEL
KRAVDRLTGNFTICPPVLPQLAAVAAFTPESVAEAESLLEGYGANRTMLL
DGLRALGIDRLAPTDGAFYVYADVSHLTTDSLSFCSKLLADTGVAIAPGV
DFDTVRGGAFVRLSFAGPSSDIEEALRRFGAWLP
315446188YP_004079067.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MNFEIDDQQRDFAASIDAALGAADLPAAVRAWGEGDTAPGRKVWSQLTDL
GVTALMVPEKFDGIEAHPVDLVVALERLGRWNVPGPVTESIAVAPILLGD
DDRVGALASGELIATVAAPPLVSRAVDADTAGLILLATEGAVADAEMGTQ
HESVDPARKLFEVTASGEARAADVERAFEFGALATAAQLVGAAQAMLDAS
VEYAKQRSQFGTIIGTYQAIKHKLADVLIAVELARPLVYGAALSLADGSQ
DTARDVSAAKVAAADAALLAARSSLQTHGAIGFTQEHDLSLLLLRVQALR
PAWGDPTWHRHRVLEALTK
315446186YP_004079065.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MTTSPRTTPAVLERIARELPDQPAVVTAQRTLTYFGLRSEVLHAAAAMID
LGIEPGDRVAIWSPNTWHWVVASLAIHHAGGVLVPLNTRYTASEAEDILA
RTGAPLLFASGAFLGADKAASVDRDSLPALRHIVRIPVDTDDGTWDEYIA
RGAKEEALAAVGARAAAVTADDVSDILFTSGTTGRSKGVRCAQRQSLDAS
AAWAACGQLTRDDRYLCINPFFHNFGYKAGILACLQTGATLYPELTFDPG
ETMQAVQEHRITVLPGPPTIYQTLLDHPRRSEFDLSSLRFAVTGAATIPV
VLIERMQSELDIDIVLTAYGLTEAAGFGTMCRADDDAVTVATTSGRPIAD
FELRIGESGEVLLRGPNVMLGYLDDPEATAAAIDGDGWLHTGDVGELDPA
GNLKITDRLKDMYICGGFNVYPAEIEQVLARLDGVAEAAVIGVPDDRLGE
VGKAFVVTLPGAELDEKTVIDHAREHLANFKTPRSVEFLDALPRNPGGKV
VKPLLRQRSERA
315446184YP_004079063.1 hypothetical protein Mspyr1_46850 [Mycobacterium gilvum Spyr1]MTDLSQAPAEIDGHGLLKGKVVLVTAAAGTGIGSTTARRALLEGADVVVS
DYHERRLGETRDELAALGLGKVDVVVCDVTSTEAVDALITSTVEKAGRLD
VLVNNAGLGGQTPVIDMTDDEWDRVLNVTLTSVMRATRAALRYFRDAPHG
GVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVDYGVRINAVS
PSIARHKFLEKTSSSELLDRLAEGEAFGRAAEPWEVAATIAFLASDYSSY
LTGEVISVSSQRA
315446182YP_004079061.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum Spyr1]MAVASEAYVIDAVRTAVGKRNGSLAGVHPVDLGAAAWRGLFERNDVDPGA
VDDVIAGCVDAIGPQAGNIARLSWLAAGFPEEVPGVTVDRQCGSSQQAIS
FGAQAIMSGTADLIVAGGMQNMSQIPISSAMTVAEQFGFTSPTNESKSWL
HRYGDQEISQFRGSELIAEKWNLSREEMEQYALMSHHRAQAAIRAGHFEN
EIIPVQTDGAGFATDEGPRDTSLEKMAGLKTLVEGGRLTAAMASQISDGA
SAVLLASEDAVKAHGLKPRARIHHISARGADPVFMLTGPIPATRYALDKT
GLTIDDIDTVEINEAFAPVVQAWLKETKADPEKVNPSGGAIALGHPLGAT
GAKLFATMLNTLERTGGRYGLQTMCEGGGTANVTIIERLS
315446180YP_004079059.1 Zn-dependent alcohol dehydrogenase [Mycobacterium gilvum Spyr1]MKTNAAILWEYGGDWTVEEIDLDPPGDGEVLVSWEATGLCHSDEHIRTGD
LPAPLPLIGGHEGAGIVREVGAGVVGLAPGDHVVASFLPACGRCRFCSTG
HQNLCDLGAMIMAGTQLDGTYRRHINGQDVGVMALVGTFSQYGTVPEASI
VKIDDDIPLSRACLLGCGVTTGWGSAVNTADVSPGDTVVVIGLGGIGSGA
IQGARLAGAEKIVVVEPVEAKRDLAFRFGATHFVTSMEEATALVADLTRG
VMADSAILTVGLLAGSMLEEAANIIRKGGAVVMTALSTMADNQPTLGMMM
FTLFQKRLLGSLYGEANPRADIPRLLSLYREGKLLLDETVTHEYKLAEVN
EGYEDMREGRNIRGVILHDH
315446178YP_004079057.1 acyl CoA:acetate/3-ketoacid CoA transferase subunit beta [MycobacteMISATRAEVCAVACAELFRDAGEIMVSPMTTIVSIGARLARLTFSPDIVL
SDGEARLIADTPAIGAAAAIEGWMPFGRVFETLSWGRRHVVMGANQIDRY
GNQNLSAFGPLQHPTRQMFGVRGAPGNTINHATSYWVGNHSTRVFGDSVD
IVSGIGWDKIDPDNPAYRFVNVYRVVTNLGVFDFNGPDHQMRALSLHPGV
EADQVAENTSFEVHGLDGAETTRLPSAEEQRLLREVVDPKSLRDKEVKS
315446176YP_004079055.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MPITTKTVEPGIVTVTVDYPPVNAIPSRGWFELADTITAAGRDQSTHVVI
LRAEGRGFNAGVDIKEMQNTEGFTALIDANRGCYEAFRAVYECAVPVVAA
VNGFCVGGGIGLVGNADVIVASDDAKFGLPEVERGALGAATHLSRLVPQH
LMRRLFFTAATVGADTLHHFGSVHEVVPRADLDEAALRVARDIASKDTRV
IRAAKEALNFIDIQPVNARYRMEQGFTFELNLAGVSDEHRDAFAGTDKGS
K
315446174YP_004079053.1 hypothetical protein Mspyr1_46750 [Mycobacterium gilvum Spyr1]MGLLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPAGGG
SAAQTVVDEIVAAGGEAVTSGANVADWGQAEGLIQTAVDTFGGLDVLVNN
AGIVRDRMFANTSEEEFDAVTAVHLKGHFATMKHAAAYWRARSKAGDTVD
ARIINTSSGAGLQGSVGQANYSAAKAGIAALTLVAAAEMGRYGVSVNAIA
PSARTRMTETVFADMMATQDKEFDAMAPENISPLVVWLGSVESRDVTGRM
FEVEGGKIRVAEGWAHGPEIDKGARWDPAELGPVVGDLLAKARTPVPVYG
A
315446172YP_004079051.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MAIVSIALVSAVDPYPVDAGKKVMLAGFVKYFADRFGPDNVHYIKVGSVR
REGFPVHVHEVPAPGSADVARNVVRRVATGRASLQEAFLDSPQTRTGIAQ
VLGDIQPARVVYDTIRMAQFATDPAAAQSICYLDDLFSERYTRMLDAAAR
YPDVEFSPLGNFAEHVPARLQPLATRRSTQTALLRLERRLVRRSEDRVAR
RFGRSLMVSPEETAQLEARVGVAPGRIRCVPPLVDIVSSAERSYSGRKEF
VFLGLLSLPHNDDGLWFFLSEVWPLILARTPDAHLNVIGREVSPRLTALA
DRYRDSVTVSGYVPDLNDALSDAAALVNPLRFGSGIKLKVFEALARALPV
VSTSVGAEGIASGPGTGILVADTAAQMAEQLCSLTAVDRNAVVSKEAQEH
FRSTYSRRAVFEVYDAAFTL
315446170YP_004079049.1 hypothetical protein Mspyr1_46710 [Mycobacterium gilvum Spyr1]MTKQRRMMAILAVVGALLGLAVGAVVSTGPSRYSAAADVALLPAPNLTSV
EASDFWEVLTSGQVTRTAAIVYGDPRWLAAAADAARVRRSDVSLTAVALP
ETTILTVTVTAGSAEAAEAALNNVLTTATPEVTALAAPFSVKVLWPPENS
AWKKSAPGKMQMMLAGALGGLLIGAGVGWWLARRRRDATTPPGGHSNVPA
AGDDTVGESTRGAPLGS
315446168YP_004079047.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MLVELSPSGGLFQFAFELGSALAAQGRQVELWTGPRPELASSQPGFTVRP
VLPTWHPGDTGVHSRAFRLARRGIRAVQLIFAWMVLSVRLLAARPGAVLW
SQWRFTFEPVFVVALSMVLRSSTLGLIAHEPVPRSDAKDTSTAKGGELLT
RAFRAAWQRLDVVFVLGPRTRDLAVSYWQPRCPVYVIPHGAEPGVRGERA
VRPVDDTEPVVLFFGVWARYKGIEVLLEAFERVRAEMPESRLVLAGDVGA
DVDLAAVLDRAHRIGNVDARPGYVAIEDVAALFDAARLVAVPYIRATQSG
VAHLAFTFGRPVVASNIGDLPEVIQDGVTGLLVDPDDVEGLAAAILTLLR
DVSFAARLGVAGERSVSDAWSVAAARVCDALAAGAGPGQEP
315446166YP_004079045.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MTGGVSALVLIDAFRMGGAETLLAPMIVASRDTDVSMDVVSISPSEWNSE
KTMTILAEAGIPTRSLGIRRLLDPVALPRLVRTIREGQYDVVHAHLEMAM
TLAVPAAALAGRPSVCTFHHVARPLEGRAAWRERLAVEAATRSRRALFVS
EASRRSFAENYRPKGMPANWEVMHNGIDIANFSPGQADPQVRRELAGGGD
SLIAVLPAAFRDFKGIPVAIRAWPAVIEKFPSAVLALTGGGELEGELRQL
VADLGLNESVNFVGVRTDMPEVYRAADVVVLPSTHGENLPTVLIESSATA
CAIAASRIGGIPDIVLDGETGLLFEAGSVEGFADTVCRLLGDAELRRRLG
VAASERARSEFSATAWLARLRTTYLEAMGDRR
315446164YP_004079043.1 hypothetical protein Mspyr1_46650 [Mycobacterium gilvum Spyr1]MSGDHDVYSRVSTAYHPFMRWAPIIEALVAIPVAYGALFFLGPGSTDTFA
AEDQIVETIGALGLLVTSIFLLLLFIAGRRAGQFGVFKQISLIGLVLLFF
FGAGEEISWGQRYLGVATPTSWEERNVQGELNLHNIDTLSGWLDADYLFR
AFWVVIGIVIPVVAAMSPRVRAAIDRCIPVFPLWVAVVLVLNQIAAEVAG
VVDRRRPTWYEGTYYTFDGARFEVTESILSVVFALGAYALYRRSKTDATD
AADESVSEPR
315446162YP_004079041.1 hypothetical protein Mspyr1_46630 [Mycobacterium gilvum Spyr1]MPSHNDATRGHSERPGSSVAATATGFAEQKFARNASPGAVSEGAAPAEPD
PRRAPKRTATTNLKRAGCIGAFAVTLGVGAALAAAPGVALADSTDSDSPQ
SSTAGNTASDAAGDSASSQGSSARKTRDQGADDSDTAGTKNAASTRAAAA
SADDGEAASASTTTQRRTLSPRKPTAAVTVSPAVITPPAPGIPTAPTPNS
ILVATSASFARPTSARSSITSSRDRTANATVSATSTAVANQNVVINAESM
TVARPAYGSVFTDPTASGGTALVLTQNTTASKTVALPSFTNIVIRAKGDQ
YQGAPQMKVSVNGKVVAKVAVAATAWTDYTVPFKGAPGTYTVSIAYTNDR
YARGKGDRNLRLDTVTVVSSVVEPAPAPTPPSSTPAPGYFGGADWLWKPI
SSNPTLAANSSTWVGYLAAADKQRVANLYNYSVALVSASEITSSTPRYDV
TLTKAWGSDPFGSTTVPIPLGTKIPPGTDGHVAVLDPTTGQAYGIWQAKY
NSSTNAWSGSWGGMTSLNGNGIDTSGSATAAAIARYAGVVTAAEFSAAIA
ANTGINHALAFSTDLAGPDFVYPAIKSDGQNWAGVATPIPEGYRIQLNPD
INVDAIAGMTPGERVIAKTLLTHGAYVVDQGGARMAFAFELLDDATPTSP
GAVWKNAGLAWDYYDMKNIPWSQLRVLAPTATPV
315446160YP_004079039.1 hypothetical protein Mspyr1_46590 [Mycobacterium gilvum Spyr1]MLLEELKPGLRIDGLIPAQVITVIFAQWHGTDALELTYKTNDGALGQQVI
FRKDQDNLTVAQTGSRAFDANATDFKMVAEAQRITLAGLFDPMLAVATSD
VRPLPHQIRAVYGELLPRTPLRFLLADDPGAGKTIMAGLYIKELLLRDDV
RQCLIVAPGGLVEQWQDELFFKFGLRFDLLTNQLIDANVNLNVFETNPLL
IARMDQLSRNEELQAQLAETEWDLIIVDFSSRGNSVRHVRQPAQMRLCRT
PGRYCSRHTARVTEQRPGEGGGWPREHLSTSSRQRTTRTIRRASRYSKSR
PPRSTHAVTAG
315446158YP_004079037.1 DNA-methyltransferase Dcm [Mycobacterium gilvum Spyr1]MARSLKLIDLFAGCGGMTAGFKPQGFDPVFSVELNLHAAATYAANFGEDH
IFWGDIDEALKGEVPEADVVIGGPPCQGFSNLGSKDVNDPRNKLWKRYLE
VVERANPRVFVIENVQRFRRSAEFQLLLDEAEQGMLSRYELTHGVLLAAD
YGVAQRRPRTIVIGSRIGRIDLPRPTHSKTPTLGREPWATVRDRIGALPE
RPSTNSLPDARTSFFGQVIPGQFKWLDLHFGRSPRELSLQRYDCIPPGGG
RFDLPDELLSDCWRNKPTGTTDVMGRMRWDAPSLTIRTEFFKPEKGQYLH
PQWDARDPRRRVNRVITHLEAAQLQDFPESYVWCGSKTEIARQIGNAVPV
GLAAALARHIRAALA
315446156YP_004079035.1 Restriction endonuclease [Mycobacterium gilvum Spyr1]MDGPKTDVAWADAAPLTDEPRLAFVGDELRYAQGANQHDVELDGFINYHW
LISPEALALPKIMLEAGINAPAEVVGPDHSRRALIAIRSSPWKAGHETNP
WHDEFDLDHGHVRYFGDHKPSTVGLPGETKGNRLLLDAARLHGGTTREER
LLAPPLFLFRAVTVHRGGRAVMKGYVEFCGAAIIERLEHVVQRDPQTGRS
FPNLSLDLAVVSGGKIDGVDFRWIDDRRNPMLTAAETLRHAPESWNRWVK
QGRIAIPGIRRRVLASAVRSSKDQVPAGGSTEATTLQTLYQFYDGRKHAF
ELLASRVAAEVFRESGARYREGWLSRSSGDGGVDFIGRIDMGSLKASTPV
VVLGQAKCIQPTSSVSPEQVARVVARLRRGWIGVYVTTGSFSRQAQVEII
DDQYPVVLIAGGTLVATVQRMVQANYGGDIEALLASTVDEYESAVTHRRP
EEVISL
315446154YP_004079033.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MKSIAAASRVKVSADGHGVVSHAGMGLLRELADRTGLSAQVTGALADTYR
GPWTYAPGEVFADLAAAVADGADCIDGVGQLCGDREHAFGAKASTTTMWR
LVDERIDAAHLPAVRAARASARAAAWAAGAAPEPGGWLHIDIDATLVIDH
SDNKHGATPTWKKSFGHHPLLAFLDRPEIAGGEALAGLLRSGNAGSNTAS
DHIIVLAQALAALPAPWRPDPSRGGGPDRPQVLVRCDTAGATHRFADACR
EQGVGFSFGYPVDARVQDAVDTLNLAQGWYPAIDTDGGLRDGAWVAEATT
LVNLNSWPPGTRLILRKERPHPGAQLRFTDTDGMRVTAFITDTPTGVVAG
QVAGLELRHRQHARVEDRIRELKNTGLRNLPCHGFWANAAWLEIVLAAAD
LVTWARLIGFTSDPTLARAEIATFRYRVLHVAARITRGARQLRLRIDATW
RWATSIATAWQTIRTAFG
315446152YP_004079031.1 transposase [Mycobacterium gilvum Spyr1]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
315446150YP_004079029.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MKSIAAASRVKVSADGHGVVSHAGMGLLRELADRTGLSAQVTGALADTYR
GPWTYAPGEVFADLAAAVADGADCIDGVGQLCGDREHAFGAKASTTTMWR
LVDERIDAAHLPAVRAARASARAAAWAAGAAPEPGGWLHIDIDATLVIDH
SDNKHGATPTWKKSFGHHPLLAFLDRPEIAGGEALAGLLRSGNAGSNTAS
DHIIVLAQALAALPAPWRPDPSRGGGPDRPQVLVRCDTAGATHRFADACR
EQGVGFSFGYPVDARVQDAVDTLNLAQGWYPAIDTDGGLRDGAWVAEATT
LVNLNSWPPGTRLILRKERPHPGAQLRFTDTDGMRVTAFITDTPTGVVAG
QVAGLELRHRQHARVEDRIRELKNTGLRNLPCHGFWANAAWLEIVLAAAD
LVTWARLIGFTSDPTLARAEIATFRYRVLHVAARITRGARQLRLRIDATW
RWATSIATAWQTIRTAFG
315446148YP_004079027.1 transposase [Mycobacterium gilvum Spyr1]MKELAADGIPVAVTCRVLKLSRQPYYRWLADPITEAELIEAYRANALFDA
HADDPEFGYRYLVEEARDAGEPMAERTAWRICSQNRLWSVFGKKRGKNGK
VGPPVHDDLVERDFTAEGPNQLWLSDITEHRTGEGKLYLCAIKDVFSNRI
VGYSIDSRMKSQLAIRALHSAVARRGDVAGCILHSDRGSQFRSRKFVHAL
NHHEMVGSMGRVGAAGDNAAMESFFSLLQKNVLDRRRWDTREQLRIAIVT
WIERTYHRRRRQSGLGRLTPIEFEAIMTTPASQAA
315446146YP_004079025.1 transposase [Mycobacterium gilvum Spyr1]MTTGKDVDSSLVEAGSTVEMAEALRASGAVDELLAQVDSGEVALTGEGGL
LPGLIKLALERGLAAELTEHLGYEKGDPIGRAMPNARNGHSPKTVQSEAG
PVALEVPRDRDGSFTPTLVPKGARRIGGLDDMIISLYAGGMTLRDIQFHL
ASTIGTEVSHETISKIVDEISDEVLSWQRRPLEPLYPVIYLDAMIVKVKD
GGHTRNKAAHIAVGVDMDGVKHVLGIWVQPTEGASFWASVCSDLANRGIK
DVLIVCCDGLTGFPEAIAATWSQAAVQTCVVHLIRNALRFVSYGDRKAVA
AALKPIYTAPSADAAHAELQAFTTSELGKKNPTVTKAFERAWEQFIPFLA
FPPELRRVIYTTNSIESLNYQMRKVIKNRGQFPNDASVVKLLWLAICNIE
DKRAAERAKERGKKLCRTAPGRLVEGQVVTNWKKALEQLSLVYPDRIERY
L
315446144YP_004079023.1 hypothetical protein Mspyr1_46380 [Mycobacterium gilvum Spyr1]MSNQNLTLIAFLLDRSGSMQSIKSDVVGGFDAFLAEQRAGDGDCRVTLAQ
FDNEYEVVYRTVPVSEVPPLVLNPRNSTALLDSMGKLITDTAAEIAALAE
DDKPGSVIIAIMTDGLENISHEWSRPAIKSLVEQQTNEFGWEFLYMGADQ
DAVEVGKDLGVKAEQAVTYSRGKSREAMAAMSGNVRGYRTARIVDAQAVM
PGFSEEQRLDLTDE
315446142YP_004079021.1 exonuclease III [Mycobacterium gilvum Spyr1]MGTRIATLNIRHGGTKSAEALAGRLLGYDADILVVTEFRANAVGERLIDR
LAQVGYDTSHPDVGVKENTVLIAARGGIDRSWAFTESLDRRHLWCTEIDG
AYVCGVYMPQNTAKLPYWEALIDDVRPSGIDLLIGDFNTGNNDLDKAPRG
AKFIGPEMPGRLIASGYTDMWRSLHPDVREYSWFSRPGDNGFRLDYVFAG
SDLAQRIRFCEFDHAPRTSGETDHSGLVAIVDG
315446140YP_004079019.1 hypothetical protein Mspyr1_46340 [Mycobacterium gilvum Spyr1]MDIMVASGVQLDHAWVGLGAEFGAALRDWSRQVLALVVEEADRRGAGMLL
IAGGLFDRAYVLPATVDYAAQILGTFSGDVVIVPGRSDWIDGTSLYSTHR
WAPNTSICSSSEYQPCATAPAVWVSAWTSPGGAVPRAPDVPEPHVLIRAG
TAGGDGRVLDVPNLVRDPREPGGFAVLIDGAKLEEPARRVELPDQPGSLA
DLDVTDAAHTDALATALEGMLTPGDPLLLRLVGTLAPGVLLPGFSGPDRD
LPSEVVLDVDSLSFATPSVDAADRSARAEFLRAMAYTNTSDLQRHQTTAL
GLAALDASAQGT
315446138YP_004079017.1 hypothetical protein Mspyr1_46320 [Mycobacterium gilvum Spyr1]MPSVQIKDVPDDTHRVLRERAARAHQSLQEYLRSRLIAEASQPTAEEVFE
RAAVRKGGKVSFSAAVDEIRAERDRR
315446136YP_004079015.1 Plasmid pRiA4b ORF-3-like protein [Mycobacterium gilvum Spyr1]MRDRSHLRVVTDLESRPDLRHPRRSDVVVYRVRVDIDDADPPIWRRIDLR
SDLTLDVVHQVLQVAFDWTDSHLHRFSLGGGAFDWDSQLFLCPYDVVEAD
FEDDGVPAADTHLDETLTATGDALHYLYDYGDNWELTLRLEQVLPAEGAC
AAAVVVDGERAAPPEDCGHLVDAASLAKVLPDPARFEQDRINDALRGPFF
VLREAKVDPRLVDLVHRLGYTAHSDSLSHVALALTAEPARLEAADLVGHL
RGFQWFLDRAADGGIPLTGAGYLKPADVVEASKVVPVMADWIGAKNREAH
CYPLLQFREMLQDLGLLRKYKGQLLLTKTGQAAQRDVNALCEHLAGRLNP
KPGDEFHVQASLLMLAYAAASPDAQLPLSTISALLTELGWRHANGTPVTD
SALRHLPFYEVLSNVTDQPATWRRRNVISPGAAALARRALGL
315446134YP_004079013.1 hypothetical protein Mspyr1_46280 [Mycobacterium gilvum Spyr1]MSNTADRVTRIAADLMDSAAAEGARQSRSAKQQLDHWARVGRAVSSQHSV
ARRKVEAALAGDVPLRDLTDEEGVVFNAEISAAIQERLVRADYGAVLAAR
GVTTVALDEDGEIVQYAPDGSSVRLGPGA
315446132YP_004079011.1 AbrB family transcriptional regulator [Mycobacterium gilvum Spyr1]MEAVIDSGGRVVLPKQLRDALGLTPGTKVDISAYGGGLQIVPGGRTARLE
RDDDGRLVAQADTVVTDEMMFAIIDSGRR
315446130YP_004079009.1 SEC-C motif-containing protein-tetratricopeptide repeat protein [MyMAAQLDPTDVLARILVENGPLREDDIAHRLREAGIRNPDDVLPQLLNEID
CPAVPLVDESWVWLPELMAGRILTHRVDAQELAHDILIVTPDLDPLTHLC
EFEEFARLADGTPISVALPAFDEDVLDERGVPPDMVDDGGALILPPGTLS
DLDVAAGELVGLRLTPAGLTLTRVTAETSPSVGAALAATLDPEEPVAFDS
AVWSACVADTALFTEPVEPLSEIADAHNLVRRLDVLAPAEFDYDRWRFDI
DCEVMSRRYDIAEDAALALRTLVSIYEQMSQLLTMPLSDDEEVPDGDAPT
PALAGYRELVAEFGAELADPHLAEVLLAETVGRNPDGAAALGLFAETLEP
QVPRRARVAFRWLRSVALERIGDIEAAERELLTAETMDTDWPLPLYDLAR
IASDRGDVERALALLHRAGAAPDDPLFTVLRSHRPEARPDVGRNEPCWCG
SGRKYKKCHLGKEQLSLPDRVGWLYSKAAQHALISGWRGLVAELNYERNR
HHDAPDEAIDPVVIDAVLFEGEALADFLAVRGPLLPDDERSLAEQWLLSE
RSLFEVEEVHPGRGLVVRDVRTGDVHEVRERTASRQLTARQLICTRLLPI
GDGTAQLFGGVEPVALHDRSALMELLDEGPAPVEIVAFLSRRFAPPMLTN
TEGDPLMICEAVVRVSDSARMEAALDGTYDRVEDAELPQWFEHVTTDGMD
RIRATVVLEGDTLRVETNSEERMDRVLETLERLDPGMQVVDDTRTPMDDP
REMAAKMPATAKGAVDPEDPQVAALLDAMILDYETKWLDESIPALDGHTP
RQAADDPTRRPDLIRLLDSFPTDAGRHAMNADRLRAALGLE
315446128YP_004079007.1 hypothetical protein Mspyr1_46220 [Mycobacterium gilvum Spyr1]MNPDVNAISPAEARRRFRDGLVTPTAGWSAGYAQANLIAVPRDYAFDLML
FAQRNPKPCPVLDVLEPGQYAGPLLAGGDIRTDIPAYRIYVDGELVTEVA
DATEYWTDDLVAFLIGCSFSFEAALLDSGVPVRHIEEDVNVPMYRTDRPC
RSAGRIGGPLVVSMRPLPPEQVADAVRITSRYPSVHGTPVHVGDPAGLGI
AHLSAPDYGDAVTIRPGEIPVFWACGVTPQAAVMQSRPPLAIGHAPGHML
ITDLRDSELVVP
315446126YP_004079005.1 X-Pro dipeptidyl-peptidase (S15 family) [Mycobacterium gilvum Spyr1MRAGTYVGRVGGLAVALGIGAAVLVGAGAAAADDDTGSSQSRSSQSAKPA
TQESDPRSAANAAGDSSDEATEADSATASSDDDTETEETAAADTVVEDTV
VEDTAVDDSDADLADEESEAEEVATERHPAKVATAQLTRDIAVVVDDTQA
PETPAAPAITSLMTSVAAAGREATQEPAADRATTAEAPQYDLPTDVVVTE
WTPPLEWLQTVPLFGRFVMTPLVGLLHNIPLIGDVLHPVFGFPIDHNAPP
GTPRARSFRVTSFDGTRIFVNFMPAKGLQAGESAPTILNGPGVSLPGSTT
LELDVDSLLPDDVIGIGALRKAGYNVVTWDPRGEWRSEGRMQLQSPDFEG
RDVSHIISYLATLDEVQTVNGDPKIGMVGASYGGGIQLSTATIDHRIDAI
VPTIAWNSLAHSLFPNGAVRNGWGTILSTALILTLARPNERVLPATITGV
LTGKVAQSDLDLFESLNFADRLANITAPTLLVQGTVDTLLPLSQADLNAK
ALIEAGTTTKVVWYCGGHGACLSSVNNGDLVVDRTLDWLDRHVKGEGIDT
GAQFEWVDQNGDWYSSDTYPASQDLTPITAQRTEDQSMLFFPFVGGAGPN
PLIITRGLVATLLGLPSGAPAVNAVNLTVTVPPDDAGTTHVVGAPEVTLT
YSGTGTAKHVWAQIVDDETGLVLGNHTTPIPVQLDGNSHTVTVPLEQVAH
TLMPGQSVTVQIVTSSFAFLNFYSGGAITIDELSVRLPTLAAGQAAQTVA
A
315446124YP_004079003.1 nucleic acid-binding protein [Mycobacterium gilvum Spyr1]MALRPWLIDKSAYTRLAVSPDVELWMERIDRGLVRISTVTRLEIGYSFRT
AAQARSEVASPPLTLMPIEYMTPTVEDRAREIQLTLADRGMHRAPSIPDL
LVAATAEQAGLTVLHLHKDFDLIAGITGQPVEALRMG
315446122YP_004079001.1 ERCC4 domain-containing protein [Mycobacterium gilvum Spyr1]MVELLIVRNPDDGSRLQYLMRLPQPGGDLLFRTSDTWPRVKALYCHPVGL
DEWPDDPEIVERIPLRSCQRRGASIDVIAQRGRENRSQVVFTTARGRDAV
FWQSPRTRKQARPNVRTPTARAQGLEQLHILVDTHERYAYRFATQQSITV
PKPLPCGDYGLEVDGALVASVERKSLADLVTSLTTGRLRYQVADLAALPR
AAIVVEDRYSQLFKLDRVRPAVVADGLAELQVRWHSVPIVFCETRPLAEE
WTYRFLAAAHAWAVTEAAALQRISPVRIDVAVQAPTNGPSTADVRAWARS
AGLPVPDRGRLRPEVWQAWRDAHPE
315446120YP_004078999.1 vancomycin resistance protein [Mycobacterium gilvum Spyr1]MRADRAQPQVITATAPAEPARPRRRRLLWTLIAAPFALLAVAYIGDLLYS
KDRVVRGVTAAGVPIGGLTLTDAEDRLRAEVSPRATRPIPVTAGPARDEI
DPASAGLTVDWRATVEQSGAQPVNPITRLTSLFETREIGVVSTADDDALT
AALDRLDETIAKDPVEGTVRFDGREPVAVDPENGLRLDVDTSADLLKRDW
ATGRTIDLPIVEPEPATTASDVREAIDDVAAPAVSAPLVITGDDDTRATV
DEDVIAAAMTFDVEDGDILATVDENVIVDAARPQLADSETPRRDATLDFA
VSPPAKVPSEDGRRIDYGETLNDVMDVLTSTDDREIAAVYVDAAATFTTE
DIAKLGPVEVIGEFQTSGFSGASGRNIKRAAEAIDGIVVAPGETFSLNGA
TNPRTAANGYVESGIILNGRPDTGVGGGVSQVATTLFNAAYFAGMDLVEH
QEHSYYISRYPAGREATVFGDEIDVKFRNDGPTPVQIQTTWTSSAITVQL
VGIKRYEVSSAQSPRSKPTSPRTITIPAGESCSASGGAPGFTITDTRTLR
DIVTGDIRTESHTVRYDPIPKVVCGG
315446118YP_004078997.1 hypothetical protein Mspyr1_46120 [Mycobacterium gilvum Spyr1]MFARRAASAGIAAVAAVGLAAPAAAAPEDAVFLDRLQKAGIEVFNPSATV
FYAYGVCRQLDLGMPQTRIVDFVMSDNSNLDWEAAADYVVLANMTYCPPV
315446116YP_004078995.1 hypothetical protein Mspyr1_46100 [Mycobacterium gilvum Spyr1]MSDGFDGTPMVVCPHGHLNAWHYKFCGQCGSPIGAVAFPDDDPVEVERRP
RRRGLLIGGAVAAVVVLAAAVAVTVLMAGSSSDDVAVPQPGGFGAGTVDP
AGMVPACTTPPLVQAESVDMTGDGMTVDAAFMSRCAGGDTEAAPSARITV
ADGERDIAAGIFDFSAAPLSMKPGETARRTLVFPAGMYWRTTEMFSGAPQ
LVFHPGEQADATTATVSSGSDRLVAHAVAEPEHGSIDGVAEAVLRELRDA
DYGYVSASIANRWVPQISAKKAGLVVDGATITSADVLRDHYDLRAKYSGV
RLVSSAQWTTFDSDDFWVTVVGTPKLSPAEANGWCDANGLGVDDCFAKFV
STLFGVEGTTAYRK
315446114YP_004078993.1 site-specific recombinase XerD [Mycobacterium gilvum Spyr1]MLPEHDYAPTPETPAQIYAAYLVHLQRRDRGNTAYAQAARSFLRRWPRVQ
SWADIPLDEQLAANCSTRPFVTFLMVSRRLQPGYDYLVHRKLSSLWHELT
DSCLQPDLDQFISAALELGFTERVASAIGSQIIARLLIQTGRPLTGLRES
DLQELLHACHVRQERTGRGAKHYRSTTHSARQILFHLGILDTQARPAVTA
LTLEQRMVDVPVALRPAFVAYLNRKYATCVPKTVSSLATRLAHFGRYLAA
ADPSLTSLNQLDRRRHIEPFITSLTTATNSVTGEPITVADRIRRIHAVGN
FLAEITEWGWDDAPPRRLIFRTDLPRPPRCLPRYLPVDSDRKLTAALAKS
PYRLAADALLVQRACGLRIGELLDLELDCIHEIPGQGSWLKVPLGKLNSE
RMIPVNDEVLTLVDRITTTRSSGRPMIHPRTGAPADFLFTHHGKRLSQNA
VREELNRAAQAASLGHITPHQLRHTYATALINAGVSLQALMALLGHVSTQ
MSLRYAHLFDHTVRTEYERALDLAKSHIGALPKTAVGLPITDITGTGWKD
TPAIKSRLAGGYCLRAPAQGSCPYANICEHCPSFHTDSTHLAVLAAQRID
AQDLAADAEKRGWIDEAERHHNLVSRLDALITGSASA
315446112YP_004078991.1 transposase [Mycobacterium gilvum Spyr1]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICLLTG
315446110YP_004078989.1 hypothetical protein Mspyr1_46030 [Mycobacterium gilvum Spyr1]MGFCVFCGGALTDAMRCHSCGAVNIAGTWHESAYSGGTGGGWQPDPTGRH
EGRYFVGGQPTDLIRDGGVEALDPVGRHELEPAGVDRLPVSAGRRGRRGW
IVAAAVLAVLAIAGAGVGAYAYVNRDRTTVDDRYLVALKQSGFAGEFNSD
ANAVAHGKQVCRALEGGGPQQGMPADEVAVQYFCPQFVEGFHVLETATIT
GSFTLNDEDPNRYSPAIEVDGSSCVGAGGYSDVNPGTPVTVKNGKGEILT
TTYLEDGRGGRFRCTFGFTFEVIEGQDRYVVAVGRRGELSYSFDELRAGG
VSLVLG
315446108YP_004078987.1 ADP-ribosylglycohydrolase [Mycobacterium gilvum Spyr1]MTSHDDRIAGVLLGTAAGDALGAPYEFQPPRGPDLDVRMAGGGVWEPGEW
TDDTAMAIAIAEVAATGADLCDERAQDAILTRWREWSHHTKDIGVQTSSV
LRAASRGSAITAARARDASRAHHARSGRSGGNGSLMRTAPVALAYLDDED
AMVEAARAISALTHYDPEAGDACVLWCSAIRHGVLTGDLDVRVGLRHLGD
EGRVTWSERLDLAETSRPRDFPKNGWVVSALQAAWSAIATTAGSEADPDA
AGTGHLPRGLDAAVRAGFDTDTVAAIAGGLLGAVHGASAVPQAWRELLHG
WPGLDAAELAELAHAAAR
315446106YP_004078985.1 PE-PPE domain-containing protein [Mycobacterium gilvum Spyr1]MSSARHVGRIGALALALGIGIGLGSAAGTANADDSAVSNSRRAAASADAA
GGPSRGPATNSPDRDEPATAPAARTRAQAKPSSSRVSEARARKSDRLDDI
SDGDISNGDISDDAAEDRTPDADADADVPVTSAANSPEPPARSTSLWTVL
TAAWRQPGRSGTDATAGSQVTDPRKPTVDDPDIPATAPLEEPDSSPLPVH
SPTAPDVPSETRTVVTIGGLGSTPEEAGDYLQGYPKSPGNTWIPLVYPAA
ARQSSITQGAANLDRLLRSTTGFVDVIGMSQGAQVVGEWLSSFAQDADAP
EPDRMRFTLLGNPSRRLGSNPDLMGWNFRRVALTPEDTAYTVRDIAKRWD
GWANWENWPNITRESGTELIRLFLGMFTDHRGYDNVDVAALMVRAVVGNT
TYYVAP
315446104YP_004078983.1 ribonuclease HI [Mycobacterium gilvum Spyr1]MAPKPVAGTRPLDIVTARSRPMLSVALAVRPRGRSVFAYSANSAQQCWSG
TVDAESADTATLDVIRRIRAAADAERIRFVVQLPARSTLWALRDEVALLM
PGVWIERPRFSDEALVRGALSGLREVMAAAPVCVATDGSVRGKITGYGWL
ASSGEYGLQGFRHSTKLIGPQVVLVAELRAIGAAVQRLRGRDITVLSDSR
PAIGMVKRWMDGEDVLPEGYLAYRESGKTPGLVRARQMIFEDRARITPLW
VKGHRGEPLNEGADALARLASRYALGDSALDAAEYHRRASDLAVTFSREF
TRARSA
315446102YP_004078981.1 redox protein- regulator of disulfide bond formation [MycobacteriumMLGRPPGRATASRLRHPVTNPEQLFAVGYAACFHSALRVVARQQKADVSD
SAVGAKVELGSLEDGGFGLAVELEVTLPNVDHETAQKLTEAAHQVCPYSN
ATRGNIEVTLTVTDD
315446100YP_004078979.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPDSEPHPHGLRERKKVQTRLAIRRAAFELFDTQGYANTTVDQIADAADV
SPRTLYRYFGVKEALLISDDQISPIVEAFADAPPDLPIVDAYRHAVATVF
RELTPEEREDAAAGQRLMYGIPEARGLLYSEYIRLIEMITDALTSRPDAP
ADHLERRVIAGAIVGVLIAAAHDTPMPDTALERSLTILSKRMAR
315446098YP_004078977.1 dihydroxyacid dehydratase [Mycobacterium gilvum Spyr1]MAGARALLRAAGVDGADIGKPIVAVANSFTEFVPGHTHLQPVGRIVSEAI
RAAGGVPREFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMINAHCAD
AMVCISNCDKITPGMVMAALRLNIPTVFVSGGPMEGGTAVLIDGTVRTRL
NLISAIADAVNTDVSDPDLARIEESACPTCGSCSGMFTANSMNCLTEALG
LALPGNGSVLATHTARRALYEKAGATVMDLCRRYYDEDDASVLPRAIANH
DAFDNAMAMDIAMGGSTNTILHLLAAAREAELDYTLEDIEKRSRQIPCLC
KVAPNGHYLMEDVHRAGGIPAILGELWRAGHLHETVHAVHAGSLAEWLRR
WDIRGGEASAEAIELFHAAPGCVRSASAFSQSERWDSLDTDAAEGCVRDV
RHAYSEDGGLAILRGNLSPDGCIVKTAGVDESILKFSGPAVVVESQEDAV
DAILNGRVQPGDVVVVRYEGPKGGPGMQEMLYPTSFLKGRGLGAVCALVT
DGRFSGGSSGLSIGHVSPEAAAGGTIALVEDGDQITIDIPHRTIELDVAD
DELDRRRAALEGGGYRPRHRERPVSAALRAYAALALSADKGAVRDIGAI
315446096YP_004078975.1 hypothetical protein Mspyr1_45890 [Mycobacterium gilvum Spyr1]MLEISGLTWGVTIGVIVGLLAIDLILAALRPHRVGFREATAWSVFYIAVA
IGFGVWFAMAHGGDFGTEYFAGYIVEKSLSVDNLFVFVIIMTTFAVPEEH
QHKVLTFGIILALIMRAIFIAVGATLLSLFSFMFLLFGLLLIYTAIQLFR
HRDEDPDVENNIMIRATRKVLPISDDYDGGKLLTRREGRRMATPLLAVLI
AIGSVDLLFALDSIPAVFGVTSEPYIVFTANAFALLGLRALFFLVKGLLD
RLVYLSTGLSIILAFIGVKLILHWGHVDINPQIPEINTYLSLVVIIGILA
IVTVASLIKTRKDPTAKAHPGSLRASRKRPEEQRDATG
315446094YP_004078973.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MNTSRLVPPVADDPHAMDGLRDEVRQFVAEQRDAGRIGRQVDSWLTGWDE
DFSRALAARGWLGMTVPEEYGGHGRSFLERFVVTEELLAAGAPVGAHWIA
DRQIVPSLLKYGTETQKRRYLPEIAAGRCYFGIGMSEPDSGSDLASVRTK
ASPVDGGWSVTGAKVWTSGAHRADAFICLARTEPVDPAHRHAGLSQFIVD
LRSPGVDIRPIVSMDGRHHFNEVLLDEVFVADDMVFGTIGDGWQQVTSEL
AFERSGPERFLSTFPLLAEVAALMDDGLPRHNDLGRYVARVAGLHQMSTA
VAGALERHEPADTAAAVVKVLGTSTEGDIADFADLLTDACAPDHGGYRAM
LDDAVVQRPGFTLRGGTNEILRGVIARGLGMR
315446092YP_004078971.1 hypothetical protein Mspyr1_45850 [Mycobacterium gilvum Spyr1]MTTWELDPSDGELLLTTGVTGPAAKMGHRLTIAVQWRATVQWDGDRPVSV
EMTVDVGSLEVLGGEGGVTGLSGPEKALARANALKTLQAKRFPQIVFRTS
SIEPADHGYLLHGTLDLHGRSRDRVLEVEVEDLGEQWQMACRASVSHADH
GLKPYSMMMGAMKVADEVAVSFTARHPK
315446090YP_004078969.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMYVDVMTTPQPLRSTGDLARRTQEAGFDGMLFTETGRTAYLNVAAAALAA
PGLQLSTGVAVAFPRSPFVTAASAWELQEACGGNFRLGLGTQVRTHVVRR
YGVEFEHPGPRLRDYVLAVKACFGAFRTGTLDHHGDFYNLDFITPQWSAG
PIDAPDPMVDVAAVNPWMLRMAGEVADGVHVHPLGEPGYIARHVIPKVAE
GAQKSGRSPSEIALIVPVMTVVGDTDEERHRERELVRASMSFYGSTPNYA
FIWDEAGFEGTTARIRDKQKAGDIKGMAAQITDEHIAVFATESTWDGLAD
ALSARYGGTATRIVLYNALADPERFERYGIVAQRLSNAQQA
315446088YP_004078967.1 hypothetical protein Mspyr1_45810 [Mycobacterium gilvum Spyr1]MAVHWTPNWTCATATGLTATLLLAGCSRGPDDEGAAPIRERATAAVDFTL
PDAQRYHRLATYPVHLNKPAADPVDGETVAEISTVTPDGNTVIYTDAAGK
RIGFLDIRDPANPVGLGTLSLAELGHADDQPTSVAAVGEYVLVVVDTTGG
DFANPSGRVDVVRVADRTRVHSVDLGGQPDSIAVAHDGSFAAIAIENQRD
EEFTPPGAEEGDLPQPPTGFVQLLDLAGAPDTWVPRRVDFDVDAARAAGL
DTPEDLEPEYVSVNPRGQVAVTLQENNGIAIIDGRTGAVQKIFSAGTESV
TRIDTAEDGRVEQTGSITDTPREPDAIGWIDDTHVATANEGDWKGGTRGW
SIFDTGTGEVVWDAGNSIEKLAVRTGLHIESRSESKGPEPEGLAITEIGG
RPVALVASERSNFVAVYDVSDATNPQFRQMLPATPGPEGILPVPARDLLV
ISSESDDAEARVRATVTVYGFGERYAGAPPFPSIVSGDVDGVPIAWGALG
ALTVDPADENRLYTAPDVAYGPSRILGVDLTQTPALIDTELPVTEAGEAV
TLDVEGVAARPDGGFVLAVEGEEGPGNQLVFVGADGAIERRVSLPSEVAA
GLGGQGFEGVALDGDAVWVAVQRQVKTDPSGVARLGRYTPDSDTWEWFGY
PLESTDVDGDWIGLSEIQVHAGALLVLERDKLNGPDARVKAIYRVALPTG
AGAAGAAAPPLLPKVLARDLLPDLQATRGYTQEKVEGFAIAGNGSLYVVT
DNDGLDDANGETVFLDLGPAGDALR
315446086YP_004078965.1 hypothetical protein Mspyr1_45790 [Mycobacterium gilvum Spyr1]MTTESEADFAAFSALPEVDQTARPPHQRRPRFDGDVSELPDRACWALQHL
LTRRYISAESDADIYAWVLEYRSQLSTRLSELDLILRVVDGTDVAFVEQA
RYESAKGIKLLRREPLGTYDSILALHLAQMMRAAGGQSVLISREEMHGLF
SGVLNDTDRDAVTFAGRIDAAIARLAGLEILRKSRDDEDSYTISPVITAV
MTASVISELQQQFELLINGATAEAETDLD
315446084YP_004078963.1 2-nitropropane dioxygenase [Mycobacterium gilvum Spyr1]MAGEMDTLSTPWSAELGLDVPIVNAPMGGAAGGTLAAAVSRAGGLGMVGM
GSSASAAQLRAQLAELGELKRPFGIGVIDWVIRKEPELLTAALDARPTVL
SVSFGTEWDWVARARDAGCVSVTQVADVKAALRAVDAGVQVLVARGAEAG
GHGTPAVATLPLLSAILDRVEVPVLAAGGIASGRALAAVLAAGAAGAWIG
TAFATCPESLFPDEARRALLTADATDTLTTRVFDVALGYPWPAHFPERVL
RNAFTAAWDGRTPDDDARARLAEAIATDDFRVAPVNTGQGVDDITAVEPA
AVVIARLCDDARRLLAKPPTR
315446082YP_004078961.1 Zn-dependent oxidoreductase [Mycobacterium gilvum Spyr1]MRAAVLEAVGQAPTVREFDEPTRDVVRVSLAGCNPVDLALASGEMGDPVI
PSVVGKEGIGRTADGTRVYFDSPISPFGSWAELAQLDPDLAFEVPDDVDD
DLAVALGIAGLAAWLPLTRHADVSAGQSVLILGATGIVGNIAIQAAKILG
AGRVVGAGRDAGALQKAQELGADAVVQLGTDDDAAALKSEVKDGYDVVVD
LIYGDPFLAALDATTVGATLITVGQGAGTPAIPFAKLMGRTHVGHMNNLL
PASVMRQAYAELVGLASEKRLTVETTRYSLDDAEKAWDAQADSPHVKIGI
AP
315446080YP_004078959.1 L-threonine aldolase [Mycobacterium gilvum Spyr1]MGQVPASAAFASAAFASDNAAPAHPSVLDALHRANDGSAPSYGADAVTAQ
AADAIRTAFDSPGADVLFAFTGTAANTIALASATRPWHEIFCSDVAHVLV
DEAGGPVRLSGAQLTRLPSVDGLIAPEELERRVRGRGAVHHSQPRIVSIT
QSTESGRVWTADAIAEFVDHAHALGLLVHVDGARIANAVAALGISPVEAI
ADADIVSVGGTKNGLLFGDAILVRRPEHFDGIHWVQKQIGHLASKHRFIA
AQFVALFTDGLWLRNAEHANAMARRLSAGLQGLGYQLASPAESNEVFVRI
DGDALGHLTRAYLVHQPDHNEPVVRFVTSWATTEAEVDDALAALTR
315446078YP_004078957.1 hypothetical protein Mspyr1_45710 [Mycobacterium gilvum Spyr1]MTDPTDAPETSKRRALARLALVVAVLAVLFYLTAIARVIDVEAVRDLIES
TGPLAPLTYVGVSAVLGALLVPGPLLAAGSGFLFGPVVGTVVTLGATVGN
ALISAYVGRRAGRQSARTLLGTQRAEQVDRLIERGGLWAVVGQRFVPGIS
DSLASYAFGAFGVPLWQMAAGAFIGSMPRAFVYTVVGSSIGEFSAPLAFA
AAAVWCVTAVIGAFAAHRGWRRWRARQ
315446076YP_004078955.1 ATPase [Mycobacterium gilvum Spyr1]MDTLQREALASLRLTWAPTSDDLWRPQAATHVTGLNEHAVDDVMDAFGDA
LRDEASSPMGVVIRGSAGSGKTHLLGQVRERVQAGGGYFFVVELLDAASF
WQSVRSGVLESLGRPGTQRETQLKDLLWELSSLAHVSRADRRAIIGDDDL
DAETLYRFIKALSGVAKETVRQCHQVLRALVLLASNDFIAHDIGEGFLQG
SDEFSIAERGPWGLRSAPESAQMCVRDISRLVALAGPAVLAVDQIDTLLA
QSLAGSDGDGVLEQVAHGLMALRQTTRRTVPVVACLPAVWEHIQDRAAAS
VADRFRVTGMLTPLPSADIGRAILERRFAASYRAVGFDPPYPSWPLAPSA
FEEAPSYTPRQLLIRADTHVRECLKRGEVAELTHLRADAQPDWDTVSTTD
DVTVSTALDRRFAEYRRRAVPAAALAHDGEDVTVPELLSAALTAWIAERD
GEATFVCDPPPGTHVMLHARLRETLDSATDDERHWAFRAVAGTNASAVLS
RVRKALTASGFGSGGDRRRLFLLRNSPWPSGKKTTEEIELFHSAGGRTLP
LSDDDIRTMTALRDLFADDDPELAAWLRARRPAHGLTLLREALGGDSESA
EPAVPEPDPDPEEEVVADYDVSADEIPLGLDLQDEKPVTVQLSALRKHVA
IFAGSGSGKTVLIRRLVEECALRGVSSIVLDPNNDLSRLGTAWPQTPAGW
RRGDDARADDYLTNTEVTVWTPRRTNGRPLAFAPLPDFAGVLDDPDEFTE
AVEAACSALEPQALITGKTQKATRSRAVLREALQHYGKTGSPTLGGFIRL
LADLPEDVSDIAGAHAIAGDLSQNLRAAMVNDPMFGGAGTPVDPGVLLTP
SDGYRARVSVISMIGLPSDDQRQSFVNQLQMALFAWIKRNPAGDRPLGGL
LVMDEAQNFAPARGFTACTRSTLALSSQARKYGLGLVFATQAPKGLNLNI
PGNAATQFYGLLNAPAQIETAREMARAKGGLVDDISRLRAGNFYVATEGE
SFHRIAAPWCLSHHPASPPSAEEVLNLATSV
315446074YP_004078953.1 acetamidase/formamidase [Mycobacterium gilvum Spyr1]MEHVTFIPTPDQYRYTFGGAEPVMRIKPQTVLTLWAEDAYGGRITSADDV
ASAVLDTPDLNPQTGPFHVEGAEPGDTLAIHLVDLTPARTWGASTLIPFF
GGLTSVPVSPTLQDPLPERTWIYEYDSAAETLAFNAHGSDFSVALPANPM
LGTVGVAPDRREVRTALVPDIFGGNMDTPEMAAGATCYLRVNVPGALFSL
GDGHYRQGEGESCGTAVEGAMHVTAIVDLIKGGNSAWPRLETDTHLMCVG
SGRPMEEAWRASQVEMITWLGELYGLDRYDAYQLLTQISLCPIANVVDTN
YSTVTKIDKRLLPTAPAYGGLHSELRSAAAALGSVNY
315446072YP_004078951.1 hypothetical protein Mspyr1_45650 [Mycobacterium gilvum Spyr1]MAKQKVPKPGDIMAAAQEAAEAAQAAATSALRIPPASLKLVAEVPDLIEN
LAVATERLNVAVDRMERYLALASPMLRTMDALLPQLEALVATGNDVYRAV
SSVPGVSTLGRFTGRGRTEEPGEK
315446070YP_004078949.1 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protMATGGDHGETVRPSDADWMPPLSRLLAWTLAVGVVCFVVRGLVHADSWSY
AMAWPAIAPQLVALLTSPRRQWPVYLASFAAVQIIPARLVLDFAPELGLL
ATMTTVVAAALLLHRDQDWVRGRSDSLRSWLRFLVLASAAPLAGAPLGVA
SLVLNGEVGTTGSELLNAAMAWYLSEAVGIAFLVPLMLRWDHYLRRGHSR
REVLWFAAMTALTAGLCAAAITESSFVLMFLSGLPSMAVLIRSGIAGAFA
AMIVGPATVLGATFAGYGPFAASLPTPGQAMISAQVFVLGAFTMVVMVAA
ALEDRTRLAALDNASYKAYELVAELTGDVVILVDAEGNVLRRASPGHEIL
SLPDGPLTKEAWLDQVHPDDRAGRADFPKISGPGPSDPFRIRKSDGTWGW
YVVHSRRTEDGLTVAVLRDVTLEREVQESLTDMANTDPLTGLANRRGLAQ
HAADLWSRARAAGEQVTALFIDLDHFKSFNDLYGHQAGDECLRRVADVLA
HLADDSVCVAARYGGEEFAVVLVGCDAPQEFADGLAAAIRALRIPHLGTD
SGMVTISVGVATLRPWHTTDSDAEAVVAELLDRADKALYVAKSRGRNAIS
IYGDDTALRDGAALRDGVVLLGEQVHHTAKHPREAAGGRHDD
315446068YP_004078947.1 hypothetical protein Mspyr1_45610 [Mycobacterium gilvum Spyr1]MFAYTLLIAAVAVERLAELVVSQRNLKWSKARGGVEFGAGHYPVMVVLHT
ALLVGCLVEASHREFIPALGWTMFAVAIAAQALRWWCITTLGPQWNTRVV
VVPNAGRVTGGPYRFMSHPNYVAVVVEGIALPLVHTAWITALVFTVLNAA
LLWTRISVENKALRTLTAAR
315446066YP_004078945.1 RND superfamily drug exporter [Mycobacterium gilvum Spyr1]MLTVALGVFGIPVAQSLSPSGFSDPGSQSAHAAALLTDTFGQGDVQMLIV
VSSPDGIDDPRVRDVGTDIVDLLTADPHVAEVSSPWTSPPGAAADLVSRD
RTAGLVVAGITGDEAEQQTYAKDISDRVTRDRDGITVRTGGTAMVNVQIT
EQSQRDLLMMEGLAIPLSFLVLVWVFGGLVAAALPVAIGGMAIVGALAVL
RLVTFTTDVSIFALNLATAMGLALAIDYTLLILSRYRDELAAGASRPDAI
ARTMATAGRTVIFSATTVALSMAVMVLFPMHFLKSFAYAGVVTVAFAAAA
AVIVTPAALALLGDRLDSLDVHRLARRVLRRPEPVPVPVEQRFWYRCATT
VMRRALPLGTVVVVLLLVLGAPFLGVKWGFPDERVLPRSASAHQVGDQLR
TEFADNTDTGVAVVVPDSAGLSPADLSAYAAALSQVPDVPAVSAPTGTFV
DGAQAGPPSAPAGERDGSTFLTVTSTAPLFSDASETQLDRLHEVPGPGGR
DVQMTGTAQINRDSVDAITSRLPLVLGLIAIIMFALLFLLTGSVVVPLKA
LVLNMLSLTAAFGALVWIFQDGHLSGLGTTPTGTLVANMPVLLFCIAFGL
SMDYEVFLVSRIREFRLQGHGNDESVALGIAHTGRVITAAALIMSISFAA
LIAANVSFMRMFGLGLTLAVLVDATLVRMVLVPAFMHLMGGVNWWAPRFL
TRIHRRLGFSDDPPTHQRAHPTEQTEQVPS
315446064YP_004078943.1 hypothetical protein Mspyr1_45570 [Mycobacterium gilvum Spyr1]MVGIGDGAMMPQAVDSPRSAHASGQVNWMLALLMLMILVGAIAGVAVALF
SGMPTIALVIALIAGAIFAGVAC
315446062YP_004078941.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MTRIAVIGAGPCGLAALHAFEQARLDGVDVGEVVCFEKQSDWGGLWNYTW
RTGLDEHGDPVHGSMYRYLWSNGPKECLEFSDYTFDEHFGGPIPSFPPRE
VLYDYITGRAKKSNVRQFIAFDTAVRRVSFDDRTQMFSLALESWETGESA
VRTETFDYVLVATGHFSTPNMPEYPGFASFPGRILHSHDFRDAVEFAGKN
LLILGSSYSAEDIALQSRKYGARSVTIAYRNAPMGFGWPDGIDEVPALQH
IAGRTAHFADGTSRDVDAIILCTGYQHHFPFIDPELRLTTTNNLYPAGLY
KGVVWTANPKLIYLGMQDQFYTFTMFDAQAFVARDVVLGRLPLPGADAMA
ADVDAWLARYATVEDVPGQIDFQTDYVRDLMSMTDYPGFDLDMVRQHFVT
WEHDKEDTITGYRDKSFASPCTGTVGPSPHTTWWDELDDGLARFLQR
315446060YP_004078939.1 hypothetical protein Mspyr1_45530 [Mycobacterium gilvum Spyr1]MTSIAAPTFLVTSGFWQKLPQMSLEQYPGTEGFIDDVYANPSGVPMSSGY
FELRNTDAPLDYYYDYDEMKVVLEGEFRLENVDTGQVEIAREKDAIFFPK
GSRILFSTPTRALAFYVGYRSFAP
315446058YP_004078937.1 DNA helicase/exodeoxyribonuclease V subunit alpha [Mycobacterium giMSLDAFAEVFEPADIHVAQRLTELGRDSDPTVALAVALAVRAVRSGSVCV
DLRTVAAQVGVPELPWPDPDGWLSTVGASPLAEHKVVRLDGDLLYLDRYW
REEEQVRDDVVALLSSPPRTAVPGLERLFPAGWEEQRAAAEAALTRSLTV
LTGGPGTGKTTTVARLLAAFAEQAELAGGPPPRMALAAPTGKAAARLQDA
VQAEVDRLSAVDRARLAGLRATTMHRLLGSRPDTSSRFRHHRGNRLPHDV
IVVDETSMVSLTMMARLLEAVRPDTRLLFVGDPDQLASVDAGAVLADLVD
GLGEAGVVELTTSHRFGERIGALALAIRSGDADATVEVLRAGGDAIGWLD
TDDAADALRGPLVDRAADLREAALLGDGETALRILDGHRLLCAHRRGPFG
VAHWNRQIERWLAERTGQSIWSQPYAGRPLLVTANDYGLGVYNGDTGVVV
AAPEGLRAHIGTPASSRELAVGRLGEVETMFAMTIHKSQGSQADEVTVLM
PPQDSRLLTRELFYTAVTRAKERVQVVGTEASVRAAVGRRAVRASGLARR
LSTAR
315446056YP_004078935.1 DNA helicase/exodeoxyribonuclease V subunit gamma [Mycobacterium giMALHLHRADRTDLLADGLGAMLSDPPADPFAEDLVLVSARGTERWLSQRL
SHVLGRGSGQDGICAGVTFRHPRSLIAELTGTREHDPWSPDAMVWPLLAV
IDDCLAEPWCSTLGAHLGHFADGEERELRQGRRYAVARRLAGLFASYATQ
RPRLLEDWLAGRTDGLDADLRWQPELYRALVDRVQADPPHVRHAETVARL
VDSPTDLPERLSLFGHTRLPVTEIELLAAVATHHDLHLWLPHPSDALWTS
LRDVRDVIPRRDDTSHRRVGHPLLATLGRDLRELQRCLPTDTVSDESLGS
VARPDTLLGWLQSDIGADRVRAEGRTHDAGDRSVQVHSCHGPARQVDVLR
EVLLGMLEDDPTLEPRDILVMCPDIEAYAPLIVAGFGLGDVVSGAHPAHR
LRVKLADRALTQTNPLLGVARRLLELAGSRATAGEVLDVAEAAPVRARFG
FSDDDLDAVGTWVRESNIRWGFDRDHRRPYGVDFVQNTWRFGIDRVLAGV
AMSDDSRAWLDTTLPLDDVSSNRVELAGRLAEFVDRLRDAVESLTGTAML
ADWLARIRTGVSELTAVPDSDLWQHSQLERELADIAAAAGVHAGTELRLS
DVRSLLDRHLAGRPTRANFRTGTLTVCTMVPMRSVPHRVVCLVGLDDGVF
PRVGVVDGDDALARDPMTGERDIRSEDRQLLLDAIGAATEKLVITYTGAN
EYSGQRRPPAVPVVELLDTLDVTTSSPVRDRVHTSHPLQPFDIANVTPGA
LNMPVNTPFTFDPTTLTAARATTGDREEHRPLLAEPLPAPPADDVALDDL
IGFFRDPVKGFFRALDFTLPWEVDGLDDAIPVDVDALQEWKIGQRLLDDM
QRGMSPAQAQQAEWRRGSLPPGRLGWRRAQEITARSAALAAAAQQYRTPD
PHAVDIDVAVGPARRLTGTVPRLYGERMVAVTYSKLAGRHLLESWIRLVA
LTAHRPGTDWTAVCIGRGDRGRPTRERLLGPPDSAAEVLADLIAMYDAGR
RAPIPLPLKTSYAWAETDFHRGQPLREAGWKWKTGRYPGEDQDPAHVRVW
GPHFPLEDLVAAGLPDFAARLWLPMLRAERSAH
315446054YP_004078933.1 NAD(P)H-nitrite reductase [Mycobacterium gilvum Spyr1]MAAPGFIAVGSGPAGVSAAETFRRRHPRIPVRILSADPALPYSKPPLSKE
FLGGGHTNLELHSVGWFARNDIDLHLGVTVDHIDVDTQEVVTVGGARYRY
WHLVLAPGSAAVPLSVPGGDSAQPLRSFSDAVALKMAARFADTAAVIGGG
LVGCETAARLAGMGLSTTLVVPEPAPLCRRFGPDVGERVHKMLTDAGVRV
VTSTTVIEVGSDGVTVATGERIAGEVVVAATGVRPDIRLAAEAGLATERG
RVVVDAHMRTSARNVYAAGDVTLAHNVAAGRPVVAEHWRDAAQQGLVAGL
TAAGTPAVWDKVPGFSATIGTFTLKYRGWGGRHDTSDLSERAGGFAVAYR
AGGRVVGTLDVTANPAP
315446052YP_004078931.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MTGTVSYDLADSVATVTLDDGKVNVLGPAMQAAINDALDRAEADKAKAVV
LAGNSRVFSGGFDLGVFQSGDAAAALGMLSGGFELSVRTLTFPVPVIIAA
TGPAIAMGSFLLLSGDHRVGQPKTRCQAIEVAIGMTIPIAALEIMRARLT
PAAFERSAALASTYVGDDAVAAGWLDEIVEADQVLTRAQQVAAEAATTLH
AGAHLATKLKARKYALDAIRAGIDGLATEFTLG
315446050YP_004078929.1 Zn-dependent hydrolase [Mycobacterium gilvum Spyr1]MADTDRLYFRQLLSGRDFAAGDMIAQQMRNFAYLIGDRETGDAVVVDPAY
AAGELVDALEADGMHLSGVLVTHHHPDHVGGSMMGFTLKGLAELLERVSV
PVHVNAHEADWVSKVTGIAPSELTTHQHGDTVSIGDIDIELLHTPGHTPG
SQCFLLDGRLVAGDTLFLEGCGRTDFPGGDVDDMFRSLQALAQLPGDPTV
FPGHWYSAEPSAPLSDVRGSNYVYRAGNLDQWRMLMGG
315446048YP_004078927.1 acyl dehydratase [Mycobacterium gilvum Spyr1]MSFLDGFVGTHFRYPDHYVVGREKIREYAVAVKNFDPAFFDEDAAAELGH
DALLAPLTFISVFGYQAQWAMFAANNIGISDAKIVQVDQSLRFVRPIKAG
DELYCDVWIDSIRKAHGTDIIVTKNIVSNGNGDVVQESYTTLAGRSEEDG
ESGFSDGIA
315446046YP_004078925.1 hypothetical protein Mspyr1_45370 [Mycobacterium gilvum Spyr1]MALKTDIRGMVWEYPDVFVVAREQIRQYANAVKAKDPASHDEAAAAELGH
GGVVAGPTFMSIFAVMIQNHFFQNVDIGLETMQIVQVDQKFLFHRPIKDG
DRLRGVMTILTVDERFGADIVTTRNVLTDDAGDIVMESFTTLMGHEGDNS
ISAGWDPETGQVVRKPVKHDEDVAEDVPEDVTAAE
315446044YP_004078923.1 transcription antitermination protein nusG [Mycobacterium gilvum SpMTSFDGEAPSGDTVDIIDADDTNAEAGSDAVRSDEDAVPAEVADVVEGAD
AGESADETAPAEPEDEDPAVALKKELRLKPGDWYVIHSYAGYENKVKANL
ETRVQNLDVGDYIFQVEVPTEEVTEIKNGQRKQVNRKVLPGYILVRMELN
DESWGAVRNTPGVTGFVGATSRPSPLSLDDVVKFLLPPAAAKKPGKATAA
STAAAEVGATERPVIEVDFEVGESVTVMDGPFATLPASISEVNAEQQKLK
VLVSIFGRETPVELTFNQVAKI
315446042YP_004078921.1 50S ribosomal protein L1P [Mycobacterium gilvum Spyr1]MSKNSKAYKEAAEKIDRDRVYSPLEAAKLAKETSSKKQDATVEVAIRLGV
DPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKAEAAVAAGADVVGSDDL
IEKIQGGFLDFDAAIATPDQMAKVGRIARILGPRGLMPNPKTGTVTPDVT
KAVNDIKGGKINFRVDKQANLHFVIGKASFDEKALAENYGAALDEILRAK
PSSSKGRYLKKVVVSTTTGPGIPVDPTVTRNFTEEPAQS
315446040YP_004078919.1 methyltransferase- cyclopropane fatty acid synthase [Mycobacterium MSDNSTGTKDMTPHFEDIQAHYDLSDDFFGVFQDPTRKYSCAFFTGPNAT
LSEAQIANVDQHLDRLDLKPGMTLLEVGCGWGLTLQRAMEKYDVNVIGLT
LSKNQKAYCDQLLAKVDSERTFDVRLEGWEQFHSPVDRIVSIEAFEHFGK
DRWDDFFKTCFDILPEDGRMTVQSSVGYHPYDLAERGKKLTFELARFVKF
MITEIFPGGRVPTTQMMVEHGEKAGFVVPETLSLRNHYIKTLGIWASRLE
AAKDEAIAATDEENYNRYMKYLTGCQYYFIDEAIDVSLVTYLKPAGAA
315446038YP_004078917.1 protein kinase [Mycobacterium gilvum Spyr1]MSSTQKNQRTPHRAVARLDRVPLPMEAARIGVTGWQITRTGGRVLSSLTT
RGTLQQKVVKQIPQAFADLGPTYVKFGQIIASSPGAFGEPLSREFRGLLD
RVPPADSDAVHKLLREDLGDEPQNLFKSFDEKPFASASIAQVHYATLHSG
EEVVVKIQRPGIRRRVAADLQILKRGARLVEFAKLGQRLSAQDVVADFAD
NLAEELDFRLEAQSMDAWVAHMHASPLGQDIRVPQVYWDLTSERVLTMER
ITGVRIDDVAAIRKKGFDGEALVKALLFSVFEGGLRHGLFHGDLHAGNLY
VDDDGKVVFFDFGIMGRIDPRTRWLLRELVYALLVKKDHAAAGKIVVLMG
AVGTMRPEAEAARDLEKFATPLTLKSLGDLSYAEIGKQLSTLADAYDVKL
PRELVLIGKQFLYVERYMKLLAPKWQMMSDPALTGYFANFMVEVSREHGT
DTGPDA
315446036YP_004078915.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSGAPHATRWAGVPLTDRRAERRALLVDAALRLFGDGGESAVSVRSVSRE
CGLNTRYFYESFGGTDDLLGAVYDRVSAELSVAVADAMDHAEDSLRARTR
AGMAAVLHFSSADPRRGRVLFTDARSNPVLTARRAATQDLLREAVLTEGW
RLHPDTDPIAAATGAAMYTGAMAELAQQWLSGNLGDDLDVVVDHALRLVL
R
315446034YP_004078913.1 hypothetical protein Mspyr1_45240 [Mycobacterium gilvum Spyr1]MSNDLTRRLAEQLDWHWAHQLRPRLAGLTDDEYFWEPVPDCWTVHRDGTV
DFAYPPPTPEPVTTIAWRLAHLIVGVLGARTHSHFGGPPADYGTWNYALD
AESALAQLDEAYAGWITGVRGFDDADLTKPCGPAEGPYAAEPMTALVLHI
NREMIHHGAEIALLRDLFAHTKEN
315446032YP_004078911.1 hypothetical protein Mspyr1_45220 [Mycobacterium gilvum Spyr1]MAAPSRILARSAAMLGIASLGAVGAVAFISVGAGTAGADVKRMAPRPVVT
SRQASQNSVIRINDMGVARGISEARLGDAGVVHAQGDVRDSTKAVLGNKA
RPFRGGFPSGPSIGEW
315446030YP_004078909.1 hypothetical protein Mspyr1_45200 [Mycobacterium gilvum Spyr1]MTGWAATVGADVITVAEVDAREDRLRAGDRAHALPRPGTAEARQLRRWLT
QVLVAERIVAASPGTDPAPSAQDLLLDEVGYRELGSVAAATLATPHGRAV
YAGVTSEVQVGDDAVADYHHRNPYRFARGDARPGTWRGPSSPPQFDDVLP
LIRAHLLAAARRREYRRWLDARCAALVTLAGGYEHPGDPRQPDNTHRH
315446028YP_004078907.1 50S ribosomal protein L10 [Mycobacterium gilvum Spyr1]MAKADKATAVADIAEKFKESTATVVTEYRGLTVSNLAELRRSLGSSTTYT
VAKNTLVKRAAAEAGIEGLDELFVGPTAIAFIEGEPVDAAKALKKFAKDN
KALVVKGGYMDGRALSVSEVERIADLESREVLLSKFAGALKAKQSQAAAL
FAAPASQVARLAAALQEKKSGAENSDAA
315446026YP_004078905.1 organic solvent resistance ABC transporter ATPase [Mycobacterium giMGIGIQVEGLTKSFGSQRIWEDVTFDLPAGEVSVLLGPSGTGKSVFLKSL
IGLLRPERGKIVVDGTNIIECSAKELYEIRTLFGVMFQDGALFGSMSLYD
NTAFPLREHTKKKESEIRKIVMEKLDLVGLGGDEDKFPGEISGGMRKRAG
LARSLVLDPQIILCDEPDSGLDPVRTAYLSQLLIDINAQIDCTILIVTHN
INIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVKQFLNGRRIGPIGM
SEEKDESTMAEEQAMVDAGHHDGGTEEIEGVPPQVMATPGMPERKAVGRR
QARVREIMHTLPPAAQEAIRADLENTQQTQPYPDGYSDGTTAHHARHDDE
TPTGRIPVAGER
315446024YP_004078903.1 DNA-directed RNA polymerase subunit beta [Mycobacterium gilvum SpyrMLEGCILAGSRQIESTTNNSVPGAPNRISFAKLREPLEVPGLLDVQTESF
EWLIGAEDWFQRAVDRGDVDPKGGLQEVLEELSPIEDFSGSMSLSFSDPR
FDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMT
EKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVKVIPGRGAW
LEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMST
LEKDNTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARV
GRYKVNKKLGLNVGQPITSSTLTEEDVVATIEYLVRLHQGDQTMTAPGGS
EVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQDVEA
ITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPG
GLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGF
IETPYRKVVDGVVSDQIDYLTADEEDRHVVAQANSPLDGDGRFEEERVLV
RRKGGEVEFVSASEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANM
QRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVTDKAGVVEEVSADYITVM
ADDGTRHTYRMRKFARSNHGTCANQRPIVDAGQRVETGQVLADGPCTENG
EMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARD
TKLGAEEITRDIPNVSDEVLADLDERGIIRIGAEVRDGDILVGKVTPKGE
TELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDEL
PAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGT
PVDIILNTHGVPRRMNIGQILETHLGWVAKAGWNIRLASDGADGSTEVPA
WAAKLPEHMLSAPADSIVATPVFDGAQEGELQGLLGATLPNRDGETMVNS
DGKAVLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQ
QPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYE
AIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDED
LERAAANLGINLSRNESASVEDLA
315446022YP_004078901.1 K+dependent Na+ exchanger related-protein [Mycobacterium gilvum SpyMNALWFVVGLLTVIAGAEVMVRGGAEVAARLGISPIIIGLTVVSIGTSMP
ELAVGVVSAADGSGALAVGNIAGTNVVNILLILGLSALLVPLALAMRTIR
FELPMMAVAALLFWGLAADGNLSRLDGGILVTAAVGYTAAVIWSARRESR
AIAAEFASEFAPEPVATTTEVRRRTATHVAMTVGGIVVVVIGADWLVDGA
VGMARQFGVTDALIGLTVVAIGTSAPELVTTVMTTLRGDRDIAIGNLIGS
SIYNILLILGITCLVPAGGLALTEGLVRIDIPVMVVVGLACIPIFLSGRR
VSRMEGGMMVAAYLGYLAFVLSTQT
315446020YP_004078899.1 collagen triple helix repeat protein [Mycobacterium gilvum Spyr1]MTAAIQLTSTGSDASEPWYVVNFGGGAAPSTNALANAVDYSRACGLICNG
ADGTAENPNGQAGGILFGNGGNGWNSTIAGVDGGNGGNGGLFGGNGGNGG
NGYWGVVGAAGAVGAPGAAGAAGAAGAASGVVGGWGTAVPNGDLPDLPGL
PPIGGAGAVGAIGTPGTVGSTGSTGTTGAVGTVGADGDNGEAGASGAPGA
AGATGVTGSSGGNGGVGFLGGAGEAGEAGGVGGVGGVGTTGGAGGVGGAG
NQGGNGGAGATGNAGLQGLPGLKGGKGLAGGAGGVGGVGGTGSASLSIGG
AGSTGGVGSKGGNGGNAGLFSLFGKGGNAGNGGTGGTGGAGGAGGTGGTG
GTGGTGGTGAQGGTGGTGGTGGTGGTGGTGGTGGTGGQGGTGGTGGVGGT
GGDGGVGGTGGNGGNGGTGGTGGAGGTGGATGTGTGSGIGGTGGQGGTGG
TGGAGGTGGTGGAAGLGGAGGTGGVGGVGGAGGTGGAGGTGGAPGVGGAG
GDGGDGGAGGAGGAGGAGGAGGPGGSTGGAGGAGGQAGSAGKGGLFGGNG
KAGTNGATGAAGASGAAGATGSQGATGATGAQGAQGATGAVGQDGLDWGD
DGADGATGAAGATGSAGSNGANGAGGAAGEQGEAGEAGEAGSPGSPGTAG
SGTTGGEGGDGGAGGSGGSGGEGGAGGSNGASGDD
315446018YP_004078897.1 glycosyl transferase family protein [Mycobacterium gilvum Spyr1]MSARTPTICLNMIVRNEAHIVHEVLDSVAPYISSWVIVDTGSDDGTQDKI
RNHMAALGIRGELHERPWRDFGHNRSEAISLAQGHADYIWVMDADDLVVG
TPDFSNLTADVYQLLYGPGVSYWRRQLFRDGLPWRYVGVLHEYADCDAPC
VEERLVGDYHIESRRLGGRNLDPEKYARDAEILLAEVERHPDDPRSVFYL
AQSYYDYGDFGNARKWYQRRTELAGFDEELYMAHLRVAEAMARLGEPWPD
VQDAYLRAWEFRPTRAEPLHAIAHHYRSNQRYQLGYFFAERAARIPLPEQ
DVLFVNTAVYEWCAVDEQAVCASWIGKHEEAFALCRQMLARADISDEDRR
RIAANRDCSAGPMIEAALAYPATSVRGWGVRIGGDVTITLIAGRSRETTE
RTLNSFLNCCTDVSRLARTLIVDVGLEPEDVALLADSYPFVEFRKLPPNL
DLRQLRAQVETRYWLHLGMGWQFFAPDDLIGRLAGVVESGAEFVQVGINY
GDADKLGDGQVPEQSARREAPGGHYVLAGTPVSGPALFDCLRLDSALAKD
VDSRVTIAELGRHADETGLTIATLDEVLCTRQL
315446016YP_004078895.1 hypothetical protein Mspyr1_45060 [Mycobacterium gilvum Spyr1]MADPKEDERDSNAESRVSRVPQKVSRQTSPLTPIALVVSLIAVGIAVWAL
VSAPEPSSVSSEGVPLTGDPKDRICTAGHAVAMAVQLQTNANVGADPAAI
EAVAANARLAMLGGGDYLLSQISEDAPKDVADTARSFGNTLQQLGLNALA
GVANDNDLQAGRYREAEESRNKLAQLCVR
315446014YP_004078893.1 phenylacetic acid-responsive transcriptional repressor [MycobacteriMVIRPLTARSVVLSVLLGAHPASASAAELVRLAGDFDIRESTVRVALTRM
VTAGDLVRSKDGYRLSDRLLARQRRQDDALSPRRTDWDGMWRTVVITSVG
NDARARSALRNSLQEKRFAELREGVWMRPDNIEIALDAEVMSRVRILRAC
DEDPEELAQKLWDLPKWGAIGHDLLGEMADAADFPGRFVVAAAMIRHLLT
DPVLPDALLPPHWPGAALRSAYENFAAELVSRRDGIDLMEAR
315446012YP_004078891.1 hypothetical protein Mspyr1_45020 [Mycobacterium gilvum Spyr1]MENERTKYAACPLCESGEISALATVNCTGHAMWREPLEPNITWMQCGTCD
HVFTDGFFTEAALDVLFGNTQDMQIVGNDIEYHRNISAKMVQRVVEALGL
PNDRLWLDIGFGNGSLLMTAKEFGFDVFGIDLRKKNVEDLNACGFSAYHG
TLRSAASEVTFNSRPSVISMADVVEHEPYPLETLRTARELISSPGMLLIS
MPNASAPLWHYWNATDQNPYWHEIEHYHNFTRERLYDVLRDSGFEPRHYA
ISERYRCCMEVLAATA
315446010YP_004078889.1 hypothetical protein Mspyr1_45000 [Mycobacterium gilvum Spyr1]MTATAAGRVLAVSALSAAAALMSTSPVAQAENGDTHITGVGVVRTIDCKD
STLFVNGNGNQVFAIGNCYAVTVQGSSNLVVVDSVANDITVYGWDQKVFY
KNGSPFVWDRGRELGMTNQINRVPA
315446008YP_004078887.1 hypothetical protein Mspyr1_44980 [Mycobacterium gilvum Spyr1]MTAGSAARLAAALSLGALLAGCGAPDRPVTPPSSPAAPGDGFESADCNGV
TDADVARAAGPGMFAPAVVSDVGCFWQEDTMIEDVGAGMGITTWWYRGSD
MDTERDLEQLAGRTLTEWSIDDNEGFKAFDDSACSIYVAKGGDVITWSIQ
TMNSATMPDLCPVVEQLAQLSQQRVN
315446006YP_004078885.1 30S ribosomal protein S12 [Mycobacterium gilvum Spyr1]MPTINQLVRKGRRDKIAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALR
KVARVRLTSAVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
315446004YP_004078883.1 translation elongation factor 2 (EF-2/EF-G) [Mycobacterium gilvum SMAQDVLTDLSKVRNIGIMAHIDAGKTTTTERILYYTGVNYKIGETHDGAS
TTDWMEQEQERGITITSAAVTCFWNQNQINIIDTPGHVDFTVEVERSLRV
LDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKLGADFYFTV
RTIEERLGARPLVIQLPIGAENDFIGIIDLVEMKAKVWRGETALGEKYEV
EEIPADLADKAEEYRTKLIEAVAETDEALLEKYFGGEELSIDEIKGAIRK
LTVASELYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVESVTGHVPNKED
EVISRKPSTDEPFSALAFKIAVHPFFGKLTYVRVYSGTVESGSQVINSTK
GKKERLGKLFQMHANKENPVERASAGHIYAVIGLKDTTTGDTLCDANQQI
VLESMTFPDPVIEVAIEPKTKSDQEKLGTAIQKLAEEDPTFKVHLDQETG
QTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYRETIRRKVEKVEFT
HKKQTGGSGQFAKVLIDLEPFSGEDGATYEFENKVTGGRIPREYIPSVDA
GAQDAMQYGVLAGYPLVNIKVTLLDGAFHEVDSSEMAFKVAGSQVLKKAA
QAAQPVILEPIMAVEVITPEDYMGDVIGDLNSRRGQIQAMEERSGARVVK
AQVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIAKATGQ
315446002YP_004078881.1 Cutinase [Mycobacterium gilvum Spyr1]MIGMSAGVATAQPAQPACPDVHWIGAAGSGERLGAGAADGEMGRVIAKSY
RDFAGLIQQSGRTITAEAVNYPAVAVPEDGGILDWAGFMGSVDTGTAALG
QQYQAFVAQCPTSQVVLAGYSQGAMVVHRNLHSLDASPNLAAALLVADGD
RLPQDPTVNIGSVTAVPGAGKGVAQDWPILAHAPAPLPVTMGARTISVCN
LGDAVCDYDPDAEDEMNPAAVAVHTSYARKAGAMDSWTVPLYQLVTQRQA
PLPAYPVQVTAGS
315446000YP_004078879.1 hypothetical protein Mspyr1_44900 [Mycobacterium gilvum Spyr1]MPMSSGTPLEGRVALITGAARGQGRAHAIRLAADGADIVALDVCKPVSES
VTYPMPTSEDLAETVRLVEETGRKVLAREVDIRDLAAQQQLVADAVEQFG
RLDIVVANAGVLSWGRIWEMSEDQWDTVVDVNLNGTWRTVRAAVPAMIEA
GNGGSIIIVSSSAGLKATPGNAHYAASKHGLVALTNALALEAGEFGIRVN
SIHPYSIDTPMIEKDAMMEIFSKYPTFLHSFAPMPFKPVARDGKPGLQEF
MTVEEVSDVVAWLAGDSSATISGSQIAVDRGTMKY
315445998YP_004078877.1 N-dimethylarginine dimethylaminohydrolase [Mycobacterium gilvum SpyMDIAAARPLRHAPTPRSARPRRYLMTAPQFFAVDYVINPWMDASVVVDTD
RAITQWETLRQTYLDLGHSVDLIDPVPGLPDMVYAANGGTVLNGRAVVAR
FAHPERAREAVAYADWMTRNGYDAFETRHVNEGQGDLLTVGGVVLAGFGF
RTDRRAHDEVAGHIGLPVVSLELVDPRFYHLDTALAVLDDATVAYYPPAF
SQDSRATLAGMFPDAIEVASADAYVLGLNVVSDGLNVVLPAAATGFAEQL
RAAGYRPVGVDLSELLKGGGSVKCCTLEVFS
315445996YP_004078875.1 NAD(P)H-nitrite reductase [Mycobacterium gilvum Spyr1]MVIVGGGLAAARTAEQLRRAEYPGAITIVSDEDHLPYDRPPLSKEVLRAE
TDDVTLKPAEFYDENNITVLLGNGAKSVDTAAQTLTLADGSTLGYDELVI
ATGLVPKRIPSFPDLPGIHVLRNFDESLALRREAASASRAVVVGAGFIGC
EVAASLRKLGVEVTLVEPQPAPLASILGQQIGDLVTRLHRAEGVDVRCGV
GVSEVSGDDRVRKVTLGDGTDVEADVVIVGIGSHPATSWLEGSGLELDNG
VVCDEAGRASAPHVWAIGDVASWRDTVGGQVRVEHWSNVADQARVLVPTM
LGQEPPAAVSVPYFWSDQYDVKIQALGEPEATDTVHIVEDDGRKFLAYYE
RDGAVVAVVGGGFPGKVMKTRAKIAAGAPISDLLG
315445994YP_004078873.1 hypothetical protein Mspyr1_44840 [Mycobacterium gilvum Spyr1]MFDTMHRGLGEADLLAAIEQAAREEAQAGARRLAAIAELVDLTVDEDDER
GMWAFDPWKNAACHIGAALSISERRASAQMCIATALRYRLPQIAALYVQG
RLSTRLISEITWRTGLVADDVIATVDAALAGKAEKWGPLSEDKLIDAINT
VIARHDPDAVRRTKEALKKRDVHIGAHEDTDDVTTIWGLLLPPDAAAYTA
RIAALVKGLCDADPRSAGERRSDAMGAIGRGENQLACRCGSPNCTASGPS
TSPVVITVIADQAAVDTAQQLIADQDAEQQNTTATTAEPTCTKDPGSALL
PGAQILPIPVLAEAIRSGAKITPLWLPGPDPEPHYRPSAKLAAFIRSRDL
FCRFPGCDVPADRCDIDHVVPYPFGPTHASNMHCKCRSHHLMKTFWGGPD
GWRERQLPDGTVLWTTPAGTTYTTTPGSRLFFPAWDTTTAELPPMTTPPP
GAGREIQMPKRQRSRTADRAARIKAEREHNGTQRNLEERPRRGQPPPDYG
NDPPPF
315445992YP_004078871.1 RNA polymerase- sigma-24 subunit- RpoE [Mycobacterium gilvum Spyr1]MSADSEGAASEGAVPEGLDAPSALLALYDEALPAVYGYFVRRCGDRGTAE
DLTSETFLAAMDAARKPSPPDLSVRWLIGVARHKLADHYRRRRDRFATPV
AELPEPADPADEWDAELDRIVAEQVLTRLSDQHRAVLVLRYMDGCSVPEC
AELIGRTVHATEALLVRARRAFRAMYPEPEGGLS
315445990YP_004078869.1 hypothetical protein Mspyr1_44800 [Mycobacterium gilvum Spyr1]MDQNQQVGAEELVTESLVEEVSIDGMCGVY
315445988YP_004078867.1 Fe-S oxidoreductase [Mycobacterium gilvum Spyr1]MTLAAPVPRLVDQFERGLDAPICLTWELTYACNLSCVHCLSSSGKRDPRE
LSTQQCKDIIDELERMQVFYVNIGGGEPTVRSDFWELVDYATEHHVGVKF
STNGVRIDKTVAAKLAASDYVDVQISLDGATAEVNDAVRGPGSFAMAVRA
LENLKEAGFKDAKISVVVTRHNIDQLDDFKALADIYGATLRITRLRPSGR
GADVWDDLHPTADQQVQLYNWLVAHGERVLTGDSFFHLSGLGEPGALAGL
NLCGAGRVVCLIDPVGDVYACPFAIHDKFLAGNILTSNGFEDVWQNSELF
RELREPQSAGACSGCNHYDACRGGCMAAKFFTGLPMDGPDPECVQGYGEP
ALAADRDKPKSSVDHSRSGGRGKPKGPIPLTLLSAPPKKFCNESPV
315445986YP_004078865.1 protein- amidase [Mycobacterium gilvum Spyr1]MVFPRELGNSTSRQLHDAHAIHMPTLVVPVGSTEQHGPHLPLDTDTRIAT
AVADAVVTRLRARDETHWVMAPAIAYGASGEHEGFPGTISIGTPALAELL
VEFVRSACRWTPRVAFVNGHGGNVDALRRAVTQLRHEGRDAAWSPCVAGN
ADAHAGHTETSVLLHLSPDAVRQEERVPGNRAPLAELMPQMLRGGVAAVS
SLGVLGDPTTATADEGRRIFAEMVDACAARVVRWEPDRGGMLT
315445984YP_004078863.1 choline dehydrogenase-like flavoprotein [Mycobacterium gilvum Spyr1MSVLIVGAGSAGSVLAERLSADPGCEVTVVEAGPGLSDSRVRDQISDGLR
LPIGAASSVVRRYDTALTEEPRRHARIMRGVVVGGSGAVNGGYFCRALPA
DVDGWGMDGWSWDDVLPHFRAIETDLDFATPVHGDTGPITVRRVAEFDGA
TASFVDAARTAGFGWVEDLNGATAEHAVPAGIGAVPLNIDRGTRVGPGGA
FLQPALGRANLTVLTDTRVLRLTFAAGRVTGVLCVGPDGPVTVGADRIVL
CAGAIATAQLLMVSGVGPPPVLRAAGVPVEIDLPVGVDTIDHPEWVLPVS
WAPTHGVPPLEAVLTTDDGVEIRPYTVGFEAMMTGRRDDPTDQPHLGVTL
MRPLSRGRVTICSADPDADPVIEHRYDSAPADVALLREGAQLASELAGAT
VQSEPSWATSQHLCGTAKMGAVVDERCRVYGVENLWVVDGSILPDIPSRG
PHATIVMAGHRAAEFVSSSAGA
315445982YP_004078861.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MSTPTMDRDSQEAAKVLADPKAYADDDRLHSALSYLRANDPVVWVDHPPY
RPFWAITKHADIMAIERANDLFLSAPRPLLVTAEADDLGKSQQEAGIGLR
TLIHMDDPHHRKVRAIGADWFRPKAMRDLKVRVDELAKRYVDRMRDIGPE
CDFVTEIAVNFPLYVILSLLGLPEEDFGRMHMLTQEMFGGDDDEYKRGTT
PEEQLAVLTDFFNYFAALTASRREHPTEDLASAIANGLVDGEPMSDMDTL
SYYVIVASAGHDTTKDAISGGLHALIENPGELARLKGDLSLMPTAVEEMI
RWSTPVKEFMRTAAEDTTVRGVPIAKGESVYLAYVSANRDEEVFADPFRF
DVGRDPNKHLAFGYGVHFCLGAALARMEINSLFTELLPRLDSIELAGEAE
LSATTFVGGLKHLPVRYSLR
315445980YP_004078859.1 carboxylesterase type B [Mycobacterium gilvum Spyr1]MVVRGIAVLVALVVAVACGSQASPQPAPDPAVVQTSTGPVRGTVADDHRL
FAGIPYAAPPVGALRWQGPRPAPKWDGVRDATAYGPRCMQDLDGDLELGR
QTDEDCLNLNVWTPPVAGDRPEPKPVMVWIHGGSFVAGSSGVYDSRRLVA
RGDIIVVTVNYRLGALGFLAHPALGPPGAVGNYGLADQQAALRWVRDNIA
NFGGDPARVTVAGESAGAMSVCDHLVAPGSDGLFDAAIVMSGLCQSQADL
PTAEKRSLDYAAQAGCGGPVPAECLRGLDANALRTPVWYYDIGDDRLSGP
VTGSAVLPTAPPVAFGDGKAARVPVLMGTTRDEWTLFVALQHLRDGKDYA
PQEYPRLLADTFGADAPAVEAHYPLTAFSSVALAYAATVTDGVFACAGRR
WAGDLAETAPVYFYEFDDRDAPAPDPLRTVPFPVGASHSLELRYLFDTGG
APPPSPAQVRLGEQMIDYWASFVKTGDPGFPGIDSGVMSLQPDGSRMIED
FDRVHQCVFWDGLG
315445978YP_004078857.1 50S ribosomal protein L3P [Mycobacterium gilvum Spyr1]MARKGILGTKLGMTQVFDENNKVVPVTVVKAGPNVVTRIRTTERDGYSAV
QLAYGEISPRKVNKPVTGQFAAAGVNPRRHLAELRLADNEDAGALYEVGQ
ELTAEIFADGAYVDVTGTSKGKGFAGTMKRHGFKGQGASHGAQAVHRRPG
SIGGCATPGRVFKGTRMSGRMGSDRVTTQNLKVHKVDAENGVLLIKGAIP
GRNGGLVVVRSAIKRGEK
315445976YP_004078855.1 50S ribosomal protein L23 [Mycobacterium gilvum Spyr1]MANVVDPRDIILSPVISEKSYGLIEDNVYTFIVHPDSNKTQIKIAIEKIF
KVKVDSVNTANRPGKRKRTRTGYGQRKATKRAIVTLAAGSKPIDLFGAPA
315445974YP_004078853.1 30S ribosomal protein S19 [Mycobacterium gilvum Spyr1]MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
315445972YP_004078851.1 30S ribosomal protein S3 [Mycobacterium gilvum Spyr1]MGQKINPHGFRLGITTDWKSRWYADKQYADYIKEDVAIRKLLATGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTKKQVQL
NILEVKNPESRAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKV
WIYKGDIVGGKRELAAAAPAGADRPRRERPSGTRPRRSGASGTTATSTDA
GRAATEEAPATDAAATAPAAGQPETTES
315445970YP_004078849.1 50S ribosomal protein L29 [Mycobacterium gilvum Spyr1]MAVGTTTGELRELSDDELTDKLRESKEELFNLRFQMATGQLANNRRLRVV
RQEIARVYTVLRERELGLAAGPGGEDS
315445968YP_004078847.1 arylsulfatase A family protein [Mycobacterium gilvum Spyr1]MTTEFNGKIALDIRDSEPDWGPFAAPTAQPEAPNVLYLVWDDIGIATWDC
FGGLVDMPAMSRIAERGVRLSQFHTTALCSPTRASLLTGRNATTVGMATI
EEFTDGFPNCNGRIPFDTALLSEVLSENGYNTYCIGKWHLTPLEESNLAA
TKRHWPLSRGFERFYGFMGGETDQWYPDLMYDNHPVAPPATPEEGYHLSK
DLADKTIEFIRDSKVIAPDKPWFSYVCPGAGHAPHHVFKEWADRYAGRFD
MGYEAYREIVLENQKRLGLVPPDTELSAVNPYLDVKGPDGQDWPAQDTVR
PWDSLSEDEKRLFARMAEVFAGFLSYTDAQIGRVLDYLEESGQLDNTVIV
VISDNGASGEGGPNGSVNEVKFFNGYIDSAEESLKVFDELGGPQTYNHYP
IGWAMAFNTPYKLFKRYASHEGGIADTAIISWPKGIAAHGEIRDNYVNVA
DITPTVYDLLDITPPATVRGVAQKPLDGVSFKVALENPNAPTGKETQFYT
MLGTRGIWHRGWFANTVHAASPAGWSHFDDDRWELYHVDADRSQVHDLAA
EYPEKLDELKALWFSEAQKYNGLPLGDLDIFETMSRWRPTLSGERSAYVY
YPGTADVGIGAVVELRGRSFAVLAEVEVDPGGANGVVVKHGGAHGGYVMY
LQGGRLHFCYNFLGEYEQTLAAPDPVPPGLHTLGFTYTVTGTAEGSHTPI
GDAELFLDTERVASLAEMRSQPGTFGLAGASLSVGRNNGSPVSEAYHPPF
AFAGGRIARVNIDTSGAPYVDLERDFARAFARD
315445966YP_004078845.1 50S ribosomal protein L14 [Mycobacterium gilvum Spyr1]MIQQESRLKVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVIVRTVKERRRADGSYIRFDENAAVIIKNDNDPRGTRIFG
PVGRELREKKFMKIVSLAPEVL
315445964YP_004078843.1 50S ribosomal protein L5 [Mycobacterium gilvum Spyr1]MTSTETKTLPRLKQRYREEIREQLLKEFGYANVMQIPGVVKVVVNMGVGD
AARDAKLINGAVNDLMLITGQKPEIRKARKSIAQFKLREGMPIGARVTLR
GDRMWEFLDRLISISLPRIRDFRGLSGKQFDGTGNYTFGLTEQSVFHEID
VDSIDRPRGMDITVVTSATNDDEGRALLRALGFPFKEN
315445962YP_004078841.1 30S ribosomal protein S8 [Mycobacterium gilvum Spyr1]MTMTDPIADFLTRLRNANSAYHDEVTLPHSKIKANIAEILKSEGYISDYR
TEDARVGKSLVVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGG
LGVAIISTSSGLRTDRQASREGVGGEVLAYVW
315445960YP_004078839.1 50S ribosomal protein L18 [Mycobacterium gilvum Spyr1]MATKTNTKETGHSPVGKNISETRRTSRLRRHARLRKKVSGTAERPRLVVN
RSSRHIHVQLVDDLAGVTLAAASSIEGDVRATDGDKKAASARVGQLIAER
AKAAGIEEVVFDRGGYTYGGRIAALADAARESGLKF
315445958YP_004078837.1 50S ribosomal protein L30 [Mycobacterium gilvum Spyr1]MAELKITQVRSTIGARWKQRESLRTLGLRKIRQSVVREDNAQTRGLIKTV
HHLVEVEEVKA
315445956YP_004078835.1 hypothetical protein Mspyr1_44450 [Mycobacterium gilvum Spyr1]MIRHRRTIVAMVAAGLTMFGGAATAQAETPDERFANVVTTLGIPHTPDED
LSVVGKRVCDMLTGSLTGNPNPVPAVRGVVSTLSSNANITKQQAVGLMQA
STYIYCPQWARFTGR
315445954YP_004078833.1 methyltransferase [Mycobacterium gilvum Spyr1]MARTPDDSWDLASSVGATATMVAAGRAVASADPDPLINDPYAEPLVRAVG
LDFFTRMLDGELDLSVFPDSSPERAQAMIDGMAVRTRFFDDCCLAAASAG
VRQVVILAAGLDARTYRLPWPDGTVVYELDQPDVIAFKTQTLRNLGAEPA
ATQRPVPVDLREDWPAALRAAGFDATRPTAWLAEGLLIYLPPEAQDALFD
TVTALSAPGSTLATEYVPGIVDFDGAKARALSEPLREHGLDIDMPSLVYT
GARTPVMDHLRGAGWQVSGTARAELFARFGRPLPQDADGTDPLGEIVYVS
ATLAADA
315445952YP_004078831.1 methyltransferase [Mycobacterium gilvum Spyr1]MPRTENDTWDLASSVGATATMVAAARAVATRAEDPVIDDPYAEPLVRAVG
IDFFAKLASGELTPEDLDVSGDESPVGMSRFADGMAARTRFFDDFFTDAC
AAGVRQAVILASGLDARGYRLTWPEGMTLFEIDQPEVIEFKRTTLAGLGA
TPSTHLATVAIDLREDWPTALRDAGFDPSVPTAWIAEGLLGYLPPDAQDR
LLDTIGELSASGSRLAVESVPSQQSADQDEMREKMKDSTDRWRSHGFDLD
FSELVFLGERANVPDYLRERGWAVTATPTNDLLTRYGLAPLDTDEGFAEV
VYVNAAR
315445950YP_004078829.1 adenylate kinase [Mycobacterium gilvum Spyr1]MRIVLLGPPGAGKGTQAQKLAEKLAIPHISTGDLFRYNISNNTELGIEAK
KYLDAGDLVPATLTNALVDDRLDDEDAAQGFILDGFPRSVEQAKALAEML
EKRGLTLDAVVEFRVPEEELVSRLKGRGREDDTEDVIRNRFKVYRDETAP
LLDFYSADLKTVDAVGELDEVFDRALTALGR
315445948YP_004078827.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium gilvum SMEDADAAMMRVLYDEHAAALWRYALRLTGDRARSEDVVQETLLRSWRHPG
VIADLDRPARAWLFTVARNMIIDERRSARFRHETGVPDPEHVAEPASPDE
ADPTLDRILLGTALRQLSDEHRAVVRRAYYQGWTTGQIAADLQIPEGTVK
SRLHYAVRALKLGLQEMGVTR
315445946YP_004078825.1 MarR family transcriptional regulator [Mycobacterium gilvum Spyr1]MIHTAGAPVRYERCVASDRPDPIATARDNWERSGWHDVADGMVAVTSVMR
AHQILLARVETALRPYDLSFSRYELLRLLAFSRTGALPITKASDRLQVHV
TSVTHAIRRLEADGLVERLPHPTDGRTTLVRITDLGRSTVEDATVTLNKD
VFGDIGISGEQSRALADAIETLRRSAGDF
315445944YP_004078823.1 histidine kinase with GAF domain [Mycobacterium gilvum Spyr1]MTRPLLTADRELALLRELIQAASSGPGVEPLAAASARMITASTDSDVCFV
HVLDDTERSLTLAGATPPFDSEVGKIRLPLGQGISGWVASHRQPVVIRRD
KESDPRYLPFQSLRGRDFTSMVSVPMETDPGGLVGVLNVHTVAERDFTDR
DVELLLVIGRLIAGAMHQARLHRQLVARERAHENFVEQVIEAQELERRRL
AGDIHDGISQRLVTLSYRLDAAAQAAKSPADHAALTEQLDRARELADLTL
QEARAAISGLRPPVLDDLGLAGGLASLARSIPQIGIETDLDDTRLADHIE
LALYRIAQECLQNVVKHARASAARLTFAVDDNTARLEIADDGVGFDTFEH
PLGSDEMGGYGLLSMAERAEIVGGRLNIRSRPGSGTTVTATIPLHQGGA
315445942YP_004078821.1 phosphatase/phosphohexomutase [Mycobacterium gilvum Spyr1]MRSVQSTQQKAWRAGRFWWDWSETGEPDGRSLTTLSAVIFDLDALADVER
TGHRLAFNAAFAELGLDISWSETRYRQLQELPDERRRVAAELRKRGVSTE
CDVLAELLVDEICATKEMILGETILDADITARPGMAELIAEAYGAGIAVG
LVSCGSHTWVEPLVRQLVGEGMVGAIVTVDDAPREDLFRAALAELGAPAH
GSLAFAGSQGSRRAAVAAGLPTVLVDGAETAPLRIADCQRIHDSWYETHP
RPTAA
315445940YP_004078819.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MDYFGLDDDDRVIAETAAAFAEKRLAPHALEWDETHHFPVDVLREAAELG
MAAIYCGEDAGGSGLRRIDAVRIFEKLSTADPTVAAFLSIHNMCAWMVDS
FGTEEQRKLWVPKLASMDAIASYCLTEPGAGSDASALRTKAVRSGDEYVL
DGVKQFISGAGTSDVYIVMARTGSDGPKGISAFVVPKETPGLSFGTDEVK
MGWNAQPTRQVILEGARVPADALLGGPDGEGTGFGIAMKGLNGGRINIAA
CSLGGAQAAYDKTVSYLADRQAFGGSLLDEPTIRFTLADMATALETSRAL
LWRAATALDNDHPDRVELCAMAKRYVTDACFEVADQALQLHGGYGYLREY
GLEKIVRDLRVHRILEGTNEIMRVVIGRSAASRARAS
315445938YP_004078817.1 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [MycobMPGAHRSDVVVVGAGPTGLTLACCLRLHGVSVRVLDAAAGPATTSRANFL
HARGSEVLDRMGALGTLPQESLRALRITNYLGDRPLATLEFGDPGMRTAA
PPMVVSQAKVEAALRARLADLDVEPEWGRKVIDVREDADGVVADLADGAR
VRGQWLVGCDGTTSVVRRQTGIEFPGVRLSERFLLADIHLDWAVDRAGTT
GWIHPDGVVGAMPMPSTDGRDDLWRLFVYDPSLDRKPTDSEILDRISELV
PYRTGRRVEIGDAEWLSMFTVHRRLADTYRRGRVLIAGDAAHVHAPFGGQ
GMLTGIGDAENVGFKLALVVRGLAADDLLDTYEAERRPLATQVLRGTSAI
TRVNVAGNPIVRFLRDRVAPRVFGLPAVQRWTTDTASQLWVSYRNGPLGG
RGSKPRPGDRIDDAPCSRPDGTATRLHGELGGRWALLLPRGVPAVGAAAV
RGPAGYLADYLVTLHHGRDDVMLVRPDAHLAWRGAHDDVAGLDRWLATAL
HPGGTQ
315445936YP_004078815.1 dTDP-glucose 4-6-dehydratase [Mycobacterium gilvum Spyr1]MRLLVTGGAGFIGANFVLATVRDRPDVRVTVLDSLTYAGSRESLAGVDTQ
IRLVQGDITDADLVGRLVGESDAVVHFAAETHVDNALADPEPFVRSNIVG
TFTILEAVRHATASRPVRLHHVSTDEVYGDLELGDPAKFTESTPYNPSSP
YSSTKAASDMLVRAWVRSYRLTATLSNCSNNYGPFQHVEKFIPRQITNIL
TGRRPKLYGTGANVRDWIHVEDHNSAVWKILTHGAVGRTYLIGADGECDN
LTVMRTILRLMDRSPDDFDHVTDRAGHDLRYAIDATPLRDELGWRPAHRD
FEAGLRDTIDWYRHNRSWWGPIKDAVEAAYQSRGQ
315445934YP_004078813.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMSDVTPDLGRFGSFGRGVTPEQAQQIEALGYGAVWVGGSPPAELDWVEPL
LAATTTLQVATGIVNIWTADAGPVAESFHRIESAHPGRFLLGIGVGHPEA
HQQYRRPIDALVEYLDKLDEYGVPRGRRVVAALGPKVLKLSADRAAGAHP
YLTTPEHTARARELIGPEAFLAPEHKVVLTTDERSREEHVTDPDRAREVG
RKALEIYLDLANYLNSWKRLGFGDEDVAKPGSDRLVDAVVAYGTAEQIAA
RLREHLDAGADHVPVQVLTGSDKLVPALAELAGPLGLESTEEQR
315445932YP_004078811.1 thioredoxin reductase [Mycobacterium gilvum Spyr1]MTGPEHQPRKPVILTVDDDPAVSRAVARDLRRHYGEKYRIMRAESGPDAL
ETLNELKLRGETVAVFVADYRMPQMSGIEFLEAAMDIFPLARRVLLTAYA
DTHAAIDAINVVDLDHYLLKPWDPPQEKLYPVIDALLDAWRSTGDRAIPH
TKIIGHPWNARSSEVREFLARNRLYYTWFRSDEPKGAALLEAAGQDGMTL
PVIITEQGETLVDPTDAELGSTLGLTTTPSGDFYDLVVIGGGPAGLAAAV
YGASEGLRTVLIERTATGGQAGQSSRIENYLGFPDGLSGAQLAERARRQA
EKFEAELITAAEVTRLEVDGNARTVHLSDGRTIGTRAVILAMGVEYRQLP
ADGCADLTGAGVYYGATASVAADCDDDEVYVIGGANSAGQAAMHLARTAK
TVTIVSRRTLEDSMSHYLIQQIRAQDNIRELPHTVVHAVKGDGHLEGICL
ENTQTGQRDEVTCGRMFIFIGAEPRTEWLDGVVVRDDHGFIPAGPDLRDV
SGWTLDRPPHHLESSVPGVFVAGDVRADSAKRVAAAVGEGSMAVMLVHRY
LSET
315445930YP_004078809.1 hypothetical protein Mspyr1_44190 [Mycobacterium gilvum Spyr1]MTKRMIRAAVAAAALYGARRYFRDWGTTKGESSSVLAGDELLGPPVLQAT
EGVSIDAPVDAVWPWVVQIGQDRGGLYSFETLENAAGLDYHNADLIHPEW
QHLAVGDSVRLVPRKWFGLADGVEMTVARMTAPQSIVLRAAPPGLPWEMV
WSFHLIPRGDDQCRLLIRSRLALRHPGEVVAAELVGPARAFVTRGILLGI
KRRAEKAVKMPPVQGFTPAHTAEDLRP
315445928YP_004078807.1 universal stress protein UspA-like protein [Mycobacterium gilvum SpMTLPTNRPYGVVAAVDGSPSSLAAAQWAAREASLRDVPVTLVHVKPTDEI
GPWLDMPVVPEYTAAIDRRCAEIVAEAVKVVSAALQDRRQVPVKEVTLSG
RVKPMLVEASGEADLLVVGCRGLSGLGRLLLGSTTAAMLHHARCPVAVIH
DEEVEEAASSDPVVVGVDASPASEPAVALAFDEASRRGVGLVAVHTWMNS
ADFYVDVSVIDVAAQAEEELAQRLAGWGEQYPDVEVRRVVAQDNPTHRLI
DESRRAQLLVVGSHGRGGFTGMLLGSVSSAVAQAARLPVIVVRGAG
315445926YP_004078805.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMQAMVYTGPGQRSWQTVPDPVLVDATDAIVRVDTVTICGTDLHILKGDVP
EVESGRILGHEAVGTVTAIGSAVQTLSVGDRVLVSCISSCGACRYCRQGH
YGQCLGGGGWILGHLIDGTQAEYVRVPFADNSTHKVPAGVSDEQMIVLAD
ILPTSYEVGVLAGRVGPGDVVAIVGAGPIGLAAVLTAKLYSPSHIVVIDV
ADTRLEAAKKLGADVTVNSRSRRPRDVIDELTGGLGADVVMEAVGLPETF
EESVDLVRPCGHVANIGVHGAPATLHLERIWIKNLTITTGLVDTHSTPTL
ISLVANGRLDAATMITHRYPMDEFDTAYQVFGDAANSGALKVVLTATS
315445924YP_004078803.1 universal stress family protein [Mycobacterium gilvum Spyr1]MVRSSAVLVGVDGSATGAAAAAWAVKEAASRDLPLRLVHAVTATGDGRVD
AQDLARAGRIVHNAVTAVEALGAPVRIESQIICGATAPALSAASHDAAML
CLGFTDGASGRHRARRSTAAEIASSARCPVAIIHPAGNHSPGARWVVAES
GASPSDDATSTRAVDEALLRGAPLRIVAAWPSRYPDMYDDHAVARKNRLV
KARWERWLAPRRRQHPELDAHVTAAPGSILNYLARHRKGIRLAVLSHERA
DDVAELLAPCVDCEFDILICDAPPGRRHDRTSSSEQSG
315445922YP_004078801.1 heavy metal-translocating P-type ATPase [Mycobacterium gilvum Spyr1MAGSGHTRWRPLLEPALTILTVGALGAGAVAWLSGADRIADMCWAAGTAV
AIVPAVAWVILALRSGRLGVDLIAVLSLGGTLLVGEYLAGALIAVMLAGG
RALDAAASRRASRDLTALLERAPRFARRRTGTEVQTMPIAEVAVDDVLVI
APGDVVPVDGRVVDAVAVLDESALTGESLQVDHPVGEAIRSGVVNAGDVF
ELRVTATSENSTYAGIVRLAQQAGAESAPLVRLADRYAAYFLPLALTMAG
IAWLASGSAVRAVAVLVVATPCPLLLAAPVAIVSGLSRASRSGVVIRSGG
ALENLGRATTLVMDKTGTLTMGQPRVVDVVTGPGTDAAEVLRLAASVDQV
SPHVLADAIVTEAVNRGLRLTLPTEAAEEPGRGVSAVLDGRRVTVGKLGD
DAAQSAWAQGAVNRARLDSAALAWVCVDDRPVGAVLLRDPLRRQAPRTMR
RLREAGFDRLVMLTGDRPEPAREVATVLGLDEVYAQQTPADKVAAVRDER
ERAVTVMVGDGINDAPALAAATVGVAMGARGATASSEAADIVLTTDRLDR
LADAMDIARWSRRIAVQSAVAGMSLSLVAMAAAAMGWLPPAVGALLQEAI
DVAVIVNALRALRHDPRTKVDLTAGTESMLQGFAAEHDELRDALGQIRDS
ADLLAGSAARPGAAAFDSVKQSYALLTERILPHERAEETELYPALAVPLH
SGEATATMSRMHAEIQRLSDRIGTHVHLAESSGGIQPYQVDDLLACLYGL
HALLRLHFVQEEENYFTLVQTDPDR
315445920YP_004078799.1 universal stress protein UspA-like protein [Mycobacterium gilvum SpMTTANSDMPVVAGIDGSAAALGAALWAVDEAAARGTTLRLVYVTKPSDRS
AAEYAGDVRHGRQSLREAQVLVQSTGESVNVETEIVDGPPAQALVALSEN
AQMLCVGSVGIGRYARSILGSTAADVAAAAHCPVAVIRPESRVGVDTPNW
IIVAVNDRPHNDAVVEHALQEAALRHAPVLVLGDGRTAASAEVLEQRIRP
WHERYPQVHVYPIANRADVAHFLKKHDEPVLLAVLGDDEADEVAQIVGHG
RSALRHGASSALVVRS
315445918YP_004078797.1 trehalose 6-phosphatase [Mycobacterium gilvum Spyr1]MPVFIDPRHHDAVIFEVDDPVADEVALSASQGDLARRLTAAGIGVGCAES
AMLRETARRLGVHPGRCVVVAGGEAGVRTARAGGFALIVGIDRAERAEDL
RSCGADVVVPDLVAVTVRDGYRRMSELADALQSYGEIVPLAETRTPVVLL
DFDGTLSDIVGDPDTAALVPGARSVLDALAARCPVAVVSGRALADIRDRI
GVPGIWYAGSHGFELCSPDGGIQENEAGLEIVRVLAGALAEVRERVGAVD
GVLIEDKRFSIAVHYRNVAAESVDEVVTAVRNIAQCNGLRADGGRRVVEL
KPDTGWHKGRAVEWILDRIDGDELLLPVYIGDDLTDEDGFDAVRLRGIGV
AVRSAESGDRRSAARFALDSPAAVCAFLARLSDQLAVEQDLTNDPWTLTF
GGYLPEDERLREALCTLGNGYLATRGAAPECDASRLHYPATYVAGIYNRL
FDEIAGTTVDNESLVNLPNWLPVTFRVDGGAWFDIDAVEFTSYVTTLDLR
RATLTREFVMRDQAGRITRIRQRRLVAMHRPHVAAMATTVRAENWSGRLQ
LRSVLDGGVENLGVERYRALSSRHLTVDAMRELSRDAVLLQTHTGESQIQ
IAVAARHRVTGGEPESVDQRVFRDDCRIGHDIEVVVTAGQAVTLEKVIAV
YTGRDHGMSGPVTAAEREIAGADTFDRLEDGHRLAWAHLWERFNIDMGHD
PNLLRLVRLHQLHLLQTLSPHTADLDVGVPARGLHGEAYRGHVFWDELFV
FPVLNMRLPKVTRSLLLYRYRRLPEARRAAAEAGYAGAMFPWQSGSDGRE
ESQRLHLNPRSGRWNPDASARAHHVGLAIAFNIWQHYQVTGDIGFLIDYG
AEMLVEITKFWVSAANLDPHRDRYVIRGVIGPDEFHSGYPGREYDGVDNN
AYTNLMAVWVIVRTLEALERLPLSYRLALLETVGVGDEDLAHWEDVSRRM
FVPFHDGVITQFEGYDRLRELDWEAYRNRYDDLQRLDRILEAEGDSVNNY
RAGKQADTLMLFYLLSADELYELFDRLGYNFAPEQIPATIDYYQKRTSHG
STLSAVVHSWVLARGDRREAMHYFRRVLASDVVDIQRGTTAEGIHLAAMA
GSIDLLQRCFTGLELRRDRIVVGPMWPEPLGRLAFTFRYRGHRLRLTVLG
RSSTLSAEPSEASPILVECRGQAQTLVAGGTVEFTR
315445916YP_004078795.1 6-phosphofructokinase [Mycobacterium gilvum Spyr1]MSGTAAIVTLTMNTALDVTADADNVVPTEKIRCRAERYDAGGGGVNVARF
AHALGAPVSAVFTAGGSTGARVIDLVHATGVCEIPVLIEGGTRESFTVND
RASGRQYRFVLPGPVLSLGEQARCLEALRRAAGTAGIVVASGSLPPGVPP
DFYQRVADICSDVGAMLVLDTSGGGLRHVTSGVHLLKPSIRELRECLDRP
LHTEPEQIAAARELIDRGAAKVVVVSLGADGALLVTPDDSERLSAVPMTS
VSCVGAGDALVAGVAVGLARRWPLGRAVRFGIAAASAKLQTPGTAAFHRD
DVERYFVTQAAHSEA
315445914YP_004078793.1 universal stress protein UspA-like protein [Mycobacterium gilvum SpMTDEAAPYGIVVGADGSPSSLSAVRWAATEAGLRHLRLTVAHVHEGSGAD
EADSVLDEATAEARNAAGVDGPDVEGRRLTGQPAAELVELSGDAQLVVVG
SRGRTGRSPGSVGLGLLHHARCPVVVVHDDLAPRNRPGRRPVLVGIDGSK
TSLHAAAIAFEEASRRSVDLLALHVCKDADTGGPHDHRMTILEEEAADFL
RETLADLQQRFPEVVVRPLIRFANPTRQLLVQAERSQLVVVGSHGRGAIA
GRLLGSVSAAVAEGCRIPVIVARRT
315445912YP_004078791.1 acyl-CoA synthetase/AMP-acid ligase [Mycobacterium gilvum Spyr1]MTVIHKSPEDWRVTPNLVDYENTCTTFRWDAAPDVCAGMGDGLCNIAYAA
VDRHAGGSAGGRTALRFVSESALTGETSGRDLEYSELASLSSRFTAVLRA
LGVGKGDRVFTLLGRCPELYVTILGALRNGSVVSPLFSAFGPEPVATRLR
LGDAHVLVTTRAMYRKKVADSRSALTSLKHVLLIDEDIDDDIGEEEGATA
TGFWRWMEATPDGAPIEPTTADDPALLLLRDQVDLDSMDWLNFLVGIHKR
LHVDIPEADYRKLRTLADVVGYVGSREAPS
315445910YP_004078789.1 hypothetical protein Mspyr1_43990 [Mycobacterium gilvum Spyr1]MTPSLRDTFGPLTRVGGYYARSWRDYLEGDSPRVPIARPTVGLAVEALRD
EVVLFGLRARRPLSDPASFERIHDEVVAALDFYGGRGCLADPARFFTTPD
ALADVEVTPVRRRNHTYARLRWESGYHPLAGEPGGDRWMTYTANRRGYAL
MLRHPEPRPWLMCIHGTEMGRAALDLALFRAWYLHEELGLNVMLPVLPMH
GPRGRGLPKGAVFPGEDVLDDIHATAHAVWDIRALLGWIRAENPGADIGV
YGLSLGGFIAGLLAGLDDGLTCAVLGVPVADLIDLLSRHSGLGRDDPRRR
TILLAAPLGRMISPLSLPPLVPMSGRFIYAGLADQVVHPREQVVRLWEHW
GRPNIEWYHGGHTGFFQSRPVQHFVTDALVRSGLVTGIGRPQSPDAATG
315445908YP_004078787.1 hypothetical protein Mspyr1_43970 [Mycobacterium gilvum Spyr1]MDGYWLDLALVAVLVLVNGLLSGSEAAFISLGEGQLREMERRGTRRDRIV
VDLAREPNRFLATIQLGITLAGFLASATAAVSLAEPVESRLQFLGGAAAA
VSIAAVTIVVTASTLVFGELAPKRLGMQYARRWAGLVAPLLRFLAIVTKP
VIWGLGQSTDIAVRVVGGDPDVGKKEPTFGELRELIAGHSGLNPEQRTII
SGALEIHERALREIVVPRPRVFRLRADLPVPQALHALAASGHTRAPVVPA
GELDDAIGVVHLRDLLGSAGTVADVARPALLLPDSLRVTAALSRLMDEHE
QFALVIGERGGVSGIVALEDLLEEVVGEIYDEQDKDIRAARLLPDGSRIL
PGSFPVHDLGDVGVDGSRLPRGNHTTVAGLILDSLGRIPEGPGDRIEIGG
YRWEVTAVDAHAITEVRVVPSPH
315445906YP_004078785.1 diacylglycerol O-acyltransferase [Mycobacterium gilvum Spyr1]MADSGAVERMTAFDAGFLDAEDADRHVSLAVGAVSVVDGPMPDFDEIVAA
IGEKITTIPRLRQVVRRQPLDLSAPEWVEDPALDLAHHIRRAALPHPGDD
AALFRFTAEAMEPRLDRERPLWQAWIIEGLADDRWAILMKVHHCIADGIA
AMHMLAGLSDGGEGESYAGAIRAAHEVGAPRPTLPSPTLNPVRWARAGWN
ATTAVAATAAMTVEGAIGILSGLVRNPESSLNGPVTTMRRYSAVQVPLAK
VASVCQAFDVTLNDVALAAITDSFRSALKRRGEEPHRDSLRTLVPVSVRS
DDARDRLDNRVSVMLPHLPVDEPDPVEQLRTVHRRLNRAKSSGQRQAGTA
AVAVVKLIPFALATRAIRVVTSLPQHGVVTLATNVPGPQHRLQVMGREVV
RMFPVPPMALRLRTAVAILSYGDDLIFGITTDFDAFPDVDDLAAGIGAAV
DTLAVAARPL
315445904YP_004078783.1 high affinity sulfate transporter 1 [Mycobacterium gilvum Spyr1]MTSNFGELRSYRRSALRDDTQAGLSVAAYLVPQALAYATLAGLSPAAGLW
AALPPLLVYAILGSSRQLSVGPESTTALMTAAVLAPIVGGDDPVRYAASA
AVLAILVGLVCLGAGMLRLGYLANMLSKPVLVGYMLGVALAMVAGQLGRI
AGVEVTGDTVPAQLAAFAAAVDRVHWPTAGLALGVLVLVLTMERVAPTLP
APLIGVLVATVVTWAAELTRFGVAVVGDVPVGLPAPALPWLTADQIQALI
VPAIGISVVAFSDNILTARAFASQVGQNIDPNIELRALGVSNLAVGFLRG
FPVSSSASRTALAVAAGARTQMYSLVVLAAVAVVVVFGGGLVSHVPAAAL
GGLIVYAALKLVDVRSFRALARFRRSEVVLATLTAIAVTAFGLLYGVVIA
VALSVLDLLRRLSHAHDSVQGLVPGVAGMHDVDDYPDARIVPGLVVYRYD
APLCFANAEDFRRRALEAIDQMDQPTRWFVLNAEANVEVDMTAIEALDQV
RQDCRRRGIVFAMARVKQDLREALAAGGVLDEIGQDRLYMTLPTAVAAYQ
AWVASGNKG
315445902YP_004078781.1 50S ribosomal protein L36 [Mycobacterium gilvum Spyr1]MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG
315445900YP_004078779.1 30S ribosomal protein S11 [Mycobacterium gilvum Spyr1]MAQAKKGAPKKGQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVIA
WASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVKKVDVFVKGPGSGR
ETAIRSLQAAGLEVGAIADVTPQPHNGCRPPKRRRV
315445898YP_004078777.1 DNA-directed RNA polymerase subunit alpha [Mycobacterium gilvum SpyMLISQRPTLSEEVVAENRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAA
VTSIRIDGVLHEFTTVPGVKEDVTDIILNLKGLVVSSEEDEPVTMYLRKQ
GPGEVTAGDIVPPAGVTVHNPDMHIATLNDKGKLEVELVVERGRGYVPAV
QNKASGAEIGRIPVDSIYSPVLKVTYKVEATRVEQRTDFDKLILDVETKN
SISPRDALASAGKTLVELFGLARELNIEAEGIEIGPSPAEADQAAHFALP
IDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIK
LHQLGLSLKDSPASFDPSEVAGYDVATGTWNSDAGYDSGYEADDNQDYAE
TEQL
315445896YP_004078775.1 pseudouridylate synthase I [Mycobacterium gilvum Spyr1]MNEPATDSGGGFVRLRLDIAYDGTDFAGWATQAGQRTVAGVIDDALSTVF
RTPMLTRAAGRTDSGVHATGQVAHVDIPTDALPHAYPRTVRAGEAEFGPL
VRRLGRMLTEDVRVRGIVRAAPGFDARFSALRRHYVYRLTTAPYGVEPSE
ARFVTAWPRPLDVDAMAGAAQNVLGLHDFAAFCRHRDGATTIRELQRLDC
VRDGDRISVHVSADAFCWNMVRSLVGALLAVGEHRRDDTWCVQLLHARHR
SSDFAAAPARGLTLVGVDYPPDDELAARNLVTRDVRTADEL
315445894YP_004078773.1 Cutinase [Mycobacterium gilvum Spyr1]MVPMAALAVMPTTTASAQPCPDVEVVFARGTSEPPGVGRVGQALADQLRN
QLGGRTVGTYGVVYPASYDFFTSGDGAADATNRISVMAAQCPNTRIVLGG
YSQGAAVVDMLAGVPPLGNRIGDVGLARPLPGGLNGNVAAVAVFGNPATK
FGNPVSARGSFAGKALDLCADGDPICSDGRNPFAHTSYERSPLIGQAAGF
AAGRL
315445892YP_004078771.1 drug/metabolite transporter permease [Mycobacterium gilvum Spyr1]MAALDSSVTSRTQARADHFRSGLLFALASAFAFGCSGPFAKALMTAGWSP
TAAVTARLAGGALAMAVFATVVRPGWVREARHHARTVVLYGIVPIAGAQL
FYFNAVAHLSVGVALLLEYTAPLLVVGWLWATTRHRPSGMTLAGVVLAVG
GITLVLGIIGPGGVAAAHINLAGVGWGLAAAVCAACYFLMSDKAGAMSDK
EVADGRPPLHPITLAAAGLAFGAVTVAALGFSGLMPLAFTANDAVIAGFT
TPWIVPVIALALIPTAIAYTLGIVGIARLRPRFASMVGLSEVMFAVLAAW
MLLGEGMAAAQVIGGAIVLAGLALARQGDRGELVGETNVGETSVTPTALP
QTTPVARGGPATIDP
315445890YP_004078769.1 subtilisin-like serine protease [Mycobacterium gilvum Spyr1]MAAVTAIALMHTTPTAAAIGPPPVDTLRLPTADPPAPAQPTVQFTDCVAA
PPAAGSAPGQLAGMDLPTVWALTRGAGQTVAVIDTGTARHRRLPHLVPGG
DYVSHRDGTDDCDGHGTLVAGIIGASPDAADPGGFTGIAPDVSLLSIRQS
SNKFRAVDDPGGSGVGDVETLAAAVRTAADLGATVINISTVACLPVAAGL
DDRTLGAALSYAVEAKNVVVVTAAGNVGGPGQCQDPNPRDVGAAHQVRTV
ASPAWYDDYVLTVGSVGTDGSPSDFSLAGPWVDVAATGEGVVSLAATGDG
LADRSPSDAALTGTSYAVPVVSAVAALVRARFPEMTARQVMQRIEDTARP
SSAEWDPVVGHGVVDALAAVSGPGSHPAALPAAPPVDAPAPAPATAPRQG
ATAVRGALICVALTVCVALVSAVIARSRRHG
315445888YP_004078767.1 DNA segregation ATPase FtsK [Mycobacterium gilvum Spyr1]MVTVPCGTFSACGWNGAGVPCVYSYVDAGRIVLDAPPTPPAPTHTNVLAR
LMPVAMVAAMGGMTALYLTSTDATSRNPMFLFFPAMMAVSLIGTLAYGSR
GAGRSGELAAQRAEYLRYLDTVDGALARAGEDLHRYLHAAHPAPAVLWTL
AGTPRMWERAEGDPEFGMIRIGIGERAGATAVAAPGWVPGDDADPVTTEA
VQRLLAHRETVGDVPVTLSLRSVRTLAICGEPAAARSVARALLCQIATLH
HPDTMSISAAPVTDWDWLKWLPHQRSSQEGRHHVVVADEGVPARDGTTLI
ILTAGSGAPTVTADGVPVAAVCDEMPEAEAAACARRIARHRPRRPSRSLR
RDWPALMGIDDPDALDVDVKWSRDLGSDLLRVPIGVADDGSVVELDIKEA
AAHGMGPHGLCVGATGSGKSEFLRTLVLGMVCAHPPGLLNLVLVDFKGGA
TFLGLEAVHHVSAVITNLADEAPLVSRMRDALSGEITRRQEMLRAAGNLT
NITQYAQARARDDTLAPLPALLVIVDEFSELLTQHPDFSEVFVAIGRLGR
SLGIHLLLATQRLDEGRLRGLETHLSYRVCLKTFSAGESRAVLGVPDAYS
LSSQPGAAYLKTASGVLTRFQTAYVSGGYTPASRPRSQPLTVRPFTSSDH
DVASESTVSQRPLLGAVLTRLAGRGAPAHRVWLPPLTSAPRLADLLHGTP
GRRLQVPIGVVDCPFEQQQMRHVVDLSGPAGNLAVAGAPRSGKSTVLSTV
MTALAATHDAAAVQFYCLDFGGGELTGLQHLPHVGSVASRHEGELCRRIV
AHVESVVRHRESATDETWNGHVFLVVDGWATLRQDFDGLEPAITALAGRG
LAYGVHVMIAASRWADLRPALKDQIGSRIELRLGDPAESEMDRRRARDLA
DRPPGRALTREGREMAIALADQRLPVRRDGPGAAPVELLPAHVDRSAIAA
PVPRRGEVLLGLGERELSAVSLDLTEHSHLMVLGENQCGKTASLRLLCAE
LVAAPQEARLEIVDFRRTLLGAVDSDRLTGYAVTPAAVTSRVAAITGVLA
DRMPGEDVTQRQLRDRSWWHGPEIYVVIDDYDLVAGATGNPLTPLADFLP
HARDLGLHVVVARRSGGAARAMFDPLLARMRDMGCAGLMMSANAEDGVLL
GAVRPGRLPPGRGTLIARGRPDELLQVAWTDPP
315445886YP_004078765.1 hypothetical protein Mspyr1_43740 [Mycobacterium gilvum Spyr1]MSTPSGAHGSALATDFDLMVSVAGRTEARNDEIRSMLSSFIGAMSSVPPS
VWGGVAAVRFREVVERWNAESVKLHSALQRIAETIRDNERLLRDVAEGHS
QRIASAGTGL
315445884YP_004078763.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MAASKPSARRASPPPPTPPSASRLQAVHELFVAGEVDTGYLNSHAVRPVV
AQSWERSRAGGVDPDIGAARSAAAAAAVDRLRETHPLAPALPVIRRLLVE
DAIGSGVVVAVSAADGTLLWVEGDPGACRRAEAMNFVPGADWSERSAGTN
APGTALTLGREMQIHGSEHFSRVVQPWSCTAAPVHDPTTGALLGAIDLTG
GGQVATSQTLALVRATAVAVENHLALLRLAGAGAEPAARKPHLVVLGGDR
PRWVTTDSVGHLQITHLTGRHADILVLLSRHPEGLSADHLAVLLDDKDLD
VVTVRAEMSRLRKVIGAENLGSRPYRLLTSITSDLGEVYEALDAADVETA
LDRYPGPLLTQSVSPAIARLRTQLSATLRAAVLAESAQGRTDLLRRWLEQ
PEGRDDRDGWQALRDSAGLTPVARARARGHLAGLDFELG
315445882YP_004078761.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MLVDAAAQVFSREGLTATTNRIADRAGLSIGTLYQYFPDKLALLRAVAER
HVRDADRELTAVFAALRTEAPPFDATMRAVLGAVVAVHAGGGRLHALLHR
MVPADARDLETVQALEDRIYDEVAFHLKRCDRGGDDVEMTARTLVHAVDA
QLHRVLSRDGFDVGDATDTLMVTVDRLAPPHG
315445880YP_004078759.1 Zn-dependent alcohol dehydrogenase [Mycobacterium gilvum Spyr1]MQAAVVTAFGEPLVVEERDLPAPGPGEALVKLVTSGVCHTDLHAAHGDWP
VKPSPPFIPGHEGYGTVVAVGDGVDDLSVGDMVGNAWLWSSCGRCEYCRT
GWETLCEQQRNGGYSVDGSFGTYMLVDAAYAARIPDGVDPVEVAPILCAG
VTVYKGLKVTDTRPGQWVAISGIGGLGHVAVQYARAMGLRVVAIDVDDSK
LDLATGLGAEVVVNARTADVVAEVHRATGGVHGVLVTAVHRDAFGQAIGL
ARRGGTIVFVGLPPGDFPAPIFDIVLKGLTIRGSIVGTRQDMVEAIDFFA
RGLVHPTVHTTRLDDINDVFDRMERGQIDGRVVIDYR
315445878YP_004078757.1 30S ribosomal protein S9 [Mycobacterium gilvum Spyr1]MTETEFTDTEGTEVAEAVETQVAETETETAADEYAAPREPVIIDRPIQTV
GRRKEAVVRVRLVPGTGQFHLDGRSLESYFPNKVHQQLIKAPLVLVDRLE
QFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKRAGFLTRDPR
AIERKKYGLKKARKAPQYSKR
315445876YP_004078755.1 phosphoglucosamine mutase [Mycobacterium gilvum Spyr1]MARLFGTDGVRGVANRELTPELAMALGSAAARRLGRAGATRRRVAVVGRD
PRASGEMLEAAVIAGIAGEGVDTLRVGILPTPAVAYLTSAYDADFGVMIS
ASHNPMPDNGIKIFGPGGHKLDDATEDRIEELVHQGPGERPTGAGIGRVV
DAEDALERYLRHVGKAATTRLDPLTVVVDCAHGAASVAAPRAYRAAGANV
IPIHADPDGLNINDGCGSTHMESLRSAVVSYGADLGLAHDGDADRCLAVD
AHGRVIDGDAIMVVLALAMQQSGELVSDTLVATVMSNMGLHLAMRSADIE
VRTTGVGDRYVLEELRAGQFSLGGEQSGHIVLPSFGTTGDGIVTGLRLMA
RMAQTGRSLADLAQPMQTLPQVLINVEVADKTTVADAPSVRDAVAQVEAE
LGDTGRILLRPSGTEQVVRVMVEAADEDTARQMAVRVADSVSAES
315445874YP_004078753.1 hypothetical protein Mspyr1_43620 [Mycobacterium gilvum Spyr1]MPDDFDVGARLAQGRPAADTLQRYVAACRQLGYEHRDLTLHPAQVTDWYG
TEDGMDLAALHRCCVALDGVGRAAQEALAVQERQLGELSAAWEGAGGDAA
RMFLARHGDSSAVATAAVRTAAEALVSLREELWRVVGGKVDSTVSAEGRA
AGTQAQWSAAATSVTTGTGDTATAGEIVEHAVKPFVDTVIRDEWLPAMRD
AVAAVTAAYDGATAEIAAERTPTFDVPGDLGPDCPEPRPNCDDEGQSGRA
AVAASPPAAATSAAWSPPAGMPAGTPAATAPSAWSPPAAPAPVPPAPAAP
SPLAPAPLAAPAPEAPLPSPGSLGSGMPGLGGGPSGFGQHFADALSGLLG
GGLGGDALESPDLDLEEPALDEPGVEEPELEEEENEEDAELEEDDEAEEK
PESVVAADPVLPEEPCDPPPEPAATVAAPEPPAPPPPAEPVPAAEPASDE
QTPCEIAAGEVPQVGESAG
315445872YP_004078751.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MPVDRLLPTDDARDLVELARQIADKVLDPIVDRHEKDETYPEGVFATLGE
AGLLSLPYPEEWGGGGQPYEVYLQVLEELAARWAAVAVAVSVHSLSCHPL
MSFGSDEQRQRWLPDMLGGSTIGAYSLSEPQAGSDAAALTCRATAVDGGY
RITGSKAWITHGGIADFYNLFARTGEGSQGISCFLVPRDTEGLTFGKPEE
KMGLHAVPTTAAHYDDANLDSDRRIGTEGQGLQIAFSALDSGRLGIAAVA
VGLAQAALDEAVAYSQERTTFGRKIIDHQGLAFLLADMAAAVDSARATYL
DAARRRDAGLPYSRHASVAKLVATDAAMKVTTDAVQVLGGAGYTRDYRVE
RYMREAKITQIFEGTNQIQRLVISRHLTRG
315445870YP_004078749.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMRTGIFLSYAGGFLEAVDEVVECEKLGVDIALVAEAYSYDAISQLGFLAA
RTSRIELGTGVVPIYTRTPALMAMTAAGVDYVSDGRFRLGLGTSGPQVIE
GFHGLPFDAPLGRTREVVEICRKVWRRERVSYDGKYYQLPLPAERGTGLG
KPLKLINHPVRENIPITIAALGPKNVELTAEIAEGWQPVFFYPEKADEVW
GDALRAGASRRDPALGPLDVMVSATLAIGDDVDDRLSWGKPQLALYIGGM
GARGKNFYHNLATRYGFGEVADHIQDLYLAGKKAEAIDAVPDELVRQVSL
VGPAGFVKERLAAFAEAGVTTLLVHPMGVDAAERVRFVEQLQGLL
315445868YP_004078747.1 glutamine--fructose-6-phosphate transaminase [Mycobacterium gilvum MCGIVGYVGQRPACDIVVDALRRMEYRGYDSSGVALVDGHGGLTVRRKAG
RLANLEAALAEAGAESPAGATGLGHTRWATHGRPTDRNAHPHRDSSGKLA
VVHNGIIENFAALRAELEAVGVEFASDTDTEVAVHLVAREYTHGDTAGDF
PASVFAVLPRLEGHFTLVFAHADDPGTIVAARRSTPLVLGVGDGEMFVGS
DVAAFIEHTREAVELGQDQAVVVTADGYRVTDFHGNDDAASARPFHIDWD
LSAAEKGGYEYFMLKEIAEQPAAVSDTLLGHFVDNRIVLDEQRLSDQELR
DIDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLDSH
TLVVAISQSGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVLYT
RAGPEIGVASTKTFLAQVAANYLVGLALAQARGTKYPDEVAREYHDLEAM
PDLISRVLASSEPVVALAKQFATSQTVLFLGRHVGYPVALEGALKLKELA
YMHAEGFAAGELKHGPIALIEDDLPVIVVMPSPKNSATLHSKLLSNIREI
QARGAVTIVIAEEGDETVRPYADHLIEIPAVSTLFQPLLSTIPMQLFSAG
VAQARGYDVDKPRNLAKSVTVE
315445866YP_004078745.1 hypothetical protein Mspyr1_43540 [Mycobacterium gilvum Spyr1]MALRDELLELEHAGWKSLCDGTGDTFYGDLMTDDAVMVLANGMVMDRQTV
VSALGQSPPWARYDIDDVRVIEIDDATAALVYTGTGWRDGLDEPFVGAMS
SVYHRTADGWALALYQQSQKS
315445864YP_004078743.1 glutamate decarboxylase [Mycobacterium gilvum Spyr1]MPNVSRHSSLAPAYTGRMSMSPVPALRLPDESMEPEQAYRFIHDELMLDG
SSRLNLATFVTTWMDPEAGQLMSETFDKNMIDKDEYPVTAAIEQRCVCMV
ADLFHAENLRDDDPSTAIGVSTVGSSEAVMLAGLAMKWRWRDKFAGKDGD
GWKGRTPNLVMGSNVQVVWEKFCRYFDVEARYLPMEKGRYVITPEQVLDA
VDEDTIGVVAILGTTFTGELEPVAEICAALDALAAGGGCDVPVHVDAASG
GFVVPFLNPLLVWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRNAEHLPE
DLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTQVMHALA
DTAQWLARELEGMTGSDHKPVFEVITDGSAIPVVAFRLTEGAKFTVFDIS
ALLRSYGWQVPAYTMPEDATDIAVLRIVVREGFSANLARALRDDLREVLG
KLDKVGIGGFSDEEHFAH
315445862YP_004078741.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMSRGAGWLAGAAGVAAVGSAAGVSMARSLRRRVTDEDPHRDEDFELLDAD
RSCVVTTSDGVPLAVREVGPEDAPLTVVFAHGFCLRMGSFHFQRVRLTEH
WGAQVRMVFFDQRGHGQSGDAPPETYTVEQLGRDLEAVLAVMAPKGPVVL
VGHSMGGMAVLSHARQYPQRYPTRVVGAALISSAAEGVARSPVGEILKNP
ALEAVRFTARYAPKLVHRGRGAARSVIGPILRAASYGDEKISPSVVAFSE
RMMHDTPIATLVEFLHALEVHDETAGLETLRRVPTLVACGDRDLLTPKEY
SQEMADVLAKSELVIVPGAGHLVQLECPEVINDALVRLVERATPSKLTAL
TRRVTQRVRSDD
315445860YP_004078739.1 molecular chaperone- inactive metal-dependent protease like proteinMSRLVLAVDTATPAVTAGIVRVDGDAIEVLAEQVTVDARAHAEQLTPNIV
AALGDAGTDASRLDAVVVGCGPGPFTGLRVGMATAAAFGHALGVPVHGVC
SLDAIAAGTTGDVLVVTDARRREVYWARYRDGRRVDGPAVNSAVDVPGGA
AAVAGSPEHTALFELPRLAPVYPSAAGLVAAVRDWDADPAPLVPLYLRRP
DAKPSQAVKR
315445858YP_004078737.1 O-sialoglycoprotein endopeptidase [Mycobacterium gilvum Spyr1]MIILAIESSCDETGVGIAELGDDGSVTLLADEVASSVDEHARFGGVVPEI
ASRAHLEALGPTMRRALATAGVDKPDVVAATIGPGLAGALLVGVAAAKAY
AAAWQVPFYAVNHLGGHLAADVFDHGPLPESIGLLVSGGHTHLLHVRSLG
EPIIELGSTVDDAAGEAYDKIARLLGLGYPGGRVLDELAREGDPKAITFP
RGMTGPRDEPYAFSFSGLKTAVARYVESHPEASQADVAAGFQEAVADVLT
AKAVRAAGDLGVSTLLIAGGVAANSRLRELAAQRCEAAGMTLRIPRPRLC
TDNGAMIASFAAHLIAAGAAPSPLDAASDPGLPVVQGQVA
315445856YP_004078735.1 hypothetical protein Mspyr1_43440 [Mycobacterium gilvum Spyr1]MFDASLPDPGRLARLSDGELIDAVTGWARASAAAEARKVAAIAELHQRLC
TDAAATHAFWVCDDCDALAAQLSCALTINHGRALSQIELATAMRHRLPKV
GAKFLAGDIPISTVTSILARTELVTDERALAQLDSKLSERAVAWGSLTKY
SLEKALDVWVDRFDPDAVKRTRSSSRGCYFTVGSGSDNADGTTTVHGRVS
NADAAIMEQRIASMARNVCEDDPRTLDQRRSAAIGAIHAGSMFLACACDN
PDCTAKVDDGRGSSFVVHVIADRESLDAPQDPLLHGDDVKDTESAGDTES
AEHTETTEHTETTEHTETTTEPRRKAALIPAARNAILPPAMLAELIAQGA
TIRFVGDPTGAEDHYRPSTALQRFIRSRDITCRFPGCDRPAAHADIDHTT
AWPCGVTHSANCKCYCRLHHLIKTFWPGFSDAQHPDGTVVVTTPTGHAYS
TKPLSGLIFPGWDTAAESPPPPAQATQPSVGRHLKMPTRRRSRAQNRAAR
IKAERMRNAALRASQVRPVASRQTYRAENSHDEYTFRPAGHEPDYGNDPP
PF
315445854YP_004078733.1 Co-chaperonin GroES [Mycobacterium gilvum Spyr1]MASVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGR
WDEDGEKRIPLDVSEGDVVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
315445852YP_004078731.1 hypothetical protein Mspyr1_43400 [Mycobacterium gilvum Spyr1]MAKTAEKNTITEVPSDLAERAADLSDDVLTSLESGQRNAIDAVRKFVGTV
EESLPGHDGDGPSRRETIVDAALDMADQLVKTQYEFIRSIVSSAGDALKK
QGDEKSPPQ
315445850YP_004078729.1 hypothetical protein Mspyr1_43380 [Mycobacterium gilvum Spyr1]MAQPRLPHAAAGLVAVTAAVSFGPPAGAEPVNPIPGNGIFLVGQDIAPGL
YRTDGTASVFGVWINDVPTQDSMCLWFTYSTPDTNKDNVVATNMSIGPMY
ANINATVKAFESRNCAPWARVT
315445848YP_004078727.1 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase [Mycobacterium MTLAQTATSQETSDRRIRRFSEIPSPHDVLTEFPLGARRAERVARDREEI
ADILAGRDDRLLVVVGPCSVHDPAAALDYASRLVKVADDLGDRLKVVMRV
YFEKPRTTTGWKGLINDPGMDGSFDVARGLRTARQLLLDIIDIGLPVGCE
FLEPTSPQYIADAVAWGAIGARTTESQVHRQLASGLSMPVGFKNGTDGNI
QVAVDGVKAAAAPHVFFGMTDMGRGALVSTTGNQDCHVILRGGTDGPNCD
AASVTVTAEKLVTAGLPGRVVIDCSHANSGKDHIRQVQVAKDVAQLVRDG
LPISGVMLESFLVAGAQAPEAQPLTYGQSVTDKCMDWGATDLVLRELANH
G
315445846YP_004078725.1 hypothetical protein Mspyr1_43340 [Mycobacterium gilvum Spyr1]MTSSPDRVAALDHIVERNQVWPRMAAKYGVENPVPPWKTSLDGFCDALDH
ASCTAAVPTFKERRDEEDALAATLYADLPYPENQLVALAHSLLARGVIDE
ETLARRMAAVRARLEA
315445844YP_004078723.1 nitrile hydratase subunit beta [Mycobacterium gilvum Spyr1]MSTAAERAAQLDLVARLKSAFPELPDAPTPDLLDHARITAYLKPVHDVGG
EPDAPMKYENKQYEQWEEMTYVICEVLAWRGIWLSEERRRIGNVDVGRAE
YLGLPYYGRWLLSVARVLVEKHHIGLTELSERMAEVAARYPDGLAGRKLE
AQPKSVGDGADVRRNAHHLHAVGKGDPQVYAGRAGEPRFAVGDAVVVREL
PVLFYTRTPEYVRGAVGEIDTVAYESPAAEDETWDRPDATPEWFYIVKFM
MADLWHGYTGPSTDILRTEIPQRWLEAAH
315445842YP_004078721.1 hypothetical protein Mspyr1_43300 [Mycobacterium gilvum Spyr1]MDTTPAVSANDLSTAAFGGNPGLWPLPPASGAHDLWVRAVAAGGQGRYAS
GFADLDRLERLPRSATTSSLALSTRASFLRQLGWHTVARGWDGRAAAVAA
GSAEPGAADAGADALIGLAADALGVGRFAASARALEGAAELIGAAATSRP
AVRMGWVSAELAMFRGDGTTAVAHARRAVDLAAGFGSVRHRVKSHVVLAA
ALCSSGDLDAARQEGDLALADATRFGLVPLQWAVACLLADIGSQAYPAAR
IRAVRDASAEAVTRWGGVWRPR
315445840YP_004078719.1 hypothetical protein Mspyr1_43280 [Mycobacterium gilvum Spyr1]MPDFGRRDPGGGDPSLTDINRTDQFLDALAAQQQPFVTDRDDVELAQLLA
GWRDDIRETPMGHVVTPLQAEAALDRVTRPAAPRRRFSLAVVGSAAAAVL
AIGGFGAVVAGSGPGDALYGLRTMLFGEQVQMRDDAVILAAQTEMQQVQQ
LIEQGDWQQAQAKLEAVTTTVATVDDVAQKEELIAQWQELTVKVEAQDPV
ATVPPGAPLPTFPELPAAVLDQATTSSETTAGTTSDTTAPSSETTAPSSE
TTGPSSETTTAPSETTGPAPTTTAPTSAPTTTAPAPSTTPTTSVGQTRSS
AAPSTPPSSAPTSTTVVLQSTTTSAAAPTTSAAPTTAAPTTAAPTTAVPT
TPSAVETTPAVEEETPPSPVAPVTTTTPVLPLPGE
315445838YP_004078717.1 inosine-5'-monophosphate dehydrogenase [Mycobacterium gilvum Spyr1]MSIAESSIPIAVPVPTGGDDPTKIAMLGLTFDDVLLLPAASDVIPATADT
SSQLTRRIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQA
GQVETVKRSEAGMVTDPVTCSPENTLAEVDAMCARFRISGLPVVDDKGSL
VGIITNRDMRFEVDQSKPVAEVMTKAPLITAQEGVSAEAALGLLRRNKIE
KLPIVDGHGKLTGLITVKDFVKTEQFPLSTKDSDGRLLVGAAVGVGEDAW
TRAMTLADAGADVLIVDTAHAHNRGVLDMVHRLKRAVGERVDVVGGNVAT
RAAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACAP
HGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAESPGDLIFVNGK
QFKSYRGMGSLGAMQGRGATGNLRGSYSKDRYFQDDVLSEDKLVPEGIEG
RVPFRGPLSTVIHQLTGGLRAAMGYTGSASIEALQQAQFVQITAAGLKES
HPHDITMTVEAPNYTTR
315445836YP_004078715.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MADGITAREAKRLQTRERLLGAAIAEFKRAGMAEADVSTIVGAAGVAHGT
FFFHFPTKEHVLLELERREEDRIAKRFATFTKTHHDLSAVLREAADLVLG
LERRLGVVLFKDFLALHFSPTRPPAEHGGDHPVVVLVAAQIEHARQRGET
AADVTPMNSAIYFLLGLYALLVTTDESTGRSVLVTDYLTRTLRSLQ
315445834YP_004078713.1 signal transduction histidine kinase [Mycobacterium gilvum Spyr1]MTRAAGVGLLMRSTINLGVSLIALADPLSTALPAGRWLLAVLAVWSLYRL
ATRSHATALLAVDYGLVLAVCLAVPLLVPVTDFHTFNTAPQAIAGTAVIS
FSVAVRVAACVPMAVGIAAAYAAGAASVIGWENVLSVMALYYFAVQCGTA
SIIRFMLLRVAGAIDQARRERAEAEVAERVTDAVRDYEREQLALLHDTAA
STLMMVGQGVSLPPERMAAQARRDLHLLRAGSWEAPPPRVELVAALRDCT
AHLSTPVEFDGRERLWVAGATANPVIAAAREAMNNVDRHARAELLRITVT
ETCVRLADDGIGFDLGHPRTGHGVDDSIIGRMARAGRDAHITSSPGAGTV
VEMSWAPSAPSAITPPAVDPDRLIDRTRTRYGLALTAYSLVNLAITVPTS
DAVLGILATLTSLAAIPGIMWQRWLFAWPAMLAALIVAIGQPAMLPQDHL
LGYPHWAQGAIGWCVLPLMLALPTRTGAALVMAYWACNSLVLVIRDPSPL
ILVNIGYGTASILGIQLFALVFNGLMRDAATAVESENAARQRLLTRDRVS
QALRAEYQRRYATIVAGVVPLLEALTRGEKIDTAMQLRARAECRRLRALF
DQASTFDHPLMQRIRPLIDAAEGRRVDVAIDVSGTLPDLDDEQISALATP
VTEVLNRASTSARIVVTGADGQVEISVVIDIADTADTPPADVDGAEVIVS
GRELWCLIVSGVQKG
315445832YP_004078711.1 GMP synthase [Mycobacterium gilvum Spyr1]MESAHPRPVLIVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIKARDP
RAVVLSGGPSSVYADGAPQLDPALFDLDIPVFGICYGFQAMAQALGGTVA
RTGTSEYGRTELKVAGGELHSDLPEVQPVWMSHGDAVTEAPSGFEVVATS
VGAPVAAFENRARRLAGVQYHPEVMHSPHGQQVLSRFLHEFAGIDAAWTP
ANIAEALVEQVRNQIGDGRAICGLSGGVDSAVAAALVQRAIGDRLTCVFV
DHGLLRAGERAQVQRDFVAATGANLVTVDVADRFLEALSGVTNPEGKRKI
IGREFIRAFEGAVRDTVERSDGSDVPVEFLVQGTLYPDVVESGGGSGTAN
IKSHHNVGGLPDDLKFALVEPLRLLFKDEVRAVGRELGLPEEIVARQPFP
GPGLGIRIIGEVTSDRLDTLRRADVIAREELTAAGLDHQIWQCPVVLLAD
VRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNE
VPEVNRVVLDITSKPPGTIEWE
315445830YP_004078709.1 hypothetical protein Mspyr1_43170 [Mycobacterium gilvum Spyr1]MAIDMDAMLAKIKDRQWALADIDWTAPGADRITDEQRPKLKAFMADLCWI
ENIGARGFAALAKKAPTPTIAEIYRYFHAEEQRHANAELALMKRWGMLDE
ASGELPEPNVNIRMAMDWLDTYADDMSLSILGTVIPMLEVALDGALLKFL
LEEVDDPVCHQVFEKINNDESRHIAVDFEVLNMIGHADARRLAIEFVGSV
ATPGLIIGAIMYIPLLNRIRNEIVGMGLEPERLYNAVKRFQSLGERGEFS
HRVPTYQVLKRHAAAVVNPDHPYHLLANSLVWVSERYPRRLLRPIPSWFK
ELTHEPAA
315445828YP_004078707.1 hypothetical protein Mspyr1_43150 [Mycobacterium gilvum Spyr1]MAGRVLALWCMDWPAVAASAAAELPPTTPVAVTLANRVIACSAAARAAGV
RRGLRRRESQARCPELHVAAADPARDARHFENVTLAVDELVPRAEVLRPG
LLALSVRGAARYFGSEVAAAERLVDAVAAVGAECQVGIADQLPTAVFAAR
MGRIIDPGGDGPFLAELSIRQLSGEPSLASASREELVDLLWRMGIRTIGQ
FAELSRSDVASRFGADGVTAHRIARGEPARGPSGREPEAELDAVMNCDPP
IDRVDAAAFAGRSLAGVLHRSLEAAGVGCTRLAIHAVTANGQELERVWRC
AEPLTEDATADRVRWQLDGWLNRRNPDRRAGAKRPGDGYGRPGAPITVLR
LRPVEVVSAEALQLPLWGGVGEQDRLRARRALVRVQGLLGPEAVKVPVLS
GGRGPAERITLTPFGDELVPQANPDQPWPGRLPEPSPTVLLDDPVELFDA
EGNPVRVTGRGLFSAEPSRLHAPGRSGQLSWWAGPWPVDERWWDPSSKSG
RTARAQVLIDETQALLLCYRQRRWYLEGVYE
315446326YP_004079205.1 type I restriction-modification system methyltransferase subunit [MMLPGDTRDDAALRKSRGAFFTPPPVARFLVDWAVRDPGHAVLEPSCGEAV
FLHEIGRRGDGGRPHTGPLVGVEIHPGSAAAAEQSLRAAGVGATIHARDF
FGHNEFGRYDAVVGNPPYVRYQDFAGESRARAREAALRAGVTLSNLASSW
AAFTVHSALHLRTGGRLGLVLPAELLSVNYAAGVRQFLMDHFSSVGLVLF
DERVFPGVLEEVVLLLADGYDAAGGNGATHMQLSQVRDAEGLARLTASRR
WTPPAGGAKWSAGLLSSAGLSAFDAAVGSDAFTVLETWGDTTLGMVTGSN
RFFTLSPAKVAALGLAPSDVLSLSPPGSRHLRGLGLTPQALHTLGADGRS
TFLFRPKGEPSPAAWHYIRSGEDLDVHQAYKCRVRKPWWRVPYLRPADLF
LTYMNADTPRVTSNRAQAHHLNSVHGVYLRDDLRRDGMSLLPLAALNSVT
LLGAETVGRAYGGGMLKIEPREADVLPVPSPELVRRNADGLRAVRSAVAA
RLRDGRLLDAVALVDDALLLSTSSLSVRQLRALRRDHGALTARRVARGKV
NGGR
315446325YP_004079204.1 LysR family transcriptional regulator [Mycobacterium gilvum Spyr1]MELRHLRYFRAVAEELHFGRAAQRLLIAQPPLSQQIRQLEREVGADLLRR
TTRSVELTEAGRAFLERTVRILDAVDDAVDQARRIGTGAEGRLVVGCVGS
ATYSLLPRLVRELRAALPAVDLRVRGEMLAPEQLAALHAKDIDLALMRPP
VDDPALTAVSLRRDRLLVALPAGHRCADRDEVSLADLRDEDFISHAGGGR
SRMSALLAALCADAGFSPRIRDEVDETSTLVTLVAGGLGVALVPEPTAAL
EIGGVTYRPLAAKAGATIELLAVYRSADASPLTAKVVDVLRATV
315446324YP_004079203.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum Spyr1]MDVVICNPVRTPVGRMGGALSPLTAADLATVTLRALIDRTGLGEGDVDDV
ILGNGYANGEAPALGRVAALDAGLGTAVPGLQIDRRCGSGLQAVLYAAGQ
VATGAARTVIAGGAESMSNVEHYALGLRTGVRQGGIALQDRLDRARETAG
GTSHPVAGGMIETAENLRREYGIEREEQDELALRSHRRAVAAHENGSFVD
EMVPVTVPGARGGADTVVDRDEHPRTDLTADKLAALRPIRSRVDAGSTVT
AGNASGQNDGAAMCVVTTRAEAEKRSLEPLLTLRSWSVTGCAPETMGIGP
VSAAAAALERADLTLDEIDLIEVNEAFAAQVLAVLAEWKIDPLDDRLNPN
GSGISLGHPIGATGARILATAAYEARRRDARYVLEAMCIGGGQGLAAVFE
VTR
315446323YP_004079202.1 3-oxoadipate enol-lactonase [Mycobacterium gilvum Spyr1]MSAVDVHVIESGLPDGPAVVLSNSLGATHRMWDAQLDALERRFRVLRYDT
RGHGASPVPDGPYSIDDLADDVVGILDRRGIDTAHLVGLSLGGMTAMRVA
ARNPDRVNRMVLLCTAAELAPAQAWTDRAAAVRAGGAESVAPAVIARWFT
LSHLETHPAERAEWVDMIAATPAEGYASCCEAIAELDLREQLPTITAPTL
AIAGADDPATPPAKLEQIVSAIPGARLLVVDGAAHLANAEQPEQITPAII
EHLEQR
315446322YP_004079201.1 3-oxoacid CoA-transferase subunit A [Mycobacterium gilvum Spyr1]MTLDKVVGSARGAVDDIPSGSSLAVGGFGLAGIPWFLIEALLEQGADDLT
IVSNNCGVDGGGLGLLLEAHRITRVIASYVGDNKEFARQYLSGELTVELT
PQGTLAERLRAGGSGIGAFFTPTGVGTLVADGGLPWRYHPDGSVALASPP
KEVRTFGGRQMLLEESIVTDFALVRAAVADRAGNCVFHAAARNFNPPAAM
AGRITVVEAERVVEVGELHPDEVHLPGIFVQRVVELSPDQAARKGIEKRT
TRPRIPQEVSA
315446321YP_004079200.1 butyryl-CoA:acetate CoA transferase [Mycobacterium gilvum Spyr1]MSWTRTEMAARAARELRDGDYVNLGIGLPTLIPDHLPEGSDVTLHAENGI
LGVGPFPYDDEVDPDLVNAGKQTVSVVAGASFFDSATSFAMIRGGHVDVA
VLGGMQVAVNGDLANWMVPGSMVKGMGGAMDLVNGAAKVIVLMDHVSKSC
AAKLVSSCDLPLTGKAVVQRVITDLGVFDVTGTEFGVVELAPGVDLDEVA
AKTGAPVSDHRQRLSAASSERDRMPSLA
315446320YP_004079199.1 LuxR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAPVTFVGRSGDLDELIRRTAATVSDGSAVVTVRGTPGIGKTALLRQVAA
TVPNSRWATAVPWESTVDGAVLSQLSPEPGAEQLARALAGDDPTLLVVDD
AQHADSASLQALSSLIRHHRSLPVLLVLVTDGHPLPVPGLDGDELVMTGL
DVREVAALASARGHVLPALMVDRLTRHTAGHPGHVRALLDELPAQTWSRL
DAPLPAPREVVAQVERELAAAGDGGRALAFALAVLGEEATLSEAVLLAGI
DDPLAAVAAATGASLVRAGDPLEPRLRDPLAAAAVLDVCGVQATADAHRR
AADVVTDPVARLRHRVAATPVPDEALADEVDALARSSGADGEWSRAAVLF
RDAARLTAAPLLRDERLTRSVDALVAAGDCVGAAAMVPTVENLRETPLRN
ATLAYLAILRGRATEAEVRLRRAWDIVHIDRDTDTAAFIAQRHVLHALVH
CQGEELVAWADRALALAERDSPAGIEAAAIRGLGLLASGQPRRAAAEYDD
LHERVRHGAQAQRVVMGRGWVQLMRDDVEGARSSLESAVAAAGLGGSTRI
TLWSHAWLARTQFSLGEWDAALASVAHGRRLAETSGIVLVTPLLEWTAGQ
IAALRGDWETAHAAAHAAAVGGEYAMMRIPALLVRAQIAEAQADYATVRR
VLEPLTTLAPGTSLQEPGYWPWVDALANAMVLTGDLAAAEDFLRPHAQRA
KSRGHRSAQARLGWVRGRLLGARGDIASAREAFEQSLALLDGLPLRYETA
RVNFAYGQTLRRAGKRREADTVISAARELYVALGADTYVARCDRELKAGG
LHQSRESRHTVELTPQEEAVSTLVSRGLSNREVAAELYVSPKTVQYHLTR
IYAKLGIRSRSELAALRR
315446319YP_004079198.1 hypothetical protein Mspyr1_48250 [Mycobacterium gilvum Spyr1]MTETYSVALSFEDGVTRFINCRPDQTVADASYRQRINIPLDCRDGACGTC
KALCETGSYDGGTYIDDALAPDEAAAGYVLPCSMKPRSDLVLQIAATSDS
AKTEAATYQGTLTLLERLSPTTVKIGIEIPNRGELAFLPGQYVNIAVPGT
DQTRSYSFSNAPHEELLTFLVKLSPGGAMSDYLAHRAQVGDAVTFTGPNG
SFFLREAQRPVLLLAGGTGLAPILAMLRTMRAAGSTRTTHLIYGVSSDDD
RTAVDEIEEIGAQLPSFTWDYCVSDPASSAPNRGPDRAYVTSLIAPHHLH
DGDLAIYLCGPPPMVEAVRTHLNTAGVEPSGFYYEKFGLATTRPTASSAS
LPTPTADSPAIEAEALLPVPDARSVAGQVVLRPADLRPVQNRPTLVDDGA
IRRLAGQTVFGPLAEPADDATVVSDDGYQIGEEHPEVRESDAIFEARSAL
ELGALELTMGRLSSAQLAGYRLLAESTLPYVDGDRFVDAEQYTETNAAFH
DYLFTLTRNDHLLQAYQALGVKGRMSEVLRHATWCHPRCAQDHVDIVAAF
EAGDRDAARSLIAAHAERSKQTMRRAMAETAEASAPVFVTPGRFAGKVVV
VTGAAQGIGERTARRIHAEGGVLVLADRSELVKELADELAATSAAVAVTA
DLEHHEGAESVVQQALSAFGRIDVLINNVGGAINFKPFTEFTAAEVRAEI
DRSLMTTLYSCHAALPSMVSRGRGVIVNVSSAATRGIHRIPYSAAKGGIN
AITASLAMEYADAGIRVVATAPGGTAAPPRRISRGTPVPRDETEQAWFDA
HITQTLDSSLLKRYGTLDEQAAAICFLASDEAAYITGTVLPVAGGDLG
315446318YP_004079197.1 benzoate 1-2-dioxygenase small subunit [Mycobacterium gilvum Spyr1]MTNTDMTTIETNTGTTTLITQNAIEQFLYREARYLDDREFEKWLDCYADD
VVYWMPAWTDDDKLVEDPQRDISLIYYSNKGGLEDRVFRIRTERSSATSL
PEPRTSHNISNVEVIERRGDIVDVRFNWHTMYFRYKTVDPYYGTSFYTID
FGGEQPLIRRKTVVLKNDYIHHVVDVYHF
315446317YP_004079196.1 benzoate 1-2-dioxygenase subunit alpha [Mycobacterium gilvum Spyr1]MTQTTASPQPRTHLAAVLADAVIDDPEAGVFRANRRIFTDEEIFELEMKH
IFEGNWIYLAHESQVANPGDYFTTYIGRQPVVITRSKDGSLNCLINACAH
RGAMICRRKTDNRMTLTCPFHGWTFRNDGALLKVKDPDGAGYPEAFNVNG
SHNMTTVARFESYRGFLFGSLNPDVLPLTEHLGDATKIIDMLVDQSPDGL
EVLRGSSTYTYDGNWKVQAENGADGYHVTATHWNYAATTSRRGTGESKNE
TKALDAGGWGKSGGGYWSFPHGHLCLWTWAANPQDRPLWDKLDELKATHG
DAKGEFMVKGSRNLCVYPNVYVMDQFSTQIRHFRPIAPDKTEVTIYCIAP
KGESAQARANRIRQYEDFFNASGMATPDDLEEFRSCQLTFRAEAAPWNDM
SRGAQHWLDGPDDVARSLGLDAVISAGVKNEDEGLYPVQHGYWLETMRAA
AQKEAR
315446316YP_004079195.1 LysR family transcriptional regulator [Mycobacterium gilvum Spyr1]MELRHLRYFLAVAETCHFGQAAEQLHIAQPALSYAIRQLENSLDATLFTR
TTRHVALTPAGEFLRVEATRILNGVDAAQRGVRRIAAGRSGLLRLGLTGT
AAFSHLPKIARIVRQELPAVALDIHADLLTPDQCEGLRTGALDVGVLRPP
AVGGDVATRTIAAEPLVLAVSADHRLAAEPVVSLADLRSEPFIGYTGQDS
AVNDAVTRSCRAAGFVPHREHSTPGTAVLLALVAADLGVSVVPASVRALP
LHGVVFRDLVDGGTVDLALAWRDGVDNPVVDAVVAVLAGALTSLDHPALQ
EQS
315446315YP_004079194.1 L-alanine-DL-glutamate epimerase-like enolase [Mycobacterium gilvumMKITAVEAIPFAIPYTKPLKFASGEVHTAEHVLVRVHTDEGVVGVAEAPP
RPFTYGETQDGILAVIRQIFAPQIVGLTLTEREVVNARLARTVGNPTAKA
AVDMAIWDALGRSLDLSVSALLGGYGDHMRVSHMLGFDTPDTMVAEAERI
RDEYGISTFKVKVGRRPVTLDTAVVRALRERFGDTVELYVDGNRGWTASE
SLRALKDMADLDLLFAEELCPADDVLGRRWLVEHTEIPFIADESVPTPAD
VTREVLGGSATAISIKTARTGFTGSRRVHHLAEGLGLEVVMGNQIDGQLG
TACAVAFGAAFELTSRRAGELSNFLDMSDDLLTHPLRIRDGRLHVPPGPG
LGIEIDPDKLDHYRTDH
315446314YP_004079193.1 catechol 1-2-dioxygenase [Mycobacterium gilvum Spyr1]MTTIESPINTTSSEASAAASGASATERFRSDKSPFDAVRDTPKERVDLLA
REVLSAVHDTIRRHRVTYDEYNALKAWLISVGADGEWPLFLDVWVEHVVE
DVATDHREGSKGTIEGPYYVPNSPECGARGVIPMRDGEQGTPLVWDGVIT
STDGTPLQGKVELWHADADGFYSQFAPNLPEWNLRGSFSTGADGVFEINT
IRPAPYQIPTDGSCGKLIAAAGWHAWRPAHLHVKVSAPGHELLTAQLYFP
GDPHNDDDIAGAVKPELILNPTEQADGSQRVVYNFVLDPAKA
315446313YP_004079192.1 muconolactone delta-isomerase [Mycobacterium gilvum Spyr1]MLFHVRMDVAIPPDMDPQVRAQTVHREKEYSQQLQRDGKWPHIWRIVGEY
ANYSIFDVDSNDELHQILSGLPLFPYMKIHVTPLAVHPSDVNAG
315446312YP_004079191.1 permease [Mycobacterium gilvum Spyr1]MIAVGVALGALIGVLLGLLGGGGSILAVPALVYGLDLGVEQAIPISLIVV
AAASAVGVLPKIRARQVRWRMAGIFSAAGIPATLAGSAISRHLPESALLI
GFAAVMVVAGIRMLTDQSSTGTACEIREGEVNWRRCAPRSIGAGLVVGLL
TGLFGVGGGFLIIPALVVVLGVEMSTAIGTSLLIIIANSVAGIFSHLQSI
SVDWQVTGLFVAAAMVTSLIAGYVGTKTDTERLQRWFAYLVFVVAGYVLI
DTIFLR
315446311YP_004079190.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium gilvum Spyr1]MSSTLTDDAKTMLSKPNPAVIATVRSDGHPVSAATWYLLRDDGLLVNMDV
ARKRLQHLRNDPRVSLTVLDSDDWYTHVTVIGHVTEIYDDDGLTDIDALS
RHYQGTQYPDRERPRVSALIAIDRVHGWGAQKNNDQPDGRPQ
315446310YP_004079189.1 cysteine synthase [Mycobacterium gilvum Spyr1]MSAPDPWSNRSSRPRGSDRSSRPRCHLQSRIWVDNAVRLIEADARRSADT
HLLRYPLPSRWCSEVDVALYLKDETTHITGSLKHRLARSLFLYALCNGWI
DEGTTVIEASSGSTAVSEAYFAAMLGLPFIAVMPESTSASKIALIESQGG
RCHFVKRSAEVYAEAQRLAEQTGGHYLDQFTNAERATDWRGNNNIAESIF
EQLGEETHPVPEWIVVGAGTGGTSATIGRYLRYRRYPTRLCVVDPENSAF
YPSYQQGVDVVIDASSRIEGIGRPRVEPSFLPGVVDRMVSVPDSGSVAAA
HHVSRVLGRRVGPSTGTNVWGAFGLLAEMVAEGRSGSVVTLLADSGDRYI
DTYFCDEWLSSQGIDPSESAGSLAEFERSGRWV
315446309YP_004079188.1 phosphohydrolase [Mycobacterium gilvum Spyr1]MSAVPSHSPGAILKTTALASAGTLAAGIAYASLIERNAFVVREATMPVLT
PGSSPLKVLHISDIHMRPQQRRKQEWLRELAQWEPDFVVNTGDNLSHPKA
VPAVVQALGDLLAVPGVFVFGSNDYFAPKPKNPANYLTKPGRRIHGEPLP
WQDLRAAFTERGWLDMTHTRREFEVKGLHIAAAGVDDPHLKRDRYDTVAG
PASPAANLTLGLTHSPEPRVLDRFAADGYQLVMAGHTHGGQLCLPFYGAI
VTNCDLDRSRAKGPSRWGVRTQLHVSAGIGTSPYAPLRFCCRPEATMLTL
VAAPTGGSDMGSRAGLSHPTVSAR
315446308YP_004079187.1 membrane carboxypeptidase [Mycobacterium gilvum Spyr1]MPEQPPTQPPRAVTVIKLAWCVVLASVIVAGLLFPVVGGFGLVSNRASDV
VANGSAQLVEGEVPQVSTMTDSKGNIIAWLYSQRRFEVPSDQIANTMKLA
IVSIEDKRFADHNGVDWQGTLTGLSGYLSGNLDTRGGSTIEQQYVKNYQL
LVIAQTDAEKRAAIETTPARKLREIRMALTLDKTFTKPEILTRYLNLVSF
GNNAFGVQDAAQTYFGINATDLNWQQAALLAGMVQSTSTLNPYTNPDGAL
ARRNVVLDTMIENLPEYADELRAARQEPLGVLPQPKELPRGCIAAGDRAF
FCDYALDYLARAGISKDQVAKGGYMIKTTLDPDVQASVKNAITQYASPDL
PGVASVMSVVKPGKDSHPVLAMASNRTYGLNLDAGETMQPQPFSLVGNGA
GSVFKIFTTAAAMEMGMGINAQLDSPSRFEAKGLGSGGARGCPPATWCVQ
NAGNYRGTMSVTDALATSPNTAFAKLIAQVGVQRTVDMAVRLGLRSYALP
GTARDYDPESNESLADFVKRQNIGSFTLGPIEVNALELSNVAATLASGGM
WCPPNPIAEVYDRYGEPVSVTTETCEQAVPEGLANTLANAMSKDDTGAGT
AAGAAGSVGWNLPMSGKTGTTEANRSSAFLGFTNRYAAASYIYDDSTAPT
ELCSFPLRQCGSGNLFGGNEPARTWFSAMQPIATAFGDVTLPPTDPRYVE
GAPGSKVPSVAGMDQDTARARLREAGFQVADQATPVNSSSRYGTVVGTAP
SGQTVPGSIVTIQISNGIAPAPPPPPAGAPPPGGPPPPAGETVIQIPGLP
PITVPVLGPPPPPPPPPG
315446307YP_004079186.1 transcription factor WhiB [Mycobacterium gilvum Spyr1]MSSIKPAARPTTVTAPTPPVVQGKEAEARIAWVSQARCRQTDPDELFVRG
AAQRKAAVICRHCPVIAECGADALDNRVEFGVWGGMTERQRRALLKQHPE
VVSWADFFAAQCKHRTAG
315446306YP_004079185.1 oxyanion-translocating ATPase [Mycobacterium gilvum Spyr1]MSTTPPALDMGSILRDTSNRVVVCCGAGGVGKTTTAAAMALRAAEYGRTV
VVLTIDPAKRLAQALGIESLGNTPQRVPLAPEVTGELHAMMLDMRRTFDE
MVVQYSGPGTADAILDNQFYQTVATSLAGTQEYMAMEKLGQLLSEDKWDL
VVVDTPPSRNALDFLDAPKRLGSFMDSRLWRMLLAPGRGIGRLVTGAMGL
AMKAMSTILGSQMLSDAATFVQSLDATFGGFREKADRTYELLKRRGTQFV
VVSAAEPDALREASFFVDRLSEEHMPLAGLILNRTHPTLCELHADKAAEA
ADELQKTDPDSVAAAALRIHAARASTAKREVRLLSRFTGANPHVALVGVP
SLPFDVSDLDALRAIADQITGEAPAA
315446305YP_004079184.1 oxyanion-translocating ATPase [Mycobacterium gilvum Spyr1]MATTYTGTTDGPKPVGWPSRLTKARLHFVSGKGGTGKSTIAAALALTLAA
GGRKVLLVEVEGRQGIAQLFDVPPLPYEEVKIATADGGGQVNALAIDTEA
AFLEYLDMFYNLGLAGRAMRRIGAVEFATTIAPGLRDVLLTGKIKEIVTR
NDKAGKADKSGKGTAYDAVVVDSPPTGRIARFLDVTKAVSDLAKGGPVHS
QAEGVVKLLHSDLTAIHLVTLLEALPIQETLEAIDELREMGLPIGSVIVN
RNISSYLAPDDLAKAADGVVDADAVRAGLESAGITLSDNDFAGLLTETIQ
HATRIRARTESAEQLAALDVPRLDLPTLPDGVDLGSLYELAEELAHQGVR
315446304YP_004079183.1 hypothetical protein Mspyr1_48090 [Mycobacterium gilvum Spyr1]MSEPTRWEYATVPLLTHATKQILDQWGEDGWELVSVLPGPTGEQHVAYLK
RAK
315446303YP_004079182.1 translation initiation inhibitor [Mycobacterium gilvum Spyr1]MSSGWQARLDELGIELPDVVAPLAAYVPAVRTGNLVYTSGQLPIRDGELL
AAGKVGAEVSAEDAKPLARQCALNALAAVHALTGIESVVKVVKVVGFVAS
APGFDGQPGVINGASELFGEIFGEAGAHARSAVGVSELPRNTPVEVEAIF
EVA
315446302YP_004079181.1 Zn-dependent hydrolase [Mycobacterium gilvum Spyr1]MEHPAYNVLRPVTDTASVLLCENPGLMTLDGTNTWVLRGPGSDEMVVVDP
GPDDKDEHIERLAALGRITLVLISHRHGDHTGGIDRLVDMTGAVVRSVGS
GFQRGLGGTLTDGEVIDAAGLAITVMATPGHTADSVSFLVDDAVLTADTV
LGRGTTVIDSEDGDLGDYLESLRRLRGLGHLTVLPGHGPELDDMAAVSEF
YLAHREERLAQVRGALGALGEDATARQVVEHVYTDVDEKLWDAAEWSVQA
QLNYLRR
315446301YP_004079180.1 hypothetical protein Mspyr1_48060 [Mycobacterium gilvum Spyr1]MVTVEVDRVCVESRLVGGAISCPACPDGVLGGWGYARARHVEGLDDRVRP
RRARCRSCLVTHVLLPVTMLLRRAYAAERVWMALSARAEGVGHRGIAARL
QVPPSTVRGWLRRAGQRLESMRTWFLTVAVGTGIDVMIPDGLGCGWRDVV
AAVMVAASAIGQRFGPAGLLGVVTPALVVVAVSGARLLAPGWPPMSSAVP
CNTSCP
315446300YP_004079179.1 Mu transposase/integrase [Mycobacterium gilvum Spyr1]MSLEDHKRRERANAIGLFRYQVICPALEEGLSTRQRGRVVREIAGRRHID
PFGTQVQIARATLDRWIRRYRGGGFEALVPEPRRLATRTDVQVLELAASL
KRENPARTAAQVARILRTATGWAPSESTLLRHFHRCELMGPAAGQSAEVF
GRFEAPDPNELWVGDALHGPRVGDRKTYLFAFLDDHSRLVVGHRFGFAED
TVRLAAALKPALAARGVPASIYVDNGSAFVDAWLLRACAKLGIRLVHSAP
GRPQGRGKIERFFRTVREQFLVEVTDTTAEDLAAAGVDHAGALLELNRLF
MAWVETEYHRRIHTETGQSPLARWEAGFDRLGHPAALPTAADLTEAFLWS
EFRIVTKTATVSLHSNTYQVDPALVGRRVELVFSPFDLQAIEVRDQDRSY
GQAIAHTITRHAHPKARPEISSQTPPAATGIDYLALTAAAHHEQLRDDER
IGYHALYGAQATATDDNQLPGQLALPSLDHKDGVSA
315446299YP_004079178.1 type II secretory pathway- component ExeA ( ATPase) [Mycobacterium MSIQRLQSHWGFSRMPFGRDLAPSMLHRHPGHSEAIARISWCVDQCAIGV
ITGEVGAGKTVAIRAAATALDPARHVIIYLANPTIGVRGMLTHIVAALGH
TPVFHTARLAPQAADALAAEHAERGRSPVLVVDEAHLLDNGQLEAIRLLT
NHDMDSGSPFAVVLVGQPTLRHRLRLGVLAALDQRIAVRYTLPGMTPADT
ADYINHHTKIAGRSDVLFADDAITLIHNASRGHPRAVNNLALHALTAAFA
AGHSIVGEKAARIAISETATD
315446298YP_004079177.1 Crp/Fnr family transcriptional regulator [Mycobacterium gilvum SpyrMDEILARAGIFQGVEPSAISALTKQLQPVDFPRGHTVFAEGEPGDRLYII
ISGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVR
AVSMDREALRAWIADRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRV
AKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAH
RGWIRLEGKSVLISDSERLARRAR
315446297YP_004079176.1 hypothetical protein Mspyr1_48010 [Mycobacterium gilvum Spyr1]MSWLFVALVPGLLMMATFGLERVEAGLRRDAFSPADVGRLLDAEVGRGER
RIRSHPQALPTANGRRGNGRIVEPVPTPDLPTPQYLQHLANTEFRQTRHA
NRV
315446296YP_004079175.1 DNA-(apurinic or apyrimidinic site) lyase [Mycobacterium gilvum SpyMTVSEPSTGAKSARRSARKWDRETHLGLVRRARRMNRTLAQAFPHVYCEL
DFTNPLELTVATILSAQSTDKRVNLTTPALFAKYRTARDYATADRTELEE
LIRPTGFYRNKATSLIGLGQALEERFDGEVPRTLDELVTLPGIGRKTANV
VLGNAFDIPGITVDTHFGRLVRRWRWTAEEDPVKVEHIVGDLIERSEWTL
LSHRVIFHGRRVCHARKPACGVCVLAKDCPSYGTGPTDPLIAAALVKGPE
TEHLLALAGL
315446295YP_004079174.1 thiol-disulfide isomerase-like thioredoxin [Mycobacterium gilvum SpMSASARWSVVALVILVALGVAFWSELDAQDPASPAGNDARDTVSARDKRD
ADTPEALAGPRAAAALEPCPAPGEGQGPAPLRGIVLECVGDGTPTDIAAA
VAGRPVVLNLWAYWCGPCADELPAMAEYQRRVGPEVLVLTVHQDENESAA
LIRLAELGVHLPTVQDGRRSIAAALQVPNVMPATVVLRADGSVAEILPRS
FATADDIAAAVDPKIGVA
315446294YP_004079173.1 ADP-ribose pyrophosphatase [Mycobacterium gilvum Spyr1]MSWDSREGELIPSAAPPWLAPLVDQPGAVKNAYRRRVPAEVLAALTAAST
TAAVTGTRRDAAVLVLFSGPEEGERGTLPEHADLLVTVRAATLRHHAGQA
AFPGGAADPDDRSPVHTALREAAEETGLDAGRLRPLATLEKMFIPPSGFH
VVPVLAYSADPGPVDVVDTSETAHVARVPVRAFVNPENRIMVYRDENTRR
TAGPAFLLNEMLVWGFTGQVISAMLDVAGWAVPWENDKLYELRDAMALLD
AEDSYGEAQR
315446293YP_004079172.1 trypsin-like serine protease with C-terminal PDZ domain [MycobacterMNSSQWLDIAILAVAMLAAVSGWRSGAPGSLMALVGVVLGAGAGILLAPH
VVDHISGPRTKLFATLFLILVLVVIGEIAGVVLGRAVRGAIRNPGLRIVD
SVVGVALQLVLVLTAAWLLGTALVSSPQPNLAAAVSGSRVIAEVDAVAPD
WLRSVPDRMSSVWENAGLHDVLKPFGPTPVAAVDAPDPALATSPVVNQTR
SSVVKVKGVAQSCQKVLEGTGFVVAPNRVMSNAHVVAGSDTVTVEVDGQE
YTAGVVSYDPNADISILDVPDLPSVPLQFVDALAQTGTDGIVLGYPGGGD
FTATPARVREVIELNGPDIYRSTTVTREVYTIRGTVRQGNSGGPMVNRQG
KVLGVVFGAAVDDIDTGFVLTADEVAAQMARVGNVDLVPTGTCISSG
315446292YP_004079171.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMTPPDPSVVRIGGPWRHLDVHANGIRFHVVEAQRPSGADDVTRPLTDRPL
VILLHGFGSFWWSWRHQLTGLSGARLVAVDLRGYGGSDKPPRGYDGWTLA
GDTAGLVRALGHNSATLVGHADGGLVCWATSVLHPRVVKAIAVVSSPHPS
ALRASALRRRDQGRALLPSMMRYQVPMWPERALTRHNGAELERLVRSRAS
EKWQVSEDFAETVGHLRRAVQIPSAAHCALEYQRWAVRSQLRAEGRRFMR
SMRAPLSVPMLHLRGDADPYVLPDPVYRTQRYAPHGRCVSIAGAGHFAHE
EQPAAVNAQLSRFLSQVYA
315446291YP_004079170.1 hypothetical protein Mspyr1_47950 [Mycobacterium gilvum Spyr1]MNATDNFRREGSLHVSDRKNDVPNTVTSIPLVDPHAPKPDPSIGDLVKDA
TAQVSTLVRAEVELAKAEITRDVKKGLTGSVFFIAALVVLFYSTFFFFFF
LAELLDNWLWKWAAYLIVFGIMVVLTALLALFGYLKVRRIRGPQKTIETV
KELPDAFTPGPDKRAVAASKDNLPATQKDPSGW
315446290YP_004079169.1 hypothetical protein Mspyr1_47940 [Mycobacterium gilvum Spyr1]MKTTSLRLLIASVIALAGICAGLGAGAASAQTGVPLGGGSGLIVNGETLC
TLTAIGTDNRGDLVGFTSAHCGGPGAVVASEAAPNAGVVGEMVAGNDILD
YAVIKFDPAKVTPVNEVNGFRIDGLGPDPAFGEVACKLGRSTGYSCGVTW
GPGQEPGTILNQVCGGPGDSGGPVTVNNQLVGMLHGAFSEDLPTCVVKFI
PLHTPAVTMSINTQLADITAKGRPGSGFVPVGAR
315446289YP_004079168.1 acetyl-coenzyme A synthetase [Mycobacterium gilvum Spyr1]MTETHVDIPSSYPPDPGFAENANATEALYEQADADRLEFWAEQARRLAWE
TPFDEVLDWSEAPFAKWFVGGTLNVAYNCVDRHVEAGNGDRVAIHWVGEP
VEHSRDITYAELKDEVCRAANALTDLGLTAGDRVAIYMPMVPEAIIAMLA
CARLGAMHSVVFAGFSASALKARIEDAQAKLVITTDGQYRRGSAVSLKTG
VDEAIDGLGEDSPVEHVLVVRRTGIDTPWTPDRDLWWDETVPEADTEHTP
EAFDSEQSLFLLYTSGTTGKPKGIVHTSGGYLTQTAYTHHNVFDLKPESD
VYWCTADIGWVTGHSYIVYGPLANGATQVVYEGTPASPTEHRHFEIIEKY
GVTIYYTAPTLVRTFMRWGRQIPAEHDLSSLRLLGSVGEPINPEAWRWYR
MAFGKDKTPIVDTWWQTETGAIMISPLPGVTHCKPGSAMRALPGISAKVV
DDDGNELERSPDHGEHATGYLVLDQPWPAMLRGIWGDPERFKETYWSRFA
EKGWYFAGDGARIGSDGEIWVLGRIDDVMNISGHRISTAEVESALVGHSG
VAEAAVVGATDEHTGQAICAFVILKSSAHGGEENMIDELRAEVAKEISPI
AKPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPSVFEAIR
ASK
315446288YP_004079167.1 hypothetical protein Mspyr1_47920 [Mycobacterium gilvum Spyr1]MTSSRDPLAPLTELPGVAAAADEAREALGRAHRHRANLRGWPQNAAEASL
RAARASSVLDGGALQFPPDGTEPVLAGAIRVAEALEGGEGTLVGVWRRAP
LQAIARLHSLAAADLVDDDALGRPREGAGRRLELLADLATGGTRVPASIL
AAVAHGELLTLEPFGSADGVVARGVSRLITIASGLDPHGLGVPEVHWMRR
SNDYRAAARGFASGTPDGLTAWLLLSCEGLHAGAREALSIAQAPSAQG
315446287YP_004079166.1 HAD-superfamily hydrolase [Mycobacterium gilvum Spyr1]MPVEPERPIRTAAFFDLDKTVIAKSSTLAFSKPFFSQGLINRRAVLKSTY
AQFLFSMSGADHDQMDRMRNYLTTMCAGWDVEQVKAVVGETLHDIVDPLV
FAEAAELIADHKRCGRDVVVVSASGEEIVAPIARALGATHAMATRMVVED
GRYTGDIAFYCYGEGKAEAIRALAEREGYALEHCYAYSDSITDIPMLESV
GHPTVVNPDRGLRKEATARGWPVRAFSKPVSLRDRLPAAPSGAAVATTAA
VGFSALAAGALTYSLLRRFAF
315446286YP_004079165.1 chromosome partitioning ATPase [Mycobacterium gilvum Spyr1]MDTAEGVLALVEDPTLNSHVERVAAAAGLRMVRTDDPSSRRVWTGAAAVL
VDGAAARRCAARGLPRRSRVLLISAEAPGADDWEAAVAVGAQQIVTLPAE
DRDLMAALSDAAEAARDPRRRGPIVAVLAGRGGGGASVFATAVAQSATES
LLIDGDPWGGGLDLVLGSETEPGLRWPDLSLAGGRVGYAALRDALPRRHG
VAVLSGSRVLSGDRSSNDIDPAPLGAVIDAGSRGGVTVVCDVARRPGAAA
ETAVAAADLVVLVTPADLRSCAASAATAQWVTAANPNTGVVVRGPAPGGL
RPADVARIVGLPVLTAMRPQPGIESALERGGLRVRSRSPLARAAREVLSV
LGLNPHLDRTAETAA
315446285YP_004079164.1 Flp pilus assembly protein- ATPase CpaF [Mycobacterium gilvum Spyr1MSAPLVDRVRERLAQETAPLRPSVVAAAIRAESGGVLGDAEVLRSLRELQ
TELTGAGALDPLLSAPGTTDVLVTAPDAVWIDDGRGLRRTSVRFADEAAV
RRLAQRLALTAGRRLDEAQPWVDGHLLAPGPGGQLTVRLHAVLPPVAAAG
TCLSLRVLRPANQNLDALTAAGTLTPEAAGLLRDILAARLAFVVSGGTGA
GKTTLLAALLAAVPHTERIVCVEDAAELAPDHPHLVKLVARGANVEGAGE
VTVRDLVRQALRMRPDRIVIGEVRGPEVVDLLSALNTGHDGGAGTVHANS
PAEVPARFEALAALGGLDRAALHSQLAAAIQVVLHVARDRAGRRHLAEIG
LLYRAEGGSVDVVRCWHRDDGFGPGAGQLRALLRARDGS
315446284YP_004079163.1 Flp pilus assembly protein TadB [Mycobacterium gilvum Spyr1]MTLAALALAVAVLTAPTDARLRAPVLRRTSTPRRRLPGPLPAAIACLTVA
AVHTPTTAAALGLLLATLGARRRVTRAHRRRTSEATALQDALDVLVGELR
VGAHPVAAITVAGHEARGRIAESLNAVAARALLGADVPAGLRAEGRRSPS
PGHWDRLAVCWQLAQTHGLAIAALMRAAQRDITERERFRGRVESGMAGAR
ATAVILAGLPVLGVLLGHAIGAEPLAFLLSGGAGGWLLLVGTVFVCAGLL
WSDRITVQVLT
315446283YP_004079162.1 Flp pilus assembly protein TadC [Mycobacterium gilvum Spyr1]MTWAALFLAAALVALPATSAARVRRGLVPVGDAARQVDGDALTVAASLDL
LAACLTSGMAVSTAAGAVAASAPPAMAALLSRAADLLALGADPARAWANP
DAGERNSTQNPVGGHLESFLRMARRSASSGSALAHGVEELAVQLRADAVD
AAGARAERAAVLMAGPLGLCYLPAFLCLGIVPVVAGLAGDVLQSGVL
315446282YP_004079161.1 hypothetical protein Mspyr1_47860 [Mycobacterium gilvum Spyr1]MIRQRLQELRVRLVLLAVADDGMSTVEYAIGTIAAAAFGAILYTVVTGDS
IVSALTNIINRALSTNV
315446281YP_004079160.1 hypothetical protein Mspyr1_47850 [Mycobacterium gilvum Spyr1]MALVAVLAVCLAGLTAVSMQVRCIDAAREAARLAARGDSAAAARVAQQIA
PSGAAVEIRRDGAFAIARVTARSALLPAVSISAEGVSALEPGG
315446280YP_004079159.1 hypothetical protein Mspyr1_47840 [Mycobacterium gilvum Spyr1]MMCVALLAVTCGAAVLGSAVAARHRAQAAADLAALGAAGRLADGHDAACR
IADQIVRAMRTTLGECAVDGLDVVVRVDAGVSLGGPLVGSASASARAGPA
DGSG
315446279YP_004079158.1 serine/threonine protein kinase [Mycobacterium gilvum Spyr1]MTAEMLAGRYELRGLLGRGGMAEVRDGWDTRLDRSVAVKLLYPSQSSDDS
VRRRFEDEARSAARLSHPNIVAIHDFGEHDSAPFIVMERLPGRTLADVIE
QGPMPAPQVRRVLDEVLAALSVAHAAGVLHRDIKPANILLTTAGDSVKVA
DFGIAKSAGAAHTATGQIVGTLCYLSPERVMGAPASVADDLYAVGVMGYE
ALLGRRAFPQDNPAALARAIIDVPPPPLRALSVTADPALVAVIDRAMSRD
PRLRFGSAPQMRAALAGDPLALNNAPPPVPPPRAGTRVLAHPLPPSAGFT
SAPVGYPTAAPPPPTRARMYLMAVAAVLAFTVAALALALDPFSSPPPMQT
VGTSTTAPPPPTSVPPPTSAAPLPPPIVPVTQAPPPDNGPKKGPDKKGEK
GNNGRGNGNKPD
315446278YP_004079157.1 hypothetical protein Mspyr1_47820 [Mycobacterium gilvum Spyr1]MTHDWMLVETLGTEPVVVAHGDHTKDLIPIGTFLRRNPHLMAIQTAIAET
VRAATGLTSITPKNDRVIRTEVVQMSDGRIHGVQLWLGAPDETAPERPLV
GPLLWDLEAGTATDTTESLQVGGWDPARQARRGRAFADDLPRRDLNPNET
EVISMVIRPEPGTTICNTWDVTDYRGEAITVGFVARSLPEVGDDGRERLI
CRAMNWRSVREGAGIQHDVLAQRILDGLAVPGVHRALVDPKHWTLLKWLD
DPVPFFNWRAGGLRSDVVHPQDMPELDAMATEFADGATARVLRLAGNQGG
WVPVHVTINRVPLGKGIDAGLATLRLPTPAELADARLDEPAPAVRNSRKL
FSHKGTETRT
315446277YP_004079156.1 helicase family protein with metal-binding cysteine cluster [MycobaMTEPVPEFGRELLACAVEGTAADEHPLRHVADLPPRRATSHPWPPWADPD
VVQAFHDQGIRSLWSHQLAAADLAHDGRHVVLSTGTASGKSLAYQLPIAT
ELKRNPRSRVLYLSPTKALGHDQLRAAAALTASVPGLDDVAPTPYDGDSP
SEVRRFARERSRWIFSNPDMIHLSLLRNHARWAVFLRNLRFVVVDECHYY
RGIFGSNVAMVLRRLLRLCARYAPAGDVSGPTVVFASATTAQPAVTASEL
IGQTVAEVTEDGSPQGTRTIALWEPALIPDLLGENGAPVRRSAGAEAARV
MADLIAEGARTLTFVRSRRGAELAALGARTRLADTAPDLADQVASYRAGY
LAEDRRRLERALADGELRGMATTNALELGVDIAGLDAVVLAGFPGTVASF
WQQAGRAGRRGQGALVVLIARDDPLDTYLVHHPAALLDKPIERVVIDPAN
PYVLGPQLLCAATELPLTEAEVRMWDAESVAAGLVDDGLLRRRPSGFFPA
PGLDPHPAVDIRGSTGGQIAILEDGTGRMLGSTGAGQAPASVHPGAVYLH
QGESYVVDSLDFEDGIAFVHAEDPGYTTFAREVTDISVTGAGERSGHGPV
TVGLVPVSVTNTVTGYLRRRLDGEVIDFVELDMPTRTLNTMAAMCTITPE
ALQDVGIDPLRIPGALHAAEHAAIGLLPLMASCDRGDIGGVSTAVGPVDG
LPTIFVYDGYPGGAGFAARGFRTLARWWEATASAIEACECPSGCPSCVQS
PKCGNGNDPLDKDGAIRVLRLVIGALEHRHR
315446276YP_004079155.1 cold-shock DNA-binding protein family [Mycobacterium gilvum Spyr1]MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EVGQSPKGPQATGVRAV
315446275YP_004079154.1 hypothetical protein Mspyr1_47790 [Mycobacterium gilvum Spyr1]MSQLSFFSAESVPPAIADLTGILAGPGQVVLRGGAEGQAARLSVVVEARW
RADALAEMIADVGLEPEITRTDEGHPLVRTAADVRLVAIAVDWTRGAVKT
VPPQWLPGPRELRAWTLAAGTPEADRYLLGLDPHAPDTHPALASAMMRVG
IAPTLIGTRGSRPALRISGRRRLSRLVENVGEPPAAVEALAQWPRIEPV
315446274YP_004079153.1 DNA topoisomerase I [Mycobacterium gilvum Spyr1]MADGDRGSGKNGSVRRLVIVESPTKARKIAGYLGSNYVVESSRGHIRDLP
RAAADVPAKYKSEPWARLGVNVDADFEPLYIISPDKKATVADLKDKLKNV
DELYLATDGDREGEAIAWHLLETLKPRIPVKRMVFHEITEPAIRAAAEDP
RDLDNDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRII
VQRERERMAFRSAGYWDVTAELDASVSDAQATPPTFVAKLNTVDGRRVAA
GRDFDSLGAVKKPGEVLVLDEAAANALAGGLRGAQLSVSSVEQKPYTRRP
YAPFMTSTLQQEAGRKLRMSSERTMSIAQRLYENGYITYMRTDSTTLSQS
AIDAARNQARQLYGEEYVHPTPRQYTRKVKNAQEAHEAIRPAGDVFQTPG
QLHSQLDTDEFRLYELIWQRTVASQMADARGTTLSLRIAGQARTGEQVVF
NASGRTITFAGFLKAYVESLDEQAGGEADDAESRLPNLTQGQRVDAKDLT
ADGHTTSPPARYTEASLIKALEDLGIGRPSTYSSIIKTIQDRGYVHKKGS
ALVPSWVAFAVIGLLEQHFSRLVDYDFTAAMEDELDEIAAGNERRTNWLN
NFYFGGEHGVEGSIAREGGLKKLVGGNLEEIDAREVNSIKLFDDSEGRAV
NVRVGRNGAYLERMVADPDNPGELKPQRANLKDELTPDELTLELAEKLFA
TPQEGRSLGIDPATGHEIVAKDGRYGPYVTEVLPEPPDDGEAGATAKKGK
KPTGPKPRTGSLLRSMDLETVTLDDALRLLSLPRVVGVDPANGEEITAQN
GRYGPYLKRGTDSRSLATEEQMFDITLEEALKIYSEPKRRGRQGAATPPL
RELGVDPVSEKPMVIKDGRFGPYVTDGETNASLRKGDDVMSITDARASEL
LADRRARGPVKKKAAKKAAVKKTAVKKAAKKAPAKKAAKKA
315446273YP_004079152.1 family 3 adenylate cyclase [Mycobacterium gilvum Spyr1]MAADPTETGRISAFVRWVARTPWPVFTLGMLQADIIGALLVLGFLRFGLP
PEDRIQLQDLPAYNLAIFLGYLFVSFTVASYLTLRMLIPVMRWQRRDMLL
GDRDPSDTEVARMRALKMPFYRSLISATNWLLGSVVFIVASWPVASKSAP
VVAVATGLGATATAIIGYLQSERVLRPVAVAALRGGVPENFRAPGVILRQ
VLTWVLSTGVPVLAIVLALVASKFEVLTAPADRLITTILLLAIVALIIGL
SSTVLVAMSIADPLRQLRWALGEVQRGNYNAHMQIYDASELGLLQAGFND
MVRDLAERQRLRDLFGRYVGEDVARRALERGTELGGQERDVAVLFVDLVG
STHLAATIPASEVVSLLNEFFRVVVDTVNRHGGFVNKFQGDAALAIFGAP
IEHPDASGAALAASRELHDELINVLGETEFGIGVSAGRAIAGHIGAQARF
EYTVIGDPVNEAARLTELAKLEPGHVLASSLAVADALDAEALCWNVGEVV
ELRGRTAPTQLARPVNLIRPPRVEEKVADDVPSTTR
315446272YP_004079151.1 DNA polymerase III subunit delta' [Mycobacterium gilvum Spyr1]MAGVFSRLVGQDTVEAELIAAARAARGDSVHDDDPAETGTMTHAWLITGP
PGSGRSIAALCFAAALQCTSEGRPGCGECRACTTTMAGTHADVRRIIPEG
LSIGVDAMRAIVQIASRRPGTGRWQIVVVEDADRLTEGAANALLKVVEEP
PPSTVFLLCAPSVDPEDIAITLRSRCRHVALVTPPADAIAQVLIADGLSP
DEARWAASVSGGHVGRARRLATDDEARERRKRALGLARDAATPSRAYAAA
EELVATAEAEAKALTGDRNEAESEELRTALGAGGTGKGTAGTMRGAAGAL
KELEKRQKSRQTRASRDALDRALIDLATYFRDALLVSAGATDVVANHPDM
ADKVAALAAHAPPDKLLRCIEAVLECREALAVNVKPKFAVDAMVGTVGQA
LRS
315446271YP_004079150.1 peptidoglycan transpeptidase - ErfK-YbiS-YhnG family [MycobacteriumMRVAVRSALVVGILAANMVVPPWEVRELASWTPQLRIGSLLPAEGATVGV
AHPVVITFDNAVVNRFATEQVMRIASDPPMTGTFEWVADNVAHWVPNEFW
PAHSTVKLTLGDLPTRTFEIGRAVVGIANLSDHTFTVTIDGVPPSELPAP
HHRPYWGLHGVFPASMGRPEYPTPVGVYSVLAKERDVTMDSSSVGIPTDA
PDGYLLDVDYAVRFTHRGLFVHSAPWAVNQMGNENGSHGCIGLSTEDAEW
YFNTVNVGDPIVVRENGVEVSQAVPR
315446270YP_004079149.1 hypothetical protein Mspyr1_47730 [Mycobacterium gilvum Spyr1]MAVFDRLSIRVAAVGAGLCGIALAVSPGVAHAGGAECLQTSAGQDPAATA
PCAPVAEMSGVPMALPGPVPPPMAPPPVVPPVVPPLAPPPVVPPVVPPLA
PPPVVPPIPAAGAAGGLPVASMGGLAGKGDLTGPAPSGAPVPGQPIPPGP
TGGN
315446269YP_004079148.1 SCP-like extracellular protein [Mycobacterium gilvum Spyr1]MKLKIAGVFALSTVVVAAVGTSADFTAEADVAAGLHAGVNQLRQSCGAIR
QDPRLTAAAQRHADDMLRNTNHSHVGSDGSSPQARMTDAGYRGDASTGEI
VFWATGSAATADAALAFWMGSPGHRAIIVNCAFAAAGFATASDGNRMTAV
GDFAGP
315446268YP_004079147.1 hypothetical protein Mspyr1_47710 [Mycobacterium gilvum Spyr1]MRFTVARAAGALIALHLVVRAVLAFGGYFYWDDLILVGRAGTQGLLSPGY
LFDDHDGHVMPGAFLVAGAITRMAPLDWAGPAVSLVVLAVVASLALLRAL
YVILGWRPVLLVPLTFALFTPLALPSFAWWAAGLNALPMLAAMAWVCADA
ILLLRTGNQRYALSGALVFLGGLLFFEKAAIIPFVAFTVTALYGHVTATA
GVSQVWRRGARLWTATLALTAGWVGVYLLVVDQQRWSFDLSMTWDLLRRS
FTHGIVPGLVGGPWDWQRWAPASPWATPPVIVMVVGWVALAAVVVVTLLR
KRRLGPVWLAALGYAVACQVPIYLMRSSRFTALELAQTLRYLPDLVLVLA
LLAAVGLCAPNRERSRWLDRSPWRTLAIACCTALFVMSSLYSTATFLTSW
RDNPAQPYLQNARSGLAQAHAGSDAPMLDQEVDPLVLQRVAWPENLASHM
FALLPERPEFASTTTDLRTLDSTGRLTDAQVTWVRSIRPGPEQGCGYLVQ
PDQPVRMPLDGPLLPADWTVEINYLGNSDGSMTLSLSEGEEVRVPVEPGL
NRVFVRLPGAGDAITASANTAALSVCIAAGPVGFVAPAP
315446267YP_004079146.1 UDP-galactose 4-epimerase [Mycobacterium gilvum Spyr1]MSWLITGGAGYIGSHVARAMLEAGRDVVVIDDLSSGFESFVPDGAAFVKG
TLLDAALVDDTLTRFDVDGVIHIAGYKYAGESVKRPLHTYEQNVSTTVIL
LQAMETRGVGQIVFSSSAATFGTPDVDIVDESTPTTPESPYGETKLIGEW
LLRDAGRASGLRHTSLRYFNVVGSGAVELFDASPHNLFPLVFDMLFRGET
PRINGDDYPTPDGTCVRDYIHVSDLALAHVAAAQRLAAGEPVEPVYNLGS
GAGTSVREIMTAMRTVTGVDFEPVVMPRRPGDPARIVAAGDLAARDLGWS
NRHSLEEMVASAWRARQHAGDAYPR
315446266YP_004079145.1 hypothetical protein Mspyr1_47690 [Mycobacterium gilvum Spyr1]MTDATAGPSGAVSRASVVRVGVATALSALCGYAVLYLAARDLEPAGFSVF
GVFWGAFGLVSGAAFGLLQETTREVRHPSAGTAHRHTRPLAVAAAVGVAA
AAAIGVSAPLWSAHVFVDARMLSVALLCAGLAGFCVHTTLLGALAGMGRW
SDYGALMVTDAALRVVVAAAGFAAGWGLGGYLWATVAGAFSWLLMLLVSP
ATRAAARVQTTGGTATFLRGAGHSMAAAGASAVLVMGFPVLLAATSGDLG
ATGGVVILAVTLTRAPLLVPLTAMQGNLIAYFIDQRAHRLRALLAPSALV
AALGAGGVVLAAVFGPWLLREAFGAQYRADGALLAWLTVAAVAIALLTLT
GAATVAAALHRAYAAGWVIATAAAALLLMLPLDLEIRAVVALLCGPLLGI
AVHLSALARDRDGVAPTYAAIDD
315446265YP_004079144.1 aminopeptidase N [Mycobacterium gilvum Spyr1]MSKKNSSPVIDPYLPEAGNFGYRVSRYELDLEYKTAINRLSGSAAITAVT
LAEIKTFTLDLADALSVSKVSVNGKRPAHYRTAAGKLHITLAERLPAGAA
MTVGIRYSGNPRPNRTPWGDVGFEELTEGVLVAGQPNGASSWFPCDDHPA
AKASFRVQIATESPYFALANGKLLSRRPRAGMTTWVYEQSEPTSTYLITL
QIGVYSRHRLAKNGVEIFAVLPDRLRREFAHDFGRQPQMMKLFTKLFGPY
PLATGYTVVVTDDDLEIPLEAQGISIFGANHCDGSRKAERLIAHELAHQW
FGNSVTVQRWRHIWLHEGFACYAEWLWSEHCGERTAQQWAEHYHHRLRHS
PHDLVLADPGPRDMFDDRVYKRGALTLHVLRQRIGDANFFALLKDWTTRY
RHSSVVTDDFLGLASQYSDESLRSLWAAWLYSTEVPALDAGS
315446264YP_004079143.1 amino acid adenylation enzyme/thioester reductase family protein [MMDRTPEIPSQFLLSAYAPQPRTLIDILAETARRFPDAPALDDGTVQLTYA
ELLSDVEDSVAWLGARGIGRGDRIGIRMPSGSYALYVAILATLAAGAAYV
PVDADDPQERADLVFTEAGVVAIITERGLVRGPGASRGWRAAAPLSRDDA
WIIFTSGSTGTPKGVAVSHRNAAAFVDAEAKMFLQNNPLGPGDRVLAGLS
VAFDASCEEMWLAWRHGACLVPAPRSLVRSGMDLGPWLVSRDITVVSTVP
TLAALWPAEALESVRLLIFGGEACPPELAERLAAGPDSAGREVWNTYGPT
EATVVACAARLDGGSGGQERSDQGNRTAAVSIGLPLPGWDLAVVDKAGEP
VAVGEVGELIIGGVGLARYLDQDKDAEKYAPFPTLAWSRAYRSGDLVRLE
TDGLYFVGRADDQVKVGGRRIELGEVDNALMNLPGVTGAAAAVRRTASST
PLLVGYLAVAPGLETPFDISRARAQLSEALPAALIPRLVVVDELPTRTSG
KVDRDALPWPVDSAEKDTADGSDLGGGTLGWLAGVWRDVLAAPIDGPEAD
FHALGGGSLSAAQLVAALRQRYPQVTVADLYDHPRLGSLAGYLDELDPPA
AVETRTVTPVSRLTQAVQVALTVPLAVLTGLQWVVWLAVANNIAAEFSLV
DWVSPVNWWWVLAGFLVFVTPPGRMSIAVFGARVLVGNLQPGTYARGGSV
HLRVWLAERLADASGAENMAGAPWLVYYARALGNRVGSGVDLHSAPPVTG
MLTLGHRCSIEPEVDLTGHWIDGDLFHVGPITVGNDATVGARTTLLPGAV
VGKNADVAPGSGVIGKVKNGQYWKGSPAVKSGKAKHPWPDHRPPRAPVWV
AMYGITSMLLAALPLTALAAGLAVIGWGVRGTSTVTSAIVPALLWAVPAT
AAAVLVYATLTVIGVRLLAIGLTEGYHPVRSRPGWQLWATERLMDSARTY
LFPVYAGLLTPWWLRLLGATVGKGTEISTALLIPKFTVIEDGAFLADDTM
VASYELGGGWIHVARATVGKRAFLGNSGITQPGRRVPDDGLVAVLSATPR
KAKAGSSWLGSPPVRLRRRPTAADALRTFHPSVRLKMLRATVEMFRFVPV
VVTFTLGIAVLFAIQAAAVHVGWPWAALAAGPVLLTAGAVAGAIAVIAKW
LVIGRITAIEHPLWSSFVWRNEVADTFVETVAAPWFARAASGTPVMNLWL
RGLGATIGRGVWCETYWLPEADLVTLDDGATVNRGCVVQTHLFHDRIMRM
DTVVLEAGATLGPHCVALPAARIGAGATVGPASLVMRGDEVPPSTRWQGN
PIAVWNPPRKKRESDPKPKKSAAA
315446263YP_004079142.1 hypothetical protein Mspyr1_47660 [Mycobacterium gilvum Spyr1]MNVSGLEWGITLAVTIGILLFDVLVIGRRPHEPSKRETGTALTIYIALAI
AFGVWTWTFHGSEYGVEFFAGWLTEYSLSVDNLFIFLIIMASFKVPRIYQ
QQALLVGIILALIFRGIFIALGAVAIEQFSWVFYLFGAFLLYTAIKLVKD
TDHDDDGDNAVVRFAQKRMKFTDTWDGLRLWVHENGQRLMTPMFLVIVAL
GTTDLLFALDSIPAIYGLTQEPYLVFTANVFALMGLRQLYFLLGDLLKRL
VYLSQGLAFILFFIGVKLVLHALHENEVPFINGGENVPVPEIPTLLSLGV
IIVTLLITTVASLYKTRVHDVRKNGTSEGSEGPDAVDDTETPHGDRAR
315446262YP_004079141.1 hypothetical protein Mspyr1_47650 [Mycobacterium gilvum Spyr1]MSELTDNQRGDQQIVRVAAPDLQKARKVCARIREDARDVAVILDVTVSVA
GDFRAAQRVRGPATDTDADTVHYVGTLDGLANLISDIASAGVADGVTLIP
ASPRQDVETVGRDILGRLTGRDQPRAS
315446261YP_004079140.1 hypothetical protein Mspyr1_47640 [Mycobacterium gilvum Spyr1]MLLHQGIGLDAFNAMPMRRAVHAVFECCYSVPLAADLCRARPFADHEQLF
EFADDLLFGLSEESIDSILQAYPDVGRRPGSEKSQAEQCAIVDERPEMMA
DLAAASAAYLDHFGFGFVMFVNGYRADEVLSTMRDRMHHDRDTERKIVRN
ELARINRTRLARMLGPEGGYDNW
315446260YP_004079139.1 inorganic pyrophosphatase [Mycobacterium gilvum Spyr1]MQFDVLIEIQKGSRNKYEVDHESGKVKLDRYLFTSFGYPTDYGYIEDTLG
EDGDPLDALVLLPEPVFPGCIVEARPVGMFRMEDEKGGDDKVLCVLADPR
WDHIQDIGDVSDFELDAIKHFFVHYKDLEPGKFVKAADWVGREEAEAEIN
RSIERFKTEGH
315446259YP_004079138.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium gilvum Spyr1]MRPTGWRRSTYVVVGAVVALLVVVLVAAAALVAGRESDENVAVDPVPAPA
TADPGVIAVSDSADVPTERGLADALRGVAADPNLGRFTGRITDALTGKQL
WAQGADVPMQPASTNKLLTAAAALVTLDRDARLTTRVVSTSPGVIVLVAG
GDQTLSAAPAKEDTWYRDAARISDLADQVRRSGVDVRSVQVDVSFYTGPT
MAPGWDPLDIDGGDIAPMEAIMLDGGRTQPVSVESRRSRTPALDAGRALA
TALRLDPAKVTVLPPGRSAPDGDEIASVQSAPLMERLRQMMHASDNVMAE
SIGREVADARNRPRSFAGAAQAVEDALDDAGIDTSGARLLDSSGLSVDNR
LTAETLDEIIQAAAGESTPALRPLVDLLAIAGGSGTMSNRYHDTESGRAA
LGYLRAKTGSLTGTNTLAGIVTDESGRVLTFALLSNDAGPTGRTSLDAFA
ATLRSCGCR
315446258YP_004079137.1 hypothetical protein Mspyr1_47610 [Mycobacterium gilvum Spyr1]MTPKTHSDSGTSRFSVGHAVDWNLAATVGGKLARQEPKATDYTRRQTIEQ
LAQSARDSEIPVREVTGLIEGGEIPEARIVNRPDWIRAATQSMRAMTGGT
HDRDVKPRMITGRIAGAQTGAVLAFVSSGILGQYDPFSGDGELLLVYPNV
IAVERQLRVVPGDFRMWVCLHEVTHRVQFRANPWLAEHMSGALAVLTEDG
GEDLTKMVGRLADYVRDHQVVVKNGEPELNSTGIIGLLRAVQSEPQRQAL
DRLLVLGTLLEGHAEHVMDAVGPAVVPSVATIRARFDQRRQRKQPPLQRL
LRILLGVDAKMSQYTKGKAFVDEVVGKVGMERFNAIWTDADTLPQPREID
EPQRWIDRVL
315446257YP_004079136.1 tRNA(Ile)-lysidine synthetase [Mycobacterium gilvum Spyr1]MDRSGPVVELRTALVDFARTHRVAPPWCVALSGGPDSLALTAVAATLHPT
TALIVDHRLQPGSADVAAAAREQALALGCVAAQVLPVDVGSPGGPEAAAR
TARYRALDDARDGKPVLLGHTLDDQAETVLLGLGRGSGPRSIAGMRPYDL
PWGRPLLGVRRDTTHRACAELGLNPWQDPHNLDPRYTRVRLRTEVLPLLE
DVLGGGVAEALARTAAALREDTDVLDALAAEAVAPGDADLDVTALADLPA
ALRRRAVRGWLLAAGARDLTDKHLRAVDALITDWHGQGGVAVPGGLTRER
LFVARNRNRLGMYREPVAQRQG
315446256YP_004079135.1 hypoxanthine phosphoribosyltransferase [Mycobacterium gilvum Spyr1]MPAHTADLYSGDIKSVLLSEDQIRAKTAELAALIADDYQDRESGQDLLLI
TVLKGAVMFVTDLARAIPLPTQLEFMAVSSYGSSTSSSGVVRILKDLDRD
INGRDVLIVEDIIDSGLTLSWLLRNLATRGPKSLRVCTLLRKPEAVRAEL
DVEYIGFDIPNEFVVGYGLDYAERYRDLPYIGTLDPKVYEP
315446255YP_004079134.1 anaerobic dehydrogenase- typically selenocysteine-containing [MycobMADTALRICPFCEATCGLTLTIDDGRVVGARGDRDDVFSAGFLCPKGASF
AELDNDPDRLSAPLVRRDGVLREATWDEAFAAMADGLSGAIREHGGASVG
VYLGNPNAHTVAGSLYPPLIVRGLGTRHVFSASTLDQMPKHVSLGLMFGS
PVAFTVPDLDRTNYLVIIGANPLVSNGSLATAADFPGKLRRLRKRGGRLV
VIDPARTRTAELADRHLAPRPGTDAALLFAIVHVLFDENLVDLGSVQDFV
NGLDEVRDLAAAFDPDTVAAYCGIDAEQIRTLARELAAAPTAAVYGRIGT
STVEFGTLGSWLIDVVNTLTGNLDRPGGAMFPMSPTAPAPRGHRPGRGFS
IGRWHSRVSGYPEVLSELPTPALAEEIETPGDGQIKAMITIAGNPVLSAP
DGDRLDRALAGVGFMLSVDPYLNETTRHADVILPPPPPSRAPHFDVALNA
LAVRNNARYSPPALPLDGRPDEAQILSRIALVLYGLGHDADPALVDDQVI
TTTLSKETADATSPVAGRTVDELIAMLPDGPGYERRLDMMLRVGAYGDAF
GARPDGLTLAKLKDAPHGIDLGPLQPRLPDLLRTPSGRIELAPPQLISDV
ARLRDALGRRGGGFVLIGRRHLRSNNSWMHNLPALTGGTNRCTLQIHPDD
AADLGLTDTAIVKGPGGELVVPVEVTDDIRRGVLSLPHGWGHDRDGTGQK
LAARAPGVNANQLNDGSLLDPLSGTAVLNGIPVVVGPAS
315446254YP_004079133.1 hypothetical protein Mspyr1_47570 [Mycobacterium gilvum Spyr1]MPIPAHAKTVRNSFIAAAVAALTVAGSTACDARSTAPAPGTDSRQVTVVG
AGEVQGTPDTLTVNASMEFLGPDATAAMNQTDERQQAVIDGLVGLGIDRA
DIATTAADLQPQYGSNGTAIAAYRATNTVNVTIRDLAQASDAISLVVNTG
GDAARINSIAYSIEDDSELVRDARARAFEDAKDRAGQYAELSGLSLGKVI
SIAESGGAPPPVPMQAPRAMEAAVPMEPGQQMVGFSVTVVWELT
315446253YP_004079132.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMQSRMVHTNGITLRVFEAGERSAPVVVLCHGFPELAFTWRHQISALAAAG
FHVLAPDQRGYGGSDKPGDAGVYNVAELTADVVGLLDDVGAERAALVGHD
FGAVVAWGAPLLEPDRFSAVAGLSLPPVPRPQVPTTQAFRRVFGDRFMYI
LYFQEPGPADAELARDPATTFRRLFALTTGGAEMVGDAGPQGFLDRIPEP
GGLPDWISQADFDVYVDEFTRGGFTGPLNWYRCFDRNWELTAETPAPTIE
VPALFVGGTEDATLAYTPRDRVREVVTGDYREVMIDGAGHWLTEERPDEV
SRVLVDFLTTVR
315446252YP_004079131.1 membrane protease FtsH catalytic subunit [Mycobacterium gilvum SpyrMNRKNVIRTLTVIAVVLLLGWSFFYFSDDTRGYKPVDTTIAIAQINGDNV
NSAQIDDREQQLRLELKNGNGDTENSTQILTKYPTGYGATLFESLQDKNI
KTNTVVNQSSIFGTLLIYMLPLLLLVALFVLFSRMQSGGRMGFGFGKSKA
KMLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQ
AKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRQ
GVILIAATNRPDILDPALLRPGRFDRQIPVSSPDLAGRRAVLKVHSQGKP
IAEDADLEGLAKRTVGMSGADLANVINEAALLTARENGTIITGPALEEAV
DRVVGGPRRKSRIISEHEKKITAYHEGGHTLAAWAMPDIEPIYKVTILAR
GRTGGHAMAVPEDDKGLMTRSEMIARLVFAMGGRAAEELVFREPTTGASS
DIDQATKIARAMVTEYGMSSKLGAVRYGSEHGDPFLGRTMGNQADYSHEV
AQIIDDEIRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRVELEA
IFGDVKKRPRLTMFDDFGGRVPSDKPPIKTPGELAIERGEPWPKPVPEPA
FKTAIAQASRAAAEAAPKNGGNGANGAHAPGPDYGAPAGWHAPGWPPPPG
GPQQQQPPQQQGYWYPGPPQQQGWQGNAPTPAYPGYPPYQPYPQPGQHAP
HGGAPAPNPTDDPGQDRGRENGHRDTERRDTDPHGPANG
315446251YP_004079130.1 GTP cyclohydrolase I [Mycobacterium gilvum Spyr1]MTRSHNHSATLTTPDFDQARAEAAVRELLIAVGEDPDREGLRDTPARVAR
SYREIFAGLYTDPDEVLTTMFDEQHDEMVLVKDIPMYSTCEHHLVSFHGV
AHVGYIPGVDGRVTGLSKLARVVDLYAKRPQVQERLTAQIADALMRKLDP
RGAIVVIEAEHLCMAMRGIRKPGAVTTTSAVRGQFKTDKASRAEALDLIL
RK
315446250YP_004079129.1 dihydropteroate synthase [Mycobacterium gilvum Spyr1]MTCAVQVMGVVNVTDDSFSDGGLFLDRDRAVAHGVELVAQGAAIIDVGGE
STRPGATRVDPEVEISRILPVVKELAQQGITVSIDTMHAAVAHAALDSGA
KIVNDVSGGRADPDMVRVVADAGVPWILMHWRSVDGDNPHEVPAYGDVVA
EVRDELLSGVDAAVAAGVHPDKLIIDPGLGFAKTGQHNWALLHALPDFVS
TGIPVLVGASRKRFLGTLLAAPDGEPRPPAGRETATAVISALAGWHDVWG
VRVHDVRASVDALAVVAAWRGGAS
315446249YP_004079128.1 dihydroneopterin aldolase [Mycobacterium gilvum Spyr1]MTDRIELRGLTVRGNHGVFDHERRDGQDFVVDITVWIDLSAAAASDDLAD
TLDYGVLAQRAADIVAGPPRQLIEAVAGEIADDVMRDERAHAVEVVVHKP
SAPIPLQFNDVAVTARRSRRNAR
315446248YP_004079127.1 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinaseMTSVVLSIGSNLGDRLAHLQSVLDALGPAVTGVSPVYETDAWGGVEQSPF
LNAVVLAEDPALDAHGWLRRAHELEDACGRTREQHWGPRTLDVDLVSCRD
GDAEIVMDDPDLTLPHPYAHVRAFVLVPWSAVDASAASAASAVSAHLAAL
DPAERAGVRLTELVLRPRSAG
315446247YP_004079126.1 hypothetical protein Mspyr1_47500 [Mycobacterium gilvum Spyr1]MGLTRKRDLAAAVAAAAIAGYLLMYVVYRVFPPITVWTGMSLLGVAVALA
GWAFLVRARIRDGRIGVGAGRLHPLAVARSVVIAKASAWMGSVVLGWWLA
VVIYLLPRRGSLRVAAEDTAGAVIAALCALALVVAALWLQYCCTSPDDSA
PEADPAPG
315446246YP_004079125.1 hypothetical protein Mspyr1_47490 [Mycobacterium gilvum Spyr1]MTVLLVLAIAASSALVFTSRVELLRLAVILALWAAVVAAFVSVIYRRQSD
SDQAKVRDLKLVYDLQLEREISARREYELSVESHLRRELASELQAQSSDE
VASLRAELAALRANLEYLFDADLSHRPALETERTAGRVTSSRIDTEDDVV
AAAEEPDAPETEESPIIDVPAEPHPPEHEWAAAVDEHGGAHRRSGEQETA
RRHRADAAAQPQWAPPPPPQQHPQQPPQPPQMPPPPMPPPPQPPPPQTPP
PGPQFPWLPPQQAPPQQAPAQSSQWQPVPAEGQYIPAGAPGSNWVAPPAE
DGHDEYVGRRRAPEQPSEDRRPPRGRHSAAGEQPQEPAVPDEEPEQPDES
DADGGAHTGGQSVAELLARLQATPSGGGGRRRRED
315446245YP_004079124.1 hypothetical protein Mspyr1_47480 [Mycobacterium gilvum Spyr1]MVQPSAGGNSPHDGLRPARLTIGVISAGRVGTALGVALERAEHVVVGCAA
VSSASRARAARWLPDTPVLPVDEVARRAELLLLAVPDAELSALVSGLATA
GAVRPNTIVVHTSGANGIGVLAPLAALGCITLAIHPAMTFAGTDEDVDRL
RGTCFGITAGDEIGYAIAQSLVLEVGGEPFRVREDARTLYHAALAHSSNH
LVTVLLDAVDALRAALWGQELLGQELVGDAPGGIAERIVGPLARAALENA
LQRGQAALTGPVARGDAAAVAAHLQALAEVNPDLAQAYRADSWRTAQRAH
APAAVFDVLTETGQ
315446244YP_004079123.1 pantothenate synthetase [Mycobacterium gilvum Spyr1]MGMGGAPKFVAGQLNLYHRPTDVSAVTRALRATGRRIILVPTMGALHDGH
LSLVRAAKRASGAVVVVSIFVNPLQFGAGEDLDAYPRTLDEDLALLREEG
VEVVFAPTANDMYPNGMRTTVHPGPIGAELEGAVRPTHFAGMLTVVLKLF
NIIAPDRAYFGEKDYQQLALIRQMVSDLDLDIQIQGVPTVREADGLAMSS
RNRFLAAEEREQAGALSAALLAGMYAASAGVAGALDAARAVLDEVPTLQL
DYLEIRNPMLGPPPAEGPGRILVAARLGRTRLIDNIAIDIGASAGIDGHP
RTAHGKSSEIPWRN
315446243YP_004079122.1 L-aspartate 1-decarboxylase [Mycobacterium gilvum Spyr1]MLRTMLKSKIHRATVTQADLHYVGSVTVDADLMDAADLLEGEQVTIVDVD
NGARLVTYVITGERGSGIIGINGAAAHLIHPGDLVILIAYGMLDDAAART
YEPRVVFVDADNRVLDLGADPAFVPDTAELLSPR
315446242YP_004079121.1 pantothenate kinase [Mycobacterium gilvum Spyr1]MLLAIDVRNTHTVVGLISGSGSHGKVEHHWRIRTESEVTADELALTIDGL
IGDDAELLTGAAGLSTVPSVLHEVRVMLEQYWPSVPHVLIEPGVRTGIPL
LVDNPKEVGADRIVNCLAAYQKYGSAAIVVDFGSSICVDVVSAKGEFLGG
AIAPGVQVSSDAAAARSAALRRVELTRPRSVVGKNTVECMQAGAVFGFAA
LVDGLVNRIREDVDGFGGDDVTVVATGHSAPLVLEDLSTVQHYDRHLTLD
GLRLVFERNRDNQRKLKQAR
315446241YP_004079120.1 amino acid aldolase or racemase [Mycobacterium gilvum Spyr1]MTAPGIAPIDDIVFDAAVRDLRDRPLDWRFKGVPADWWGRTEAQIIAAGS
AVPVGGGAGPQCVLRDDALTHNVDTMARWCAARGMELAPHGKTHMSPQLA
ERQLAGGACAITVATVAQAAVYRAFGVRSLLLANELVDAAGLRWVSAELD
RDPDLRFVCWVDSVRGVELMTAALDGARRPIDVCVEVGIPGGRSGCRTPE
AADDVARAAAASPRLRLVGVAGYEAAVAQSLDDDALAVVTAHLAEVRATV
MRLAALFEDDDVVVTAGGSTYFDAVADALSDWPGGTRVRPILRSGCYLAH
DHGLYARTSPLTRGGSHGFRPALEIRAQVLSRPEPDLAIVGMGRRDVSFD
QGMPVPLDDVAGAVEKLNDQHAYLRVTSGDVEVGDWLRFGISHPCTTFDK
WRLIPVLDADDRVVDLVHTFF
315446240YP_004079119.1 lysyl-tRNA synthetase [Mycobacterium gilvum Spyr1]MTSPDSPDDIPEQFRIRQAKRERLLAEGREPYPVKVDRTHTLAELRQAYP
DLEPDTKTGLKVGVAGRVIFARNSGKLCFATLQEGDGAQLQVMISFAEVG
QESLDAWKADVDLGDIVFVHGEVISSRRGELSVLADSWQIVSKALRPLPV
AHKELNEETRVRQRYVDLIVRPEARTIARQRIAVVRAVRSALERRGFLEV
ETPMLQTLAGGAAARPFVTHSNALDADLYLRIAPELFLKRCVVGGFDRVF
ELNRNFRNEGADSTHSPEFAMLETYQAYGTYDDSATVTRELIQEVADEAI
GTRQVPLADGTEYDLDGEWQSLQMYPSLSEALGEEITPATPAEKLWQIAD
RLGVEIPRDRGYGHGKLVEELWEFTVGDTLWAPTFVRDFPVETTPLTRPH
RSIEGVTEKWDLYVRKFELATGYSELIDPIIQRERFEAQARAAAAGDDEA
MALDEDFLAALEYGMPPTTGTGMGIDRLLMALTGLSIRETVLFPIVRRHS
N
315446239YP_004079118.1 hypothetical protein Mspyr1_47420 [Mycobacterium gilvum Spyr1]MAKKVTVTLVDDFDGEGGADETVEFGLDGVSYEIDLSAKNAAKLRNDLKQ
WVEAGRRVGGRRRGRAVAGTGRGRAAIDREQSAAIREWARRNGHNVSTRG
RIPADVIDAFHAAT
315446238YP_004079117.1 chaperone ATPase [Mycobacterium gilvum Spyr1]MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYQGKET
AEAGTGGRGGEAGNPSTSLVLDQFGRNLTAAAMEGKLDPVIGREKEIERV
MQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGDVPETLKDKQLYTL
DLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG
AIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEP
TVAHTIEILKGLRDRYEAHHRVSITDGAIAAAATLADRYINDRFLPDKAI
DLIDEAGARMRIRRMTAPPDLREFDEKIADARREKESAIDAQDFEKAASL
RDKEKQLVAQRAEREKQWRSGDLDVVAEVDDEQIAEVLGNWTGIPVFKLT
EEETTRLLRMEDELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFI
FAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPG
YVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDG
QGRTVDFKNTVLIFTSNLGTSDISKAVGLGFTQGGGDNNYERMKQKVHDE
LKKHFRPEFLNRIDDIIVFHQLTQDEIIQMVDLMIGRVGNQLKAKDMAME
LTPKAKALLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEELGPGQLV
TVDVENWDGEGQGEDAVFTFSGARKPVEVAEPDLAQAGAGGAGPAAE
315446237YP_004079116.1 hypothetical protein Mspyr1_47390 [Mycobacterium gilvum Spyr1]MTSPHASRTPAGVIDLSATRAAVWLSLTAFFALVVLYFIGMDQGATSVFG
NSTYIHEFVHDARHLLGFPCH
315446236YP_004079115.1 hypothetical protein Mspyr1_47380 [Mycobacterium gilvum Spyr1]MEKQIIWRGLLAGAVAGVLAFVFARIFVEPQIELAIGYEEGIGAAHDALQ
HGHGGHGGHGHSHDGEGGITRAIQMNVGLGLGLLAFSVAIGALFSVVYAV
AYGRIGTVSARLTSLYVAGGMLLSLYIVPSLKYPASPPALSLDETIRQRT
LLYLATVVLSVALLVAAVYLGRRWAARLGAWNASVAAAGAYIAAVAVMML
VLPSINETPGPLRDDNGAIVYEGFPADLLYEFRLYALGTQVVVYATIGLV
FAAMISRLLGERKQSVPA
315446235YP_004079114.1 fructose-2-6-bisphosphatase [Mycobacterium gilvum Spyr1]MSEVVRLTFVSHGMTDAMAAGRFPTDEPVNPLGRRQIGELEPSALGPVDR
ALCGPESRTQQTAELLGLRPVVESALADLDCGRWRGSSLGEVSPEEMTIW
LTDPARAPHGGESVVDLVSRVGAWMDTLATERARVVAVTHPAVVRAAVLV
ALNAPAKSFWRIDVAPASRTVLHCRGHAWTLRV
315446234YP_004079113.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MRKVRTGSGAVAVQVVRKHRGQRTILAHVGSAHTDAQLGILLERARQIAA
EDQGVLDIEVPARTQSIDTIADWRAGTLSLSPGGPQGAPVPAGRTAATHS
RLLYDVLGTVYDWLGFDVVDDAVFRDLVIARIVEPTSKADAARVLADLGA
EAMSYRTIQRHLGKAKSNRYREQIAARCFTHAADRGGLSLLLYDVTTLYF
EAENEDDLRKVGYSKERRVDPQIVVGLLVDRSGFPLEIGCFEGNTAETTT
LIPVVTAFAERHDLGDTPMVIAADAGMLSATNLAALNDAGLGFIVGSRMT
KAPGDLESHFHWHGDVFTDGQIIDTVTPRHANSTVNDAAHRAEPIWDPDE
HTNAWRAIWAYSAKRARRDQKTVYAQEARARAVINGERAAKSTRFVKTAA
GDRILDEAALARAQSLVGLKGYVTNVPATIMPAGEVIAHYHELWRVERSF
RMSKSDLRARPMFHRTRDAIEAHLTIVVTALAVAHNIQERTGLAIANVVK
QLRATALGDDRHQRDHRDLPTPSPRGPTENPGQPQHPRTGALSQMS
315446233YP_004079112.1 beta-lactamase class A [Mycobacterium gilvum Spyr1]MVALLSVVALACGCAATRPAPADAAYGAPIQINTPQGLRAKQTMDMLNSD
WPIGEVGVRTLAAPDLVEHVGVTLDRIWWDRPFTLTNVDVGAGWATLDVQ
TSYGVAQTIRLRTDEQGLVDRFSVDLVPPEIDEWSDIDEQLTASGARYSY
QVAKVDDGRCVKVAGSNTDLSLPLASIFKLYVLLAVADAVKAGTLAWTDP
LTITEEAKAVGSSGFDELEPGATVTVREASQQMISASDNMATDLLIERLG
PGAIERALAEAGHHDPASMTPFPTMHELFSVGWGTPDLREQWKKASPEGR
AQLLQQTNSRPYEPDPKRTHMPASEYGAEWYGSAADICRLHAALQRSAVG
EAAPVKDILSFLPGIDLDRAEWPYIGAKAGNLPGDMTFSWYAVDRSGQPW
VVSLQSNWPEFRSQTAAAWLMSIARQTFDLIPLT
315446232YP_004079111.1 biosynthesis of extracellular polysaccharides protein [MycobacteriuMSDKTPVVKINAIEVPPDAGPELEKRFAHRAHAVDNQPGFLGFQLLRPVK
GENRYFVVTQWESDEAFQAWANGPAVEAHAGERKNPVATGASLLEFEVVL
NVAGTDTDA
315446231YP_004079110.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMRTDLLTARGGAGRPVVLVHGLMGRGTTWPRQLPWLIRHGRVYTYDAPWH
RGREVDDPHPICTERFVADLGEAVESLGEPAILVGHSMGGLHSWCLAAER
PELVTALVVEDMAPDFRGRTTGPWEPWVHALPVEFTSADQVYAEFGPVAG
QYFLEAFDRTATGWRLHGHPARWIEIAAEWGTRDYWSQWEAVTAPTLLIE
AGNSVTPPGQMRAMAQRSRGAEYLHVPGAGHLVHDDAPGKYRDAVEAFLS
SFA
315446230YP_004079109.1 hypothetical protein Mspyr1_47310 [Mycobacterium gilvum Spyr1]MSTALAFLILVSPFALATLLTWAAHRSGSLRMHLDQFRVSGPMTGRLFDH
RDSDSYRVQHDLDAIRTRFEEQPAWPGPAVSSERR
315446229YP_004079108.1 AraC family transcriptional regulator [Mycobacterium gilvum Spyr1]MAIKTVSTLVLDGLAVFEFGVVCEVFGIDRSADGVPNFDFKVCGPEPGEP
LRTSVGATITPDHGLDDLVGADLVAIPAIASRQGTYLPEALDAIRRAAES
GSIILTVCSGAFVAGAAGLLDGRPCTTHWMHADALAEMYPTAKVDRNVLF
VDDGNLITSAGTAAGIDACLHLVRREMGSEVTNKIARRMVVPPQRDGGQR
QYIDQPIPVKCSERFAPQLDWILANLDKPHTVTSLSRRAHMSGRTFARRF
VEETGRTPMQWITDQRVLYARRMLEETTLDIDRIAEQSGFGTATLLRHHF
RRLIGVTPSDYRKRFNAHAPEVAEIA
315446228YP_004079107.1 A/G-specific DNA glycosylase [Mycobacterium gilvum Spyr1]MIDPNELIRWYATAQRDLAWRRPGVSAWQILVSEFMLQQTPVARVEPIWL
DWVARWPTPSATAAASAADILRAWGKLGYPRRAKRLHECATVIATEHGDV
VPDDVDTLLTLPGVGTYTARAVACFAYRQRVPVVDTNVRRVVARAVHGLH
DAGPPSTRDLADVAALLPDDDTAPHFSIAVMELGATVCTARAPRCGVCPL
THCAWRSRGFPAGTGPARRVQRYAGTDRQVRGRLLDVLRDNASPVTRAEL
DVAWTTDPAQRDRALDSLLVDGLVEQTADGRFALAGEGDQT
315446227YP_004079106.1 carbonic anhydrase [Mycobacterium gilvum Spyr1]MTAMPNTNPLTAWKALREGNERFVAGKPQHPSQSTDHRASLAAAQKPTAV
VFGCGDSRVAAEILFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVSVLEVP
LVVVLGHDSCGAVKAALGALDDGEVPGGYVRDVVERVMPSILVGRRDGLS
RVDEFEARHVTETGKQLLSRSTAIAEAVNAGKLAIVGLTYHLADGKVDLR
DHIGDIGES
315446226YP_004079105.1 hypothetical protein Mspyr1_47270 [Mycobacterium gilvum Spyr1]MTWAYRVDVLDLEPHGPLPRQIYWRRRALAAGIAALVIAVVVAVITVVVL
NTRSTEQPAASESAAETGQAAPPPLPGENPDVKSPIQPPAQQAPPPTPTP
TAAVVPPPILKEGDDCPDSTLAVKGITNQPQFIVGDQPKFTMVVTNIGLV
ACQRDVGAAVLAAYVYTLDNQRLWSNLDCAPSNETLIKTFQPGEQVTTEV
TWTGMSSAPNCPLPRQPIGAGTYNLVVQLGNLRSAPVPFILAEAAAMPPP
VEGAPHLPVPGPAPVG
315446225YP_004079104.1 nucleic-acid-binding protein (contains the HHH domain) [MycobacteriMAVKSSAGRSTRTVVPMTRPTLRETIARLAPGTPLRDGLERILRGRTGAL
IVIGYDDSVETICDGGFSLDVRYAPTRLRELSKMDGAVVLSSDGSRILRA
NVQLVPDPSIPTEESGTRHRSAERTAIQTGYPVISVSHSMSIVTVYVAGE
RHVVPESATILSRANQTIDTLERYKTRLEEVSRQLSTAEIEDFVTLRDVM
TVVQRLEMVRRISLELDSDVVELGTDGRQLKLQLDELVGDNDVDRELIVR
DYHANPDPPTSAQVTATLEELDSLSDSELLDFTTLARVFGYPSTAEAQDS
AMSSRGYRAMAGIPRLQFAHVDLLVRNFGSLQGLLAASASDLQSVEGIGS
MWARHIREGLSQLAESTIADRLA
315446224YP_004079103.1 DNA repair protein RadA [Mycobacterium gilvum Spyr1]MARTNSKVRSQYRCSECHHTTAKWVGRCSDCGTWGTVDEVALTAVGGATR
RAVAPASPAVPISSIDPGTTRHFHTGISELDRVLGGGLVPGSVTLLAGDP
GVGKSTLLLEVAHRWASTGRRALYLSGEESAGQIRLRAERTGCSHDEVYL
AAESDLQTALGHIDAVRPSLVVVDSVQTMSTTEADGVTGGVTQVRAVTTA
LTMTAKTTGVAMLLVGHVTKDGAIAGPRSLEHLVDVVLHFEGDRASALRM
VRGVKNRFGAADEVGCFLLHDNGIECVSDPSGLFLDQRPKAVSGTAVTVT
LDGKRPMIGEVQALIGASASGSPRRAVSGIDSSRAAMITAVLEKRARLPV
GTNDIYLSTVGGMRLTDSSSDLAVALAIASAYTDLALPTTAIAIGEVGLA
GDLRRVTGMDKRLAEAARLGFTVAVVPSGAVGAHAGLKVLQADNIGSALQ
VLRRISQNDASQGRADD
315446223YP_004079102.1 hypothetical protein Mspyr1_47240 [Mycobacterium gilvum Spyr1]MNPFKRRSSVVAAISTCGLAASVLLGACSAGQVSQTATQEPAINGTSGLA
GAIALRNVHLAVTQTTDYIQPGTEVDLIFVAANTSADVADKLTGITSDVG
EVTLTGAGDVPVNGVLVVGTPDGQETALSSIEAADSAEAKVELSKPITNG
LTYDFTFSFEKAGEVTVAVPISAGEAPRRDDPAAGGGSAGHSGGGH
315446222YP_004079101.1 CarD family transcriptional regulator [Mycobacterium gilvum Spyr1]MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPA
DNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGD
VNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAENTDDAKA
STILDEVLAAAS
315446221YP_004079100.1 2-C-methyl-D-erythritol 2-4-cyclo diphosphate synthase [MycobacteriMSTFRVGLGTDVHPIEAGRPCRLLCLLFDEGDGCAGHSDGDVAAHALCDA
LLSAAGMGDIGEVFGTGLPQWRDVSGADMLRHVHTLLVEQGFQVGNAAVQ
VIGNRPKIGPRRAEAQRILSELLDAPVSVSATTTDGLGLTGRGEGLAAIA
TALVLAPADV
315446220YP_004079099.1 cysteinyl-tRNA synthetase [Mycobacterium gilvum Spyr1]MTDRPAAGMRLYDTLSGGVRDFAPLRPGHVSIYLCGATVQGLPHIGHVRS
GVAFDVLRRWLTAKGFDVAFIRNVTDIDDKILIKAADAGRPWWEWAATYE
RAFTAAYDALGVLPPSAEPRATGHITQMVELIDRLIERGHAYCADQEGNG
DVYFSVSTLPDYGKLSGHRIDDVHQGEGVATGKRDQRDFTLWKGAKPGEP
SWPTPWGRGRPGWHTECVAMCEAYLGAEFDIHAGGMDLVFPHHENEIAQA
EAAGDGFARFWLHNGWVTMGGEKMSKSLGNVLAIPAVLQRVRAAELRYYL
GSAHYRSMLEFSENALQDAARAYSGVEDFLHRVRVRVGAVVPGEWTPKFG
AALDDDLAVPAALAEVHAARAEGNRALDAGDHDAALTHAMSIRAMMGILG
ADPLDERWESRDETSAALAAVDVLVHAEVRRREDARARRDWAEADAIRDR
LKEAGIEVTDTGDGPQWSLLDGTDK
315446219YP_004079098.1 rRNA methylase [Mycobacterium gilvum Spyr1]MAGNSQRRGAVRKAGTKKGPQVGSGGVRRRGLEGRGATPPAHERPHHPAG
KRAAKAARQAQGRHKKTDDTEIVLGRNPVVECLRAGVPATALYVALGTDA
DERLTESVQMAADRGISILEVQRHDLDRMAANGLHQGIALQVPPYAYAHP
DDLLRDAKSDAAPALLVALDNISDPRNLGAIVRSVAAFGGHGVVLPQRRS
ASVTAVAWRTSAGAAARTPVARATNLNRTLKQYADAGLQVVGLDAGGDTT
IDEIDGLTPTIVVVGSEGKGLSRLVRENCDRIVSIPMAGPTESLNASVAA
GVVLAEIARQRRLS
315446218YP_004079097.1 Na+/H+ antiporter NhaD-like permease [Mycobacterium gilvum Spyr1]MALTLSVAALAAVLACALLRPRLQAIVAGLAAALVIVAGATTWRAAVGEI
SELAPVVAFLAAVLVLARLCDDEGLFRAAGTLMARATSGGQSRLLTTVFA
ISAAVTAILSLDATVILLTPVVLATARALAVPARPHAYATAHLANSASLL
LPVSNLTNLLAFSAAGLSFLHFAAAMTLPWIAAIVVEFLLLRWLFAKDLA
TEPQRAVSVEPLDVPKFTLAVVVLTLAGFAVTSLLGFSPAWAALAGALVL
GVRALADRRTTMSRIVVSLDIPFLIFVLCLGVVVDAVMRNGLESAMQQVI
PDGHGLLALLGIAAVAALLSNVVNNLPAVLVLLPLVAGSGPAAVLAVLIG
VNIGPNLTYVGSLANLLWRSVVRRDVKAGFGEFSRIGVVTTPLVLVAAVL
GLWTYVRLIGL
315446217YP_004079096.1 hypothetical protein Mspyr1_47180 [Mycobacterium gilvum Spyr1]MRCKPGRPDLDAYATYFDLPAATPASPVTVSWAGVTTLLINDGTSALMTD
GFFSRPGLLRVATRRPLASSDSRIDAALQRLGVTRLDGVTPVHTHFDHAM
DSAAVAGRTGARLIGGSSAAHIGRGHGLDRVEVVTSGDATAVGAFDVTLI
ESHHCPPDRFPGAITAPVAPRAPVSAYRCGEAWSTLVRHRGTGRGLLIVG
SAGFVPGALAGRHADVVYLGVGQLGLQPHDYLAAYWTETVRTVGARRVVL
IHWDDFFRPLDKPLRALPFVADNLDVSMRILARLAREDGVDLHLPTLWER
ADPWR
315446216YP_004079095.1 arabinose efflux permease family protein [Mycobacterium gilvum SpyrMVAIDRSIGETQRWAYPLLLVLSGVALGVSGLPAPLYGIYETNWHLSPLA
TTIVFAVYAVAALAAVLVSGRISDVVGRKPVLLGALVALLIGLGVFLIAD
SMAMLLLARAIHGVAVGSIVVAGAAALLDLRPDHGVRVGQLSGVAFNIGM
TIAIFGSALLAQYAPHPLRTPYAVVAVICLIVGVGVLALREPHTARTRGP
IRIARPAVPAEIRADFWFSALGAMASWSVLGVLLSLYPSLAAHHTHIDNL
VFGGAVVATTAFAAALAQLAATRVPARYAAIIGDAGMAAALLLTIPVLLT
HQWQLVFVAAALLGATFGLGFGGSLRHLSNVVPPARRGETMSAFYLLAYS
AMAVPTLVAGWAATRWELASVFPWFAGIVSAACLGAAVAGLRSIRVARAA
315446215YP_004079094.1 lactam utilization protein B-like protein [Mycobacterium gilvum SpyMSSVDLNADLGEGFGVWALGDDDAMLDIVTSANVACGFHAGDPATLRRVC
EAAAARGVRIGAQVSYRDLAGFGRRFIDVSSEDLIADVMYQIGALSALAA
AAGSSVSYVKPHGALYNAVVTNRLQAHALAAAVHAVDPALPVLGLAGSVF
FGAAEELGLRTVPEAFADRAYRPDGRLVSRRERNSVLHDVDEIAERVISM
VSRGRVHAVDGSTIPITVESVCVHGDSPGAVQIATAVRKRLVAEGVTLAS
FS
315446214YP_004079093.1 rhodanese-related sulfurtransferase [Mycobacterium gilvum Spyr1]MSRADVFVTATDLSRMIAEDRPVSVLDVRWRLDAPDGRQAYAQGHVPGAV
YVSLDDELSDHSVPDRGRHPLPSGVALQAAARRWGLREGVPTVVYDDWNR
AGSARAWWVLRAAGIEDVRILDGGLAAWAAAGGDLEAGEVSRPPGDVVVR
CADLYRGALPTLTVDEVAEFDGLLLDARAPERFRGDTEPVDPVAGHIPGA
TNAPSTGVLDGDGVLLPTEELVAFAERVGADGDSAVGVYCGSGVTAAVTV
AALMATGVPARLFPGSWSQWSADPSRPVATGH
315446213YP_004079092.1 diguanylate cyclase domain-containing protein [Mycobacterium gilvumMISSSTSKRRRLRPAANRWWNQPDQFDWLSGYLHARGLAPATRRLMAVIS
SALVLMAFGVLGSRDEHPVLTYTVAAAAAIAGIGYGTLWLRRWPTRRQSL
MMGMVGGSMIAVGSGMQTEPVVALMGCTGLVVTGGYLAFFHNTKAVLFNF
AVAATVGTYCALRVFETYDDRASALAGLWLIIELNLAVPLAIQTVVRTMG
ADVVRSDHDALTGLLNRRGFYERASSLLTSPAADSDLIVVMIDLDAFKRL
NDTYGHLAGDQALAAVGWALRKASPGSAVIGRTGGEEFLLIDILPVAQAE
ALPDELCAAIAALPHPVTASVGAAVVRGLPQSDAPAVIEALTRTADATMY
EAKRSGGNQALIRRVSPLFQN
315446212YP_004079091.1 ABC-type metal ion transporter periplasmic protein/surface adhesin MLRSTRRGRALAGIAASAALVLTACGGSGNTGAGDEASAGDCPAAPVDVV
VSVDQWGDIVSQLGGVCTRVTTVVAGSSVDPHDFEPAPSDAVAFEGAQLV
VVNGGHYDEWATKLAQTSAPDAHLIDAVALSTGHSGHEDHGHEGHDHEGH
DHADEGNPHVWYRPSAVTEVVDAVTAELTALSADAAGYFADRHRAFVESM
KPYEDTVAAIRAGATGKTYAAAEGAFDDMAAALGLTNRTPPGFQVAAANH
SEPSPADLDAFLNLLSERGVDVLVYNTQTEGSVPEQIRRAAEQSGVPVVE
VTETLPSDAGSFQDWQVAQLDSLAEALGVGT
315446211YP_004079090.1 ATPase component of Mn/Zn ABC transporter [Mycobacterium gilvum SpyMSAPEPATALSFTDVSAERGGRIIWSESTFDVEAGRFVAVIGPNGSGKTT
LLQVILGLLGPASGSVRVFGRAPGTQNDEIGYVPQNYDANANEAIRARDA
VLLGLTGRRWGFGRTSAADRARVEEALGWVDAVGIADRRLSDLSGGQRQR
IALAGALVAQPKMLILDEPLASLDVRNQHEIVAVLGRLKRELGVTVLVVA
HDLNPLLGVLDSAIYLLDGHAHHAALDKVVDSALLTHMYGTRIQVAHTLQ
GELYMRSGG
315446210YP_004079089.1 ABC-type Mn2+/Zn2+ transporter permease [Mycobacterium gilvum Spyr1MTQTVLAVGYQQNWVDIVGSLFMRNAWLGGTIVALAAGLMGYFIVVRHSS
FAAHALAHIGLPGATGAVLIGVPAAVGLGVFCVGGALVIGALGKRAADRE
VATGTVLAFATGLGLFFNSLATKNSSTLTNVLFGNLLAISGQQLLSFFAL
LLLTAAGMAFIFRPLLFTSVNSRVAEAKGVPVRGLSVAFMVLLGLTVTMA
VQAVGTLLLFALVVTPAATALMLTARPVLAMGLSAAIGLVSVWAGLVLSA
MFNLPPSFVIVTIACAVWLVVWGGSRMPRRGRKEAVAQPIG
315446209YP_004079088.1 LacI family transcriptional regulator [Mycobacterium gilvum Spyr1]MSRSPTPRRRATLASLAAELKVSRTTVSNAYNRPDQLSAELRERVLSTAK
RLGYPGPDPVARSLRTRRAGAVGLVITEPLNYSFSDPAALDFVAGLAESC
EAVGQGLLLVAVGPNRSVAEGSAAVLAAGVDGFVVYSASDDDPYLPAVME
RHLPVVVVDQPRDVPGASQVRIDDRAAMRSLAEHVIDLGHREIGLLTMRL
GRDWPHGPGPALADPERVRAPNFHVQCERIHGVYDAMTAAGLDPASLTLV
ESYEHLPTSGGAGADIALEANPRITALMCTADVLALSAMDHLRAKGIYVP
GQMTVTGFDGVPEARQRGLTTVAQPGVEKGRRAGELLHNPPRSGLPVVEV
LDTEVIRGRTSGPPA
315446208YP_004079087.1 trehalose 6-phosphatase [Mycobacterium gilvum Spyr1]MSALLPELESALSAAARTPRLLVASDFDGTLAPIVNNPADARPLPGAAEA
LIALATLPSTAAALISGRALATLRELSSMPDSVHLVGSHGAEFESGFSRD
IDRDLLQTITDGLDAIAAGRPGVAVETKPASVALHVRNASPADGDAALAA
AWDAARDWDAHITTGKAVLEFAVISTDKGEAVDILRERLQATTVVFLGDD
VTDEKAFVRLGESDVGVKVGPGDTAAAYRVESPADVATALRHLVDTRASQ
SPQPAP
315446207YP_004079086.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MNVAVLAESELGSEAQRERRKRILDATLAIASKGGYEAVQMRAVAERADV
AVGTLYRYFPSKVHLLVSALGREFERIDAKTDRAALAAGATAYQRLNIMV
GKLNRAMQRNPLLTEAMTRAFVFADASAAGEVDHVGKLMDSMFARAMSDG
EPTEDQYHIARVISDVWLSNLLAWLTRRASATDVAKRLDLAVRLLIGDGD
QPKI
315446206YP_004079085.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MPVPTSATITDEQADARELVRSWATASGSFEAAREVEQGDAAAWQAPYGR
LAELGIFGVALPEAHGGADGTVADLAAMVDEAAAALVPGPVATTALATLV
LPDGQADLLESLATGQRWAGVALNADLSYADGRVSGTAAYVLGADESAVL
LLPAGETWLLVDAGADGVTVEPLQATDFSRPLARVSFDGAPAEALPVSGQ
RVVDLAATLMAAESAGLARWLLHTATEYAKVREQFGKPIGSFQAIKHMCA
EMLLRSEQASVAAADAARAASDPAADAAQLSIAAALAASVGIEAAKANAK
DCIQVLGGIGITWEHDAHLYLRRAYGIAQFLGGRSHWLRRVAALTQQGVR
RELHIDLESVADLRPEIASAVAEVAAAPEDGRQVALAETGLLAPHWPKPY
GRAAGPAEQLLIDQELASAGVVRPDLVIGWWAVPTILEHGSPELIEQFVP
PTLRGELTWCQLFSEPGAGSDLAALRMKAVRAEGASASGAKVSGWKLTGQ
KVWTSAAQKAHWGVCLARTDPEAAKHKGITYFLIDMKSPGIVIRPLREIT
GDELFNEVFFDDVFVPDEMVVGEVNQGWRLARTTLANERVAMAQGTALGN
PMEELLRVIAELDVDGAQQDRLGHLIGTAQVGTLLDQRIAQLAVEGQDPG
PQASARKLIGVRYRQALAEFRMELSEGAGAIVNQQVHDFLNTRCLTIAGG
TEQILLTMAGERLLGLPR
315446205YP_004079084.1 hypothetical protein Mspyr1_47060 [Mycobacterium gilvum Spyr1]MKRLAAASVTALASMAMALTGAPGAGAASDAGVSSIPVGPDRIEMHVSAD
CVPAQNRCFYRTSANLLTPGGPTGFPQDTWARQTITLRSDSQDVWQEAWY
SAPAGVPRELKGANHNNVLSRMLKSLREVEVSVTYFGGGPIERFTTDGDS
VPTAWTTGLPAKGSRFIVCSQIQVVYPGVNLTTPTACAQPIFD
315446204YP_004079083.1 flavodoxin reductase family protein [Mycobacterium gilvum Spyr1]MTDVAADEPLGAHVLELEIADVIDETSDARSLVFRSPADAPVAPEKLRYS
PGQFLTLRVPSEKTGSVARCYSLCSSPFTGDPLTVTIKRTADGYASNWLC
DNAHAGMKMHVLAPSGTFVPKNLDTDFLLLAAGSGITPMLAILKSALSEG
SGHVTLVYANRDEKSVIFAETLRDLANKYPDRLTTIHWLESVQGLPSVSA
LTALFAPFTSREAFICGPGPFMAAAEEALTASGAAADKIHIEVFKSLDSD
PFAAVTIDDADDEGDSGPATVVVTLDGETHEVSWPRKAKLLDVLLNKGLD
APFSCREGHCGACAVLKKSGDIEMEVNDVLEQQDLDEGLILACQAHPTSD
SVEVTFDE
315446203YP_004079082.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MTSIEQRDAQTVLAGVNDLLPRIAKRSAAAEELRRLPDETVAELDEVGFF
KLLQPEQWGGLQCDPTLFYEAVRRIASACGSTGWVSSIIGVHNWHLALFD
QKAQEDVWGDDPTVRVSSSYAPMGAGTVVDGGYLVSGAWQWSSGCDHATW
AFLGGPVIKDGKPVDFGSFLIPRTDYRIDDVWNVVGLKATGSNTVVVKDV
FVPRHRFLSYKAMNDGTAGGYENNTAPVYKMPWGTMHPTTISAPIMGMAY
GAYEAHVEHQGKRVRAAFAGEKSKDDPFAKIRIAEAASDIDAGWRQLIGN
VRDEYELLQAGKEIPFSLRASARRDQVRATARAIASIDLLFEASGATALQ
LDQPVQRFWRDAHAGRVHAANEPERAYLIFGNDAFGLPPQDTMV
315446202YP_004079081.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMTSFAAEAAQQQEITFESTSRYAQVREDMRLHYHEAGVGNPKTVVLLHGG
GPGASSWSNFGRNIPVLAKHFHVLAVDQPGYGHSDKHTEHEQYNRYSATA
LLNLFDHLGIEKAALVGNSLGGGTAVRFALDNGKRAGKLVLMGPGGLSVN
LFSPDPTEGVKLLGRFAAEPTRENIEKFLRIMVFDQAMITPELVEERFQI
ASTPESLAATKAMGKSFAGADFELGMMWRDVYKLRQRVLLIWGREDRVNP
LDGALVALKQIPRVQLHVFGQCGHWAQLEKFDEFNKLTIDFLTN
315446201YP_004079080.1 glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily [MyMTIKSLGYLRIESTAVAAWREYGLKVLGMVEGSGPTEGALYLRMDEFPAR
LIIVPGENDRLLESGWETANAAALQDIRARLDIHGTPYKEATASQLADRR
VDEMIIFDDPSGNTLEVFHGVALEHRRVVSPYGHKFVTEEQGLGHVVLTT
RDDAETLHFYRDVLGFFLRDSMKLPPQLVGRPADGAPAWLRFLGVNPRHH
SLAFMPGETPSGIVHLMVEVENSDDVGLCLDRALRRKVKMSATLGRHVND
KMLSFYMKTPGGFDVEFGCEGLEVDDQNWVARESTAVSLWGHDFSVGFK
315446200YP_004079079.1 hypothetical protein Mspyr1_47010 [Mycobacterium gilvum Spyr1]MGSPPIDPRTFRNVLGQFCTGITVITTVHDDAPVGFACQSFAALSLDPPL
VLFCPTKASRSWAAIEASGTFCVNILHENQQHVSARFGSREPDKFAGIDW
APSKLGSPVIEGSLAHIDCTVHSVHDGGDHFVVFGAVHSLSDVPKKKPRP
LLFYHGQYTGIEPDKNTPADWRNDLEAFLTATTDDTWL
315446199YP_004079078.1 hypothetical protein Mspyr1_47000 [Mycobacterium gilvum Spyr1]MTTTSTVQRVDADEALLACTTLSRVDHVDVHTLSPTSALQTPEAWARIIL
EGPPAATRLRLRAGWTMLDLRLHRGDADVIAGWRITHRDTEYLRLQASSA
IGLTGELVTRVTDDHVVFATLVRLGNPAARLLWARVLPTHLTVVRSLLEG
AAARTC
315446198YP_004079077.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPPPVRTPRRSWIDAGLALLAQEGPDAVRVEVLAQRLGVTRGGFYRQFEG
RSDLVTAMLDEWEQRSIDEVRARVEAEGGDVQSRVTRAGALTFSDELVPL
DLAVRDWARRDSDVAARLRRVDTRRIGFLRELLGAVCEDADEVEARALLA
FSLAIGTHVIAADHPGPRQRVVRDATRLILDGVTPV
315446197YP_004079076.1 lysophospholipase [Mycobacterium gilvum Spyr1]MPFLDHDRGPAYYRHWAAEDPRAAVVFLHGFGEHTGLYHRYAFALNTAGI
DVWAVDQFGHGLSPGTRGDFGSIEDSSALADALTERASTRSVPLIAQGHS
FGSIVTLFRLLDGPNRYRAAVISGSPLIPVPELVDADTSIDLDPGWLSSD
PFYLDALENDPLAFVESDSTALTRELDRGWDRFGSDLPALSVPTLAVHGV
NDPIAPIGAVRAYAEQIDAMELAAFDGARHDVLNESQHRDVAAAIIGFIE
SHLR
315446196YP_004079075.1 LysR family transcriptional regulator [Mycobacterium gilvum Spyr1]MQLPSPAMVKTAGWFCENAEMSPLGRRPSADDLLVLLAVGRTGKYTSAAD
ELGLNHTTISRRIAALEQAMGGRVLARVAGGWELTDLGRDALAAAEVVET
AVRSLATDPAGQRALEGVVRISATDGFSAYIAAPAAAAVQRRHPGVAVEI
VATTRRATQQRSGMDVEVVVGEPKVRRARALRLSDYCLGLYGSRDYLATR
GTPATIAELQKHPLVYFIDSMLQVDDLDLATSFTPAMRESVTSTNVFVHV
EATRAAAGIGLLPCFMADRHDDLVRVLPGQVSITLTYWLVTRAETLRRPE
VAAVVDAIRARVRDQHHMLLGAG
315446195YP_004079074.1 sugar phosphate permease [Mycobacterium gilvum Spyr1]MSSTESASRSKGLKRVVVASMAGTVVEWYEFFLYATAATLVFNKVFFAEG
TSEAAGLIAALLTYAVGFVARPLGGIVFGHFGDKYGRKKLLQFAILLVGV
VTFLMGCLPTYHQIGVWAPILLVALRFIQGFAVGGEWGGAVLLVAEHSPA
KDRGFWASWPQAAVPVGNMLATVVLLVLTGVLPEAAFMSWGWRVAFWLSA
VVVLIGYYIRTKVTDAPIFVKAQEEVDRVKAVSFGVAEVLKRYPRGVFTA
MGLRFAENIMYYLVVTFSIVYLKTHVGADTSDILWWLLAAHAVHFLVVPQ
VGRLSDRFGRRPVYIVGAILAATWGFFAFPMMNTGSYLLIMAAVILGLMI
HALMYAPQPAIMAEMFPTRMRYSGVSLGYQVTSIVAGSLAPAIATWLLDK
FGTWVPIALYLAGAAAVTLVAAWFTRETKGIDLHTLDAADREQLEKAGIV
315446194YP_004079073.1 hypothetical protein Mspyr1_46950 [Mycobacterium gilvum Spyr1]MSESGVNDLRSRTAVVTGGAGGIGAACAKALAERGVTVTVADIDEVGAKT
VAEEIGGKAWALDLLDVAALESLQLETDILVNNAGVQNISEIAEFPPEKF
RSMMALMVEAPFLLIRAALPHMYRNEFGRVINISSIHGLRASPFKVAYVT
AKHALEGLSKVTALEGGPHGVTSNCVNPGYVRTPLVTKQIADQARTHGIP
EDQVVSDILLKESAVKRLVGPEEVGSLVAWLASPAAGMVTGASYTMDGGW
SAR
315446193YP_004079072.1 acetoacetyl-CoA synthase [Mycobacterium gilvum Spyr1]MERSVTEPQWTPAERDIAEAEITAFTRFVEQRTGRDFPDYHALWAWSVED
VEEFWAALWDYFDLGERAQPVLQSAEMPGAQWFPGTEINYVDQVMRHVRT
DRPAILHVSEDARDREVSWAELLGRTAAFADRLRAAGVESGDRVVGYLPN
IPEAVVAFLATASIGAVWSACGQDYSAKAALDRLGQLEPKALVAADGYTY
AGRYHDKRADVAALRSEIPSLTAIFTLDDLAARVETPLTPARVPFDHPLW
VLFSSGTTGLPKGIVHGHGGVVVEHLKAVALQSDIGRDDVFFWYTSPSWM
MWNFQVAGLLVGATIVCYDGSPTARHPETLWEIASRVGATVLGTSPGYVL
GCMKAEATPASTYDLSALRSVGITGSALPAASSLWLQDQVGVQVASISGG
TDVVSAFLGGVRTVPVWPGELSAPYLGVALDAWDEDGQPVRGEVGELVIT
KPMPSMPVGFWNDRDGSRYRCAYFDTYPGVWRHGDWITLTDRGSVVVHGR
SDSTLNRHGIRMGSADIYQAVESLPEVAEALVIGAELPDGGYWMPLFVVP
ADGVKLDDGLRDKINERIRTELSPRHVPDEIIAAPAIPHTRTGKKLEVPI
KKLLQGGDPAKIVERSAVDDPALLDWYAGQCRAVTST
315446192YP_004079071.1 hypothetical protein Mspyr1_46930 [Mycobacterium gilvum Spyr1]MFESLFDIDEGASQAELRAVVERCERLKSAAAAAQARATALWAAKRAAAE
EAAGVPVRRRGKGLASEVALARRDAPVKGGQHLGFAKALVHEMPHTWAAL
ECGALSEWRATLIVRESACLSVEDRRRLDEELCADVSTLEGWGNKRVEAE
AKKIAARLDVAAVVERADKAAAQARVSCRPAPNGMVYFTVLLPLAQGIGM
YAALKHHADTTFDGRSRGQVMTDTAFERITGRSAGTAVPVALNLVMADTT
LAGDDDCPGWLDGYGPVPAGFCRALTGDAVADKGARATLRRLYRHPRSGQ
LVAMESRARIFPKGLATLIDRRDQTCRTPYCDAPIRHHDHATPDRAGGKT
SAENGLGECAACNYAKEAPGWQVSAGTQDGSHTARWVTPTGAVHYSIAPT
LPGPPVRRRISDTEGRLSIDLITFDKPDAA
315446191YP_004079070.1 arabinose efflux permease family protein [Mycobacterium gilvum SpyrMAPLSPTAQRAPLLAAGFTTAFGAHAVAGTLGTTTTGTAASLLTLGAMLA
IYDGAEVILKPLFGTLADRIGARTVLIAGLAVFAVASLSFAVADETAWLW
AARLGQGIGAAAFSPAASALVARLAPASGQGRAFGTYGSYKSVGYTLGPL
IGGAIVTFGGLQALFAVMAALAAAVAVWAAVAVPRLAVLPRTRQTLLDTV
RRFSESSFVTPTLALAAATAALSAGVGFLPVLGTDFGLSPVVTGAVVSVL
ALTTAVVQPLAGRAADSGRISLTSGLFTGVVVTAAGVAAAALPGLVGLLG
GAVVIGVGCGLITPLAFTMLARSTPEERLGQTMGAAEIGRECGDAAGPLV
VAAIAAASTVPFGFLGLAAVVAASGVGVRRGRGRVGGVG
315446190YP_004079069.1 aspartate/tyrosine/aromatic aminotransferase [Mycobacterium gilvum MTPSQRSGIPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPTAVRDA
AVAALHRNQLGYTVALGIPELRTAIAGSYQDRHGLEVDPGDVVITTGSSG
GFLLAFLACFDVGDRVAIASPGYPCYRNILSALGCEVVELPCGPDTRFQP
TLQMLTELDPPVSGVIVASPANPTGTVIAPEELAAIAAWCETSGVRLISD
EVYHGLVYPGAPATSCAWETSRESIVVNSFSKYFAMTGWRLGWLLVPDEL
KRAVDRLTGNFTICPPVLPQLAAVAAFTPESVAEAESLLEGYGANRTMLL
DGLRALGIDRLAPTDGAFYVYADVSHLTTDSLSFCSKLLADTGVAIAPGV
DFDTVRGGAFVRLSFAGPSSDIEEALRRFGAWLP
315446189YP_004079068.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MSEERELLRDTVAALVEKHASPEAVRTAAASERGYDEALWTMLCEQVGAA
ALVVPEELGGAGGELADAAVVLEELGKRLVPTPLLGTTLAELALLSVDAP
DAALLEALAEGTSIGTVVFDPEHVVNGNVADVVIGTDGETLSRWTSFTAT
PSVAMDITRPLASLEVTETSPLGTDPGLADIAAILLAAEQVGAASKCLDL
TVQYTKDRVQFGRPIGSFQALKHRMADLYVAVQSAKAVVDEAVAEPSSTS
AALARLAATEAFSKTAAEAVQMHGGIAITWESDIQLYFKRAHGSAQLLPP
PREQLRRLESEVF
315446188YP_004079067.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MNFEIDDQQRDFAASIDAALGAADLPAAVRAWGEGDTAPGRKVWSQLTDL
GVTALMVPEKFDGIEAHPVDLVVALERLGRWNVPGPVTESIAVAPILLGD
DDRVGALASGELIATVAAPPLVSRAVDADTAGLILLATEGAVADAEMGTQ
HESVDPARKLFEVTASGEARAADVERAFEFGALATAAQLVGAAQAMLDAS
VEYAKQRSQFGTIIGTYQAIKHKLADVLIAVELARPLVYGAALSLADGSQ
DTARDVSAAKVAAADAALLAARSSLQTHGAIGFTQEHDLSLLLLRVQALR
PAWGDPTWHRHRVLEALTK
315446187YP_004079066.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MDLTFDDATLDFQAEVREFLAANKGSFPTKSYDTADGFEQHRRWDKVLFD
AGLSVITWPEKYGGRDASLLQWIVYEEEYFRAGAPGRASANGTSMLAPTL
FAHGTEEQRDRILPKMASGEEIWAQAWSEPESGSDLASLRSTATRTEGGW
LLNGQKIWSSRAVFGERAFGLFRSDPAAQRHKGLTYFMFDLKADGVTVRP
IAQLGGDTGFGEIFLDDVFVPDDDVIGEVHDGWRAAMSTSSNERGMSLRS
PARFLAPAERLVAQWKDNPDPVFTDRVADAWIKAQAYRLHTFGTVTRVAG
GGELGAESSITKVFWSDLDVALHQTALDLRGADGELMDPVTEGLLFALGG
PIYAGTNEIQRNIIAERLLGLPRK
315446186YP_004079065.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MTTSPRTTPAVLERIARELPDQPAVVTAQRTLTYFGLRSEVLHAAAAMID
LGIEPGDRVAIWSPNTWHWVVASLAIHHAGGVLVPLNTRYTASEAEDILA
RTGAPLLFASGAFLGADKAASVDRDSLPALRHIVRIPVDTDDGTWDEYIA
RGAKEEALAAVGARAAAVTADDVSDILFTSGTTGRSKGVRCAQRQSLDAS
AAWAACGQLTRDDRYLCINPFFHNFGYKAGILACLQTGATLYPELTFDPG
ETMQAVQEHRITVLPGPPTIYQTLLDHPRRSEFDLSSLRFAVTGAATIPV
VLIERMQSELDIDIVLTAYGLTEAAGFGTMCRADDDAVTVATTSGRPIAD
FELRIGESGEVLLRGPNVMLGYLDDPEATAAAIDGDGWLHTGDVGELDPA
GNLKITDRLKDMYICGGFNVYPAEIEQVLARLDGVAEAAVIGVPDDRLGE
VGKAFVVTLPGAELDEKTVIDHAREHLANFKTPRSVEFLDALPRNPGGKV
VKPLLRQRSERA
315446185YP_004079064.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MIEVQKFRAEVRDWLAENLVGDFAALKGLGGPGREHEAFEERLAWNQHLA
AAGLTCLGWPEEHGGRGLSVAHRVAFYEEYAKANAPDKVNHLGEELLGPT
LIAYGTPEQQQRFLPRILDVTELWSQGYSEPGAGSDLANVSTTATLDGDE
WVINGQKVWTSLAHWAQWCFVVARTEKGSKRHAGLSYLLVPLQQPGVEIR
PIIQLTGDSEFNEVFFDDARTAADLVVGEPGDGWRVAMGTLTFERGVSTL
GQQIRYAREHSNLVELAEKTGAADDPLIRERLVRSWAGLKAMRSYALATM
DLEGGSEAAGKDSVSKLLWANWHRELGEIAMDIEGAAGLTLPDGEFSEWQ
RLYLFSRSDTIYGGSNEIQRNIIAERVLGLPREARH
315446184YP_004079063.1 hypothetical protein Mspyr1_46850 [Mycobacterium gilvum Spyr1]MTDLSQAPAEIDGHGLLKGKVVLVTAAAGTGIGSTTARRALLEGADVVVS
DYHERRLGETRDELAALGLGKVDVVVCDVTSTEAVDALITSTVEKAGRLD
VLVNNAGLGGQTPVIDMTDDEWDRVLNVTLTSVMRATRAALRYFRDAPHG
GVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVDYGVRINAVS
PSIARHKFLEKTSSSELLDRLAEGEAFGRAAEPWEVAATIAFLASDYSSY
LTGEVISVSSQRA
315446183YP_004079062.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MDRALPSRRDELLQLAATMFADRGLRATTVRDIADSAGILSGSLYHHFKS
KEQMVEEVLKDFLDWLFTRYDEIVAATTDPLERVSGLFMVSFEAIEHRHA
QVVIYQDEAKRLNSLPQFGFLDDRNRQQRRMWVEVLKQGIAEGSFRPDID
VDLVYRFIRDTTWVSVRWYQPGGPLTAEQVGRQYLAIVLGGITEGSK
315446182YP_004079061.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum Spyr1]MAVASEAYVIDAVRTAVGKRNGSLAGVHPVDLGAAAWRGLFERNDVDPGA
VDDVIAGCVDAIGPQAGNIARLSWLAAGFPEEVPGVTVDRQCGSSQQAIS
FGAQAIMSGTADLIVAGGMQNMSQIPISSAMTVAEQFGFTSPTNESKSWL
HRYGDQEISQFRGSELIAEKWNLSREEMEQYALMSHHRAQAAIRAGHFEN
EIIPVQTDGAGFATDEGPRDTSLEKMAGLKTLVEGGRLTAAMASQISDGA
SAVLLASEDAVKAHGLKPRARIHHISARGADPVFMLTGPIPATRYALDKT
GLTIDDIDTVEINEAFAPVVQAWLKETKADPEKVNPSGGAIALGHPLGAT
GAKLFATMLNTLERTGGRYGLQTMCEGGGTANVTIIERLS
315446181YP_004079060.1 hypothetical protein Mspyr1_46820 [Mycobacterium gilvum Spyr1]MLAQERRNTRPFGYGFAAIALSAGLVLAPMHGVAYAEPADSGSASAQQAA
DGPEDRAESRKPPSRRSGPVDTETPTTGPSREVHDADPPDPAPDDSVESD
GDGPTTEEVSDPASTPGPVAATHEDDPLPIEAFEPAKPVHTDAPEPAAVA
LTTVEPATPLPVLDRSPARAEVVSVTSPTAADVAPIEITRPAPPQPLSPV
AQLLELPGRLINAVLQALGFTASANHPPVPNGLGPINDLIFGAFRELERL
IGLHRTPPPLPEVPTLTYTGPTTRPTPTVAQFLNASAAGYVLGGTPGGLV
PFTVNGFQLSRTNIFTGMVGRTWVTPEGQVIIAYQGTTGGSHLLFNPLIT
ITQVLADLQVVFTRTTPLAFYDALDFAERVLAEAAVQGYATDDIFVTGHS
LGGWEAQFVAQQIGLAGIGFEAPGMNTRTPGNGADSMFVNIGTYGSSAPY
MATDLPGLQPFMPPYVPGGGTKPHYGPIVMIGDPAAMTPLYNASALWGRG
LIGTTIFLVDYLINFFQYHLPGVQAYHLDVVPDPGMVLFLGTSRGPVHTG
YGTLSIPQLMRAASDDGILFRP
315446180YP_004079059.1 Zn-dependent alcohol dehydrogenase [Mycobacterium gilvum Spyr1]MKTNAAILWEYGGDWTVEEIDLDPPGDGEVLVSWEATGLCHSDEHIRTGD
LPAPLPLIGGHEGAGIVREVGAGVVGLAPGDHVVASFLPACGRCRFCSTG
HQNLCDLGAMIMAGTQLDGTYRRHINGQDVGVMALVGTFSQYGTVPEASI
VKIDDDIPLSRACLLGCGVTTGWGSAVNTADVSPGDTVVVIGLGGIGSGA
IQGARLAGAEKIVVVEPVEAKRDLAFRFGATHFVTSMEEATALVADLTRG
VMADSAILTVGLLAGSMLEEAANIIRKGGAVVMTALSTMADNQPTLGMMM
FTLFQKRLLGSLYGEANPRADIPRLLSLYREGKLLLDETVTHEYKLAEVN
EGYEDMREGRNIRGVILHDH
315446179YP_004079058.1 2-nitropropane dioxygenase [Mycobacterium gilvum Spyr1]MTRLVTPLTELVGIEHPVVQTGMGWVAGARLVAATSNAGGLGILASATMT
LAELTTAVGKVKAATDKPFGINIRADAGDANERVELLIREGVKVASFALA
PKPDLIARLKEAGVVVIPSVGLAKHAKKVAGWGADAVIVQGGEGGGHTGP
IATTLLLPSVLDAVADTGMPVVAAGGFFDGRGLAAALTYGAAGVAMGTRF
LLTKDSTVPDAVKQRYLDAALDGTVVSTKVDGMPHRVLRTGLVEKLESGS
PVRGLSAAVLNAQKFKKMSGMTWKSMITDGLAMRHGKDLTWSQVVMAANT
PMLLKAGLVEGNTEAGVLASGQVAGIIDDLPSCAELVPAIVAEAVEHLQK
ASQHIR
315446178YP_004079057.1 acyl CoA:acetate/3-ketoacid CoA transferase subunit beta [MycobacteMISATRAEVCAVACAELFRDAGEIMVSPMTTIVSIGARLARLTFSPDIVL
SDGEARLIADTPAIGAAAAIEGWMPFGRVFETLSWGRRHVVMGANQIDRY
GNQNLSAFGPLQHPTRQMFGVRGAPGNTINHATSYWVGNHSTRVFGDSVD
IVSGIGWDKIDPDNPAYRFVNVYRVVTNLGVFDFNGPDHQMRALSLHPGV
EADQVAENTSFEVHGLDGAETTRLPSAEEQRLLREVVDPKSLRDKEVKS
315446177YP_004079056.1 acyl CoA:acetate/3-ketoacid CoA transferase subunit alpha [MycobactMTDKRTTLDEAVSSIESGMTIGIGGWGSRRKPMALVRALLRTDVTDLTVV
TYGGPDLGLLCSAGKVKRVYYGFVSLDSPPFYDPWFAKARTTGAIESREM
DEGMLRCGLQAAAQRLPFLPIRAGLGSDVRAFWGDELKTVKSPYPTGSGY
EELVAMPALNLDAALVHLNLGDAKGNAAYTGIDPYFDDLFLMSAEKRLLS
VEKVVSTEELVKSVPPQALLINRMMVDSVVEAPNGAHFTTAEPDYRRDEK
FQRHYAEAAASDETWAEFVKTYLSGSEEDYQAAVREFQQAQEASK
315446176YP_004079055.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MPITTKTVEPGIVTVTVDYPPVNAIPSRGWFELADTITAAGRDQSTHVVI
LRAEGRGFNAGVDIKEMQNTEGFTALIDANRGCYEAFRAVYECAVPVVAA
VNGFCVGGGIGLVGNADVIVASDDAKFGLPEVERGALGAATHLSRLVPQH
LMRRLFFTAATVGADTLHHFGSVHEVVPRADLDEAALRVARDIASKDTRV
IRAAKEALNFIDIQPVNARYRMEQGFTFELNLAGVSDEHRDAFAGTDKGS
K
315446175YP_004079054.1 hypothetical protein Mspyr1_46760 [Mycobacterium gilvum Spyr1]MTDAVDRAASGRSAIALGLTGRVVLVTGGVRGVGAGISTVFADQGATVIT
CARRPVESSPYEFRACDIRDDDAVKALVDGIAADHGRLDVVVNNAGGSPY
VLAAEASAKFSMKILQLNLLGALSVSTHANAVMQKQDGGGSIVNISSVSG
HRPTPGTAAYGAAKAGIDNLTRTLAVEWAPRVRVNSVVVGMVETEQSELF
YGDADSIAAISKNVPLGRLARPEDIGWATAFLASDAASYISGASLEVHGG
GEPPHYLSTTTADIK
315446174YP_004079053.1 hypothetical protein Mspyr1_46750 [Mycobacterium gilvum Spyr1]MGLLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPAGGG
SAAQTVVDEIVAAGGEAVTSGANVADWGQAEGLIQTAVDTFGGLDVLVNN
AGIVRDRMFANTSEEEFDAVTAVHLKGHFATMKHAAAYWRARSKAGDTVD
ARIINTSSGAGLQGSVGQANYSAAKAGIAALTLVAAAEMGRYGVSVNAIA
PSARTRMTETVFADMMATQDKEFDAMAPENISPLVVWLGSVESRDVTGRM
FEVEGGKIRVAEGWAHGPEIDKGARWDPAELGPVVGDLLAKARTPVPVYG
A
315446173YP_004079052.1 GAF domain-containing protein [Mycobacterium gilvum Spyr1]MTSLSGFDDWLNRLVDEQAALAGQTVPDYVAQAVATRLMGDIKRRDEEMA
VFFEHLSEVGIVLPQETSGPNPVVVDPERLEALRATGLLDAPRDVAFDRI
ADMAATALGAPGAAITLVDIDRQFFVAMHGAATDAPDARETPLARSVCQY
AVAAGQPLVVTDARTDPVLKYNPAVTDGTVVSYLGIPLMDSGQHAIGTLC
VWDTIPRDWTSGHVTTLRDLAHLASARIFDE
315446172YP_004079051.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MAIVSIALVSAVDPYPVDAGKKVMLAGFVKYFADRFGPDNVHYIKVGSVR
REGFPVHVHEVPAPGSADVARNVVRRVATGRASLQEAFLDSPQTRTGIAQ
VLGDIQPARVVYDTIRMAQFATDPAAAQSICYLDDLFSERYTRMLDAAAR
YPDVEFSPLGNFAEHVPARLQPLATRRSTQTALLRLERRLVRRSEDRVAR
RFGRSLMVSPEETAQLEARVGVAPGRIRCVPPLVDIVSSAERSYSGRKEF
VFLGLLSLPHNDDGLWFFLSEVWPLILARTPDAHLNVIGREVSPRLTALA
DRYRDSVTVSGYVPDLNDALSDAAALVNPLRFGSGIKLKVFEALARALPV
VSTSVGAEGIASGPGTGILVADTAAQMAEQLCSLTAVDRNAVVSKEAQEH
FRSTYSRRAVFEVYDAAFTL
315446171YP_004079050.1 hypothetical protein Mspyr1_46720 [Mycobacterium gilvum Spyr1]MTGSEPEGARVPDASGRPTPAAPSTARQTAWNYLVFALSKSSTLLMTIVV
ARILSPTEFGIFALAILVVNLFDYVKDLGVASALVQNRRDWRDLAPTGLT
LSVLFGLFASGLLAATAGVAARALGEPELTELIRVLAVGLAISALSTIPA
AWLRRSMNFSARLMPEFAGAVAKTGLTIGLAAAGFGVWSLAYGQLAASVI
MTILYWRVARIRPGFAFNGPVCRELVRFGLPVTAVTLLAYAIYNVDYLAV
GERLGATELGLYSMAYRIPELLVLSLCVVISEVLFSALSGLQDDRDVLTR
HYLQALTVVAALTIPIGIGLAVAAQPAVGTLYGSAYAESAPILSVLAIYA
TVYSASFHAGDVFKAIGRPGILTAINAGKLAVLVGPIWWAAGHSALAVAV
ALLSVEALHFLVRMTVLCRLTSTSWLSIAGALCRPAAAAVPMGLVLVGVS
HVIDGLADPLELAVMVVVGLCVYVLILRFTAAHLVKSAFETVRARISRSA
ATPATTKEDL
315446170YP_004079049.1 hypothetical protein Mspyr1_46710 [Mycobacterium gilvum Spyr1]MTKQRRMMAILAVVGALLGLAVGAVVSTGPSRYSAAADVALLPAPNLTSV
EASDFWEVLTSGQVTRTAAIVYGDPRWLAAAADAARVRRSDVSLTAVALP
ETTILTVTVTAGSAEAAEAALNNVLTTATPEVTALAAPFSVKVLWPPENS
AWKKSAPGKMQMMLAGALGGLLIGAGVGWWLARRRRDATTPPGGHSNVPA
AGDDTVGESTRGAPLGS
315446169YP_004079048.1 Lipid A core--O-antigen ligase-like protein [Mycobacterium gilvum SMTGDTRVGQAEAAGLAVAVGFVALGALFVFGTGSTLLLIGAPIGALAILL
VARYPLVAVSIMVAIEFSNLSALLAPRTGLPVFPASLLLGLLAVGFALRD
PVCRSRINGWTAVCAGLLTVYLATQAIATIGSIDTAESSANMQRQTIDCV
FVMLVLILVQVTARPWTIAAVIVVTLASICALTIISWVVFGGAATFGGLS
TVTTASGELVTTARYGGPLPDSNFWGRHLVMGLPMAAALLTHALRSARRG
AAAIWVLALILLLAGIYLTQSRGTFLAAGVVIVVWFAAVGRGVRRWALML
IPFGAATFAVPGVGNRILAVFEDFTETETQVNVDPSVVQRVSAQEQAWLM
FDERPLFGFGPATYPGQVINFADRTEFSPLDPTNAPHNLYAEFAAESGYL
GLFGWALVMLGFLTVVILGIIANPLGRERVLAAAVCAALVGWSVASIGLH
MAYFRTFGVALALVGGFAAAWPVSADAVRTLVRGAAVWAAAAVLGGAAAW
MFLSANSTTVVTARQSVTLVPAGPIDGWYAYALDVRSRGSLLPTFAYLLE
DPDSPVDINADPVRGVLILKTTAADVEQAHDDIQIAAAHAEATLYSAIGY
QQYSLRAVGGMRAVTEQQRSPLTTLLGAGIGVAVTLISVAGMHRIGKRRR
ITGPDERRDVPEEAVSVPATNP
315446168YP_004079047.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MLVELSPSGGLFQFAFELGSALAAQGRQVELWTGPRPELASSQPGFTVRP
VLPTWHPGDTGVHSRAFRLARRGIRAVQLIFAWMVLSVRLLAARPGAVLW
SQWRFTFEPVFVVALSMVLRSSTLGLIAHEPVPRSDAKDTSTAKGGELLT
RAFRAAWQRLDVVFVLGPRTRDLAVSYWQPRCPVYVIPHGAEPGVRGERA
VRPVDDTEPVVLFFGVWARYKGIEVLLEAFERVRAEMPESRLVLAGDVGA
DVDLAAVLDRAHRIGNVDARPGYVAIEDVAALFDAARLVAVPYIRATQSG
VAHLAFTFGRPVVASNIGDLPEVIQDGVTGLLVDPDDVEGLAAAILTLLR
DVSFAARLGVAGERSVSDAWSVAAARVCDALAAGAGPGQEP
315446167YP_004079046.1 hypothetical protein Mspyr1_46680 [Mycobacterium gilvum Spyr1]MAARCIPGLLAILVVLVSGVTACSFQAGPGPFERPFAASSPWRQEIPPDA
EVDPDSAAMIAAVQQKPALNGNLVEYGIPIYRADDDTPTYTVPCTRQDYG
ICPFAGWPVPIPDGAQPNTGSDGVLVSVAESDGTVFEFWRAAREGDTWTT
GFAAVNSLNGSGWGGAATGSGASRLAGVIRVAEIADGEIPHALALQSNNA
CPAFRPPALKSDGASTRADCIPEGARLQLDPQLDLESLGLSPGELAVGRA
MQRYGGYLMDVANTPMSVSFERDRDAGPGELGPTYSDAGFRWDYDAMENI
PWDRLRVLK
315446166YP_004079045.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MTGGVSALVLIDAFRMGGAETLLAPMIVASRDTDVSMDVVSISPSEWNSE
KTMTILAEAGIPTRSLGIRRLLDPVALPRLVRTIREGQYDVVHAHLEMAM
TLAVPAAALAGRPSVCTFHHVARPLEGRAAWRERLAVEAATRSRRALFVS
EASRRSFAENYRPKGMPANWEVMHNGIDIANFSPGQADPQVRRELAGGGD
SLIAVLPAAFRDFKGIPVAIRAWPAVIEKFPSAVLALTGGGELEGELRQL
VADLGLNESVNFVGVRTDMPEVYRAADVVVLPSTHGENLPTVLIESSATA
CAIAASRIGGIPDIVLDGETGLLFEAGSVEGFADTVCRLLGDAELRRRLG
VAASERARSEFSATAWLARLRTTYLEAMGDRR
315446165YP_004079044.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MNRRHVTYLVSRFPVTSETFIVRELDALDRSGEFDLEIRSLFPSPDTAVH
EIARRWNERLVRPTLFDAAAGAAWALLTHPLALMTILANVVAGYRRNPAL
LVRALTTLPLACSHARDLARRAQPCHVHAHYATYPALAAWACHRLVGASY
SFTVHAHDLYVDTSMLDRKIAEARYVVTISRYNRTLLERHNPAETPIRVV
HAGIGTAAYRYRPRGIPPEGVVRALTVASLQQYKGHAVLLEALAMGGSAV
ERITLDLIGDGVLRQDLEALVERWGLQGRVRFRGSCSEDVVRAALDAADL
FVLPSLVADDGQMEGLPVVLMEALACGVPTVATDLSGIPEIVVDGVTGLL
AQPGDAGSLNRALTAMIERGGGAADFTGPGRDLVTREFDLRESIDALTGL
LDEYVPARPVQR
315446164YP_004079043.1 hypothetical protein Mspyr1_46650 [Mycobacterium gilvum Spyr1]MSGDHDVYSRVSTAYHPFMRWAPIIEALVAIPVAYGALFFLGPGSTDTFA
AEDQIVETIGALGLLVTSIFLLLLFIAGRRAGQFGVFKQISLIGLVLLFF
FGAGEEISWGQRYLGVATPTSWEERNVQGELNLHNIDTLSGWLDADYLFR
AFWVVIGIVIPVVAAMSPRVRAAIDRCIPVFPLWVAVVLVLNQIAAEVAG
VVDRRRPTWYEGTYYTFDGARFEVTESILSVVFALGAYALYRRSKTDATD
AADESVSEPR
315446163YP_004079042.1 hypothetical protein Mspyr1_46640 [Mycobacterium gilvum Spyr1]MRGLDAEEAQLSRISETSARLVPHVGALVATVALLIGISPPAHAQPDVGS
DPAIGTTTLSLADAGLENGLQFFGDTGQTTLTFPVPSGLRPTALNTTLNL
PFGIRSGTVTVTQDDRLISKVGLPPVDFEPVVIPLDAVVVTDDVVNLTLR
LTALAEDRYCLDADHPVILTNGSITFTGSVSNPTTVADFLPPVLRTLTIG
VPERPSQAESGTALQLAAALLLRYRSQAPQVALVPLPGDAAVIDGPAQPF
ERRIVVKEGGEEGLSLSGGPDPQLRISGPPDRLPDQARLLTDGNLTMAVG
TNVVTGTLRTRPPPAGESTTLADLGEPGLSSTGVAPKVGIALDQTRFGRA
IGGYRLHLTGSHTPLPADVGGRVTASVDGQIIDSWPITADGTIDHWVDLP
DDLVERYTNIVVGIDTSGDMGDCADYRPITLTIYGSTVVQNTPAEPPLAA
GFNALPQALMPYTKVGIAADSFVDTQRALQMVLGLQRLSVVPLLTEVVSV
QQAIEGDEPAIVVSPEGWTDTSITLPVSSENQWLTLTGLGDEEETTLALE
PGIRFGSLQTVSDGNRSLLIATSNGAPAELDRLLRWLNDDPRGWSRLRGN
AVLAIEGAEPQLVPGRSPLAVLDAPAVTSEAEADRGGETPTWWIAGGVIA
AVVIGISAYWLGTRRRPGGDTTES
315446162YP_004079041.1 hypothetical protein Mspyr1_46630 [Mycobacterium gilvum Spyr1]MPSHNDATRGHSERPGSSVAATATGFAEQKFARNASPGAVSEGAAPAEPD
PRRAPKRTATTNLKRAGCIGAFAVTLGVGAALAAAPGVALADSTDSDSPQ
SSTAGNTASDAAGDSASSQGSSARKTRDQGADDSDTAGTKNAASTRAAAA
SADDGEAASASTTTQRRTLSPRKPTAAVTVSPAVITPPAPGIPTAPTPNS
ILVATSASFARPTSARSSITSSRDRTANATVSATSTAVANQNVVINAESM
TVARPAYGSVFTDPTASGGTALVLTQNTTASKTVALPSFTNIVIRAKGDQ
YQGAPQMKVSVNGKVVAKVAVAATAWTDYTVPFKGAPGTYTVSIAYTNDR
YARGKGDRNLRLDTVTVVSSVVEPAPAPTPPSSTPAPGYFGGADWLWKPI
SSNPTLAANSSTWVGYLAAADKQRVANLYNYSVALVSASEITSSTPRYDV
TLTKAWGSDPFGSTTVPIPLGTKIPPGTDGHVAVLDPTTGQAYGIWQAKY
NSSTNAWSGSWGGMTSLNGNGIDTSGSATAAAIARYAGVVTAAEFSAAIA
ANTGINHALAFSTDLAGPDFVYPAIKSDGQNWAGVATPIPEGYRIQLNPD
INVDAIAGMTPGERVIAKTLLTHGAYVVDQGGARMAFAFELLDDATPTSP
GAVWKNAGLAWDYYDMKNIPWSQLRVLAPTATPV
315446161YP_004079040.1 hypothetical protein Mspyr1_46620 [Mycobacterium gilvum Spyr1]MVEAPKPLSPRQVESLNSKAVGTGIKWMSKFNTWAYKATGGRLGAKWRGG
SNRFSAPPPVGILTTIGRKSGEPRESPLLFLREGDRIVLVASQGGRATNP
MWYLNIQANPQVTFQVKNEKLTLVARDATDAERDEYWPKLDAIYPDFVNY
RTYTDRKIPILICDPA
315446160YP_004079039.1 hypothetical protein Mspyr1_46590 [Mycobacterium gilvum Spyr1]MLLEELKPGLRIDGLIPAQVITVIFAQWHGTDALELTYKTNDGALGQQVI
FRKDQDNLTVAQTGSRAFDANATDFKMVAEAQRITLAGLFDPMLAVATSD
VRPLPHQIRAVYGELLPRTPLRFLLADDPGAGKTIMAGLYIKELLLRDDV
RQCLIVAPGGLVEQWQDELFFKFGLRFDLLTNQLIDANVNLNVFETNPLL
IARMDQLSRNEELQAQLAETEWDLIIVDFSSRGNSVRHVRQPAQMRLCRT
PGRYCSRHTARVTEQRPGEGGGWPREHLSTSSRQRTTRTIRRASRYSKSR
PPRSTHAVTAG
315446159YP_004079038.1 DNA/RNA helicase [Mycobacterium gilvum Spyr1]MGSDEQPSTSAIGDEVRGWVDAAAAVTTARHEIASAAATQSAALLARTAK
AHRDNRYLWHVIPLRAEDQSLVQTMARASCVPAVHPDVQRELDRLTTEVA
AATEDLRKVTGFGRLLLFGETRNKANQAAQFLADYRRWFLTSGIAEAIAQ
AKPVDDPRIRALTVRDVLTDSVGFKHQLPDHGQTARLEDSKTFAILPNAT
AVIRRAAAQESQLRKAAVDAGNIVRSKEADRMLADMSVERLREATRDKIR
IGALTANGITTVLDVLANEEILEHFDGIGQTSATRIRAAARTLRQTTYDE
MPMRIDIKNRTPEHTDFLRHLRAWDAARRATASSADMAIVEELAPVAAVI
DNTVTHAIVIPTALSTVQDFRDAVQIVARAARGIAAAQDGATVGDPWEDF
LTRPSDYFALLAELGFITEDDEKTHGDLPTEIVEAVRRFELKGDYLTASL
RGYQSFAARFALVQRKVIIGDEMGLGKTVEAIAAIAHLRAKGEQNFLVVC
PAAVVTNWVREVNAKSKLSAHRLHGPDRQWAARNWQRNGGVGVTTFETLR
WLIDEVSMPTLGCVVIDEAHYIKNPDARRSKRTSHLINRCERAILLTGTP
LENRLDEFRNLVGYLRPDLVLDANEFAPKKFRRQVAPAYLRRNQEDVLTE
LPDLVEVDEWVPMSPADVSAYRAAVEQRNFMAMRQAGMRQGRNSTKMQRL
IEIVEEAEDNGRRVVVFSHFLDVLNDVARHMPGRVFGPLTGSVAANQRQV
LVDDFSAAQKGAVLVAQIVAGGVGLNIQAASVVVICEPQLKPTTEWQAIA
RAHRMGQLESVQVHRLLSDEGVDQRVREILATKKSLFESFARESDLATSA
PEAYDITEAELARTIIAAERERLLGGPAQVANGDNARVTQPAVSTGSDIG
VRPVTPTPAAHTVANNQPKTASSGLSKSADQLSRSRARSDFSSSSSAASA
HDSFDADGLAPYPVFDDRLAPISQTSPEQIMQNVVRIVAQEGPVTGWRVH
QVYSACSAGSHTHEEFSRSLNRAISAAEKRGLIVSDNPLKRTGNKPRTFR
LPTQSAANVRQLGPRTLDIVPPNEVRLLCDQVVGGKPLPDEEIFARIARK
LKLEALSAVDRDAIVAACRLTANR
315446158YP_004079037.1 DNA-methyltransferase Dcm [Mycobacterium gilvum Spyr1]MARSLKLIDLFAGCGGMTAGFKPQGFDPVFSVELNLHAAATYAANFGEDH
IFWGDIDEALKGEVPEADVVIGGPPCQGFSNLGSKDVNDPRNKLWKRYLE
VVERANPRVFVIENVQRFRRSAEFQLLLDEAEQGMLSRYELTHGVLLAAD
YGVAQRRPRTIVIGSRIGRIDLPRPTHSKTPTLGREPWATVRDRIGALPE
RPSTNSLPDARTSFFGQVIPGQFKWLDLHFGRSPRELSLQRYDCIPPGGG
RFDLPDELLSDCWRNKPTGTTDVMGRMRWDAPSLTIRTEFFKPEKGQYLH
PQWDARDPRRRVNRVITHLEAAQLQDFPESYVWCGSKTEIARQIGNAVPV
GLAAALARHIRAALA
315446157YP_004079036.1 transposase [Mycobacterium gilvum Spyr1]MLTVVHDTDEANANDGGGRSLLDEIVRDGARQMLAAALKAEVAAYIDAHA
GELDESGRRLVVRNGSHAGREVLTAAGAVAVTAPRVNDKRIDADTGERQR
FSSAILPAWARKSPQMTEVLPLLYLHGLSTSDFGPALEQFLGSSAGLSAT
TITRLTSQWQEEAKAFGARDLSGTDFVYLWVDGIHLKVRLEQEKLCLLVM
IGVRSDGRKELVALADGYRESTESWADLLRSCRRRGMIAPVLAVGDGALG
FWKAMREVFPATREQRCWFHKQANVLSCLPKSAQPGAVAAMREIYNAEDL
DHAQVAIKAFEIDYGAKYPKAVAKIVDDADVLLEFYKYPAEHWIHLRTTN
PIESTFATVRLRTKVTKGPGSRAAGIAMAYKLIDAAQARWRAVNAPHLVA
LVRAGAVFHKGKLLERPADITPPEPAESTETEVA
315446156YP_004079035.1 Restriction endonuclease [Mycobacterium gilvum Spyr1]MDGPKTDVAWADAAPLTDEPRLAFVGDELRYAQGANQHDVELDGFINYHW
LISPEALALPKIMLEAGINAPAEVVGPDHSRRALIAIRSSPWKAGHETNP
WHDEFDLDHGHVRYFGDHKPSTVGLPGETKGNRLLLDAARLHGGTTREER
LLAPPLFLFRAVTVHRGGRAVMKGYVEFCGAAIIERLEHVVQRDPQTGRS
FPNLSLDLAVVSGGKIDGVDFRWIDDRRNPMLTAAETLRHAPESWNRWVK
QGRIAIPGIRRRVLASAVRSSKDQVPAGGSTEATTLQTLYQFYDGRKHAF
ELLASRVAAEVFRESGARYREGWLSRSSGDGGVDFIGRIDMGSLKASTPV
VVLGQAKCIQPTSSVSPEQVARVVARLRRGWIGVYVTTGSFSRQAQVEII
DDQYPVVLIAGGTLVATVQRMVQANYGGDIEALLASTVDEYESAVTHRRP
EEVISL
315446155YP_004079034.1 transposase [Mycobacterium gilvum Spyr1]MAPTIVQMLKWLGVSKSGFYEWWGRPASAAMCRREELKLKIAALFTSFGA
VYGYRRIHAELVRAGERVGPELVRTLMRELNLVALQPKPYKRTTIAGESA
TAVPDLVARDFTADRPGVKLVGDITYIRTWAGWLYLATVIDCFNKEVIGY
AMADHMRTELATGALEMAARNHALEPGCIMHTDRGTQYTSTDYAIKIADL
DMRASLGRTGICWDNALAESFFAALKNERVHHMVYPTRKKARADIARYIE
LFYNRRRLHSALGYRTPHEVRIEYMNSQLAA
315446154YP_004079033.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MKSIAAASRVKVSADGHGVVSHAGMGLLRELADRTGLSAQVTGALADTYR
GPWTYAPGEVFADLAAAVADGADCIDGVGQLCGDREHAFGAKASTTTMWR
LVDERIDAAHLPAVRAARASARAAAWAAGAAPEPGGWLHIDIDATLVIDH
SDNKHGATPTWKKSFGHHPLLAFLDRPEIAGGEALAGLLRSGNAGSNTAS
DHIIVLAQALAALPAPWRPDPSRGGGPDRPQVLVRCDTAGATHRFADACR
EQGVGFSFGYPVDARVQDAVDTLNLAQGWYPAIDTDGGLRDGAWVAEATT
LVNLNSWPPGTRLILRKERPHPGAQLRFTDTDGMRVTAFITDTPTGVVAG
QVAGLELRHRQHARVEDRIRELKNTGLRNLPCHGFWANAAWLEIVLAAAD
LVTWARLIGFTSDPTLARAEIATFRYRVLHVAARITRGARQLRLRIDATW
RWATSIATAWQTIRTAFG
315446153YP_004079032.1 transposase [Mycobacterium gilvum Spyr1]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
315446152YP_004079031.1 transposase [Mycobacterium gilvum Spyr1]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
315446151YP_004079030.1 transposase [Mycobacterium gilvum Spyr1]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICWDNALAESFFAALKNERV
HHMVYPTRKKARADIARYIELFYNRRRLHSALGYRTPHEVRIEYMNSQLA
A
315446150YP_004079029.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MKSIAAASRVKVSADGHGVVSHAGMGLLRELADRTGLSAQVTGALADTYR
GPWTYAPGEVFADLAAAVADGADCIDGVGQLCGDREHAFGAKASTTTMWR
LVDERIDAAHLPAVRAARASARAAAWAAGAAPEPGGWLHIDIDATLVIDH
SDNKHGATPTWKKSFGHHPLLAFLDRPEIAGGEALAGLLRSGNAGSNTAS
DHIIVLAQALAALPAPWRPDPSRGGGPDRPQVLVRCDTAGATHRFADACR
EQGVGFSFGYPVDARVQDAVDTLNLAQGWYPAIDTDGGLRDGAWVAEATT
LVNLNSWPPGTRLILRKERPHPGAQLRFTDTDGMRVTAFITDTPTGVVAG
QVAGLELRHRQHARVEDRIRELKNTGLRNLPCHGFWANAAWLEIVLAAAD
LVTWARLIGFTSDPTLARAEIATFRYRVLHVAARITRGARQLRLRIDATW
RWATSIATAWQTIRTAFG
315446149YP_004079028.1 transposase [Mycobacterium gilvum Spyr1]MARPYPREFRDDVVRVARNRDDGVTIEQIATDFGVHPMTLQKWLRQADIE
EGTKPGKSASESGELREARRRIKLLEQENEVLRRAAAYLSQANLPGKGST
RS
315446148YP_004079027.1 transposase [Mycobacterium gilvum Spyr1]MKELAADGIPVAVTCRVLKLSRQPYYRWLADPITEAELIEAYRANALFDA
HADDPEFGYRYLVEEARDAGEPMAERTAWRICSQNRLWSVFGKKRGKNGK
VGPPVHDDLVERDFTAEGPNQLWLSDITEHRTGEGKLYLCAIKDVFSNRI
VGYSIDSRMKSQLAIRALHSAVARRGDVAGCILHSDRGSQFRSRKFVHAL
NHHEMVGSMGRVGAAGDNAAMESFFSLLQKNVLDRRRWDTREQLRIAIVT
WIERTYHRRRRQSGLGRLTPIEFEAIMTTPASQAA
315446147YP_004079026.1 hypothetical protein Mspyr1_46410 [Mycobacterium gilvum Spyr1]MLLRRVGQQPRKVAVEPHPDGPEYFYGIDILQAAIDQTPDQRPTRRLRQE
ARELLPAEWAEQLEKAWSPEQPHIDIPPGLFWDETPQPTTQRLTEPVRSR
TSGGCLLCTWSRGGKAYCRECLKEAEEGLFSDRGFDEPWKEAVLWSLRTL
AEVEFGGPPAVNQLKKPPADGNNADLLMLCRILTCRRGWTEMGAERNAYA
WTDWLADAGLLTDGFRASRGVTVMAKDGHICRSLLEREIDDFFHEHGIAH
EPEPDYPYDSEHNVGGYRADWKLADGRVCCTIR
315446146YP_004079025.1 transposase [Mycobacterium gilvum Spyr1]MTTGKDVDSSLVEAGSTVEMAEALRASGAVDELLAQVDSGEVALTGEGGL
LPGLIKLALERGLAAELTEHLGYEKGDPIGRAMPNARNGHSPKTVQSEAG
PVALEVPRDRDGSFTPTLVPKGARRIGGLDDMIISLYAGGMTLRDIQFHL
ASTIGTEVSHETISKIVDEISDEVLSWQRRPLEPLYPVIYLDAMIVKVKD
GGHTRNKAAHIAVGVDMDGVKHVLGIWVQPTEGASFWASVCSDLANRGIK
DVLIVCCDGLTGFPEAIAATWSQAAVQTCVVHLIRNALRFVSYGDRKAVA
AALKPIYTAPSADAAHAELQAFTTSELGKKNPTVTKAFERAWEQFIPFLA
FPPELRRVIYTTNSIESLNYQMRKVIKNRGQFPNDASVVKLLWLAICNIE
DKRAAERAKERGKKLCRTAPGRLVEGQVVTNWKKALEQLSLVYPDRIERY
L
315446145YP_004079024.1 hypothetical protein Mspyr1_46390 [Mycobacterium gilvum Spyr1]MTGYAIAWDGKIVTLPRAGDLNPDGVSWAWIRDDDGNGIYDRRLVEFADT
AFAAQGKRVGRISVSVVLIPRPDNPFDSDAVSIALPKSMGGDEEDRCLGY
LYRHTIHNWGIANEGRKDLVARLAALSADGEVHFTATMLRDSDPADLERY
RCADDEDDWDIPMRMPEFCLDLPDARIMGAAIGAFLAEHETDGCAAPAAR
DRGPHATHVQPAKPLTPMTRWHRRFLQEEAPRLRWLDELADKLIEDLVTN
WVVNTRDMPPPPQYKIRRWGAGGSGVIVTNQDGGRIGKIRNHPLLEARLK
KGHGGYLSFLLLANELDRPAAVEALAREGIVIPFDPSPGWLNASVEPGLH
GWLDVYWSGNLAGLELKPGRVKWSV
315446144YP_004079023.1 hypothetical protein Mspyr1_46380 [Mycobacterium gilvum Spyr1]MSNQNLTLIAFLLDRSGSMQSIKSDVVGGFDAFLAEQRAGDGDCRVTLAQ
FDNEYEVVYRTVPVSEVPPLVLNPRNSTALLDSMGKLITDTAAEIAALAE
DDKPGSVIIAIMTDGLENISHEWSRPAIKSLVEQQTNEFGWEFLYMGADQ
DAVEVGKDLGVKAEQAVTYSRGKSREAMAAMSGNVRGYRTARIVDAQAVM
PGFSEEQRLDLTDE
315446143YP_004079022.1 hypothetical protein Mspyr1_46370 [Mycobacterium gilvum Spyr1]MLTEVSLLLDEQLARAVVDDEMSIAAAGKSAGLTENAVGPRLASTPRLSP
YASNGSRITAEDVKRARNDKHARKPLPPAAPAEPMRFKPRRKAKPR
315446142YP_004079021.1 exonuclease III [Mycobacterium gilvum Spyr1]MGTRIATLNIRHGGTKSAEALAGRLLGYDADILVVTEFRANAVGERLIDR
LAQVGYDTSHPDVGVKENTVLIAARGGIDRSWAFTESLDRRHLWCTEIDG
AYVCGVYMPQNTAKLPYWEALIDDVRPSGIDLLIGDFNTGNNDLDKAPRG
AKFIGPEMPGRLIASGYTDMWRSLHPDVREYSWFSRPGDNGFRLDYVFAG
SDLAQRIRFCEFDHAPRTSGETDHSGLVAIVDG
315446141YP_004079020.1 DNA/RNA helicase [Mycobacterium gilvum Spyr1]MLPGFAHLSPGSKVEGLAFDAVVEIVDITAAGSGAFVRYRDEFGIEDSRL
LSADELTNILPVGGRGPTLAADPDHFWLAIEALRLRHAAVLNPLLAVSSS
NVEALPHQVQAVYDCMLTGHPKRFLLADDPGAGKTIMAGLFIKEALARGW
IRRCLIVVPGSLVEQWQNELREKFALHFEVFENSLLGDSPDKSLQDFPFL
IARLDQFSRNSELMAHAVDGEYDLAIFDEAHKLAVSSWGSTVTKTKRFKL
AEAIRDAVPSTVLMTATPHNGKDADYREFLTLLGSADQPVVEDPAGDGLM
RRLVKEQLVHLDGTPLFPERRASTVPYRLSPIESELYEAVSEYVREEMNK
VSDDDTRRSVGFALVVLQRRLASSPQAILRSLTRRRDRLRAQADQAQAAE
GKLAVALAATLGVGNDDPDEMSSVRAETYQDEVVSVATNARTVAELEAEI
LVLGRLVAKAEAVYSARADAKWAALAELLTSEAMFEADGQRRKIIIFSEN
RDTLDYLEDRLVGLLGRTVDVQVIHGALSWTDRRRAQANFITEPSSSVLI
ATDAAGEGVNLQVAHLMVNYDVPWNPNRLEQRFGRIHRIGQRHTCHLWNL
VAADTREGDVFRTLLEKVEVQREALGDQVFDVLGEVLTEISLSQLLRRAV
GGEAQRGEIESELESVSGRLESAVEKRAASVSTLTPEELAVLRREMEIAK
AMSFQPDVARDFMLRAAPLFHVDITMRGDAWQVGYVPTRLRDEFGSSLMA
RYDRVAFEHSDDQVFAADPPELMAPGHPLVSALADAIGDEFGSSLNHGIV
LSDNRSSDDYVLVTVVATAEGNPSTVTTYAVTVGGDRQQVSPGLYTDLEM
GATPEPREVAAAEAVVAAFSDDYPDYDIAAVAYVRGTASPQTASAWRTAR
EQLRDELTARGLDPVAALPGQGWDFTTGHDEIIFWSAAPPGETERRRTEK
QVAANVGGKYRVEQG
315446140YP_004079019.1 hypothetical protein Mspyr1_46340 [Mycobacterium gilvum Spyr1]MDIMVASGVQLDHAWVGLGAEFGAALRDWSRQVLALVVEEADRRGAGMLL
IAGGLFDRAYVLPATVDYAAQILGTFSGDVVIVPGRSDWIDGTSLYSTHR
WAPNTSICSSSEYQPCATAPAVWVSAWTSPGGAVPRAPDVPEPHVLIRAG
TAGGDGRVLDVPNLVRDPREPGGFAVLIDGAKLEEPARRVELPDQPGSLA
DLDVTDAAHTDALATALEGMLTPGDPLLLRLVGTLAPGVLLPGFSGPDRD
LPSEVVLDVDSLSFATPSVDAADRSARAEFLRAMAYTNTSDLQRHQTTAL
GLAALDASAQGT
315446139YP_004079018.1 hypothetical protein Mspyr1_46330 [Mycobacterium gilvum Spyr1]MRIDRVICTAFGPFRGETLEFAPGLNVVHGPNEAGKSSWFNATYTALAGR
RKYKGRGSAAETEFRNRHKPWSGSKWAVGLAVTLDDDRRLAITQDLAKGE
WTIVDGSTTRAVPEAELLTDTSLDGTRLLGLNRQSARSTIFTGQADILRV
RDDAGELQELLERAASTGATDATADAALAWLKERRSEWVGVAHGKKPLAA
TRAALNASREVAQTRRDDLAELHETIANRQKLAAPLVKARAKVALSERLV
KWQSVYEMRNRVEKAVELSARVAESREADLTVDEEKVAAATNVLVVFDRG
TDVVPLGEGPTAADLQAQIDELPQVPEGDREPRQDVIDAHSDLVKAQTAL
DTHMQAAPPDVEPTPPTALSADELRTFADILASSPPEVDTAAVEAFQQDR
ERRTAQLAALQREVDDHDATYRQAKVDYDAAVENGAMALELAALHAIERS
AAEDVIAASRRQVALLSEALSAQENQAGVMAQEVALRRHQERVDAAHAQV
QGDSLDADPEALKRIAREIDAAGAARIAAAKHADHAAEFRAARDDRVRTL
SSLLGGQNPLTTEDPVVQTLQMFTDYVDACKSRAEVAQQAARRADLVEAH
SQRLQLEANHRQALSLRETQGREVVELAAALGVTADPLETAIEQLRRWVS
EQEEKRVAMTTWKTDVALLEQLLGGRELTDLQSELAALTTDAGDEPEEPM
PPDLNTFVAEAKALYDRMIDLDGQLKGKIQALGNALGSVADAVEVEADAQ
RAADQVETLASCLDAAAAELTNAKERANASIAPALADRMRPWLPRVTNGR
YRDVTVDPGDLTIHVTETTGQVRQADRLSLGTTEQIYLLLRVTLSQVLSG
GTETAPLIFDDVTTQSDTTRTVAVMELLHELSAEHQVILFSQEDEVVEWA
QRNIDPTRDTIIPLPAP
315446138YP_004079017.1 hypothetical protein Mspyr1_46320 [Mycobacterium gilvum Spyr1]MPSVQIKDVPDDTHRVLRERAARAHQSLQEYLRSRLIAEASQPTAEEVFE
RAAVRKGGKVSFSAAVDEIRAERDRR
315446137YP_004079016.1 nucleic acid-binding protein [Mycobacterium gilvum Spyr1]MIVVDASVLAVALGDDGADGRLARQRLTGEALAAPELIDLEVASVWRRHV
AAKLMTARRADAAVSDLADLPLRRCSHRPLLERIWVLRRTVTPYDAAYAA
LAEALEVVLVTADVRLARAPGLACDVEVIGSSG
315446136YP_004079015.1 Plasmid pRiA4b ORF-3-like protein [Mycobacterium gilvum Spyr1]MRDRSHLRVVTDLESRPDLRHPRRSDVVVYRVRVDIDDADPPIWRRIDLR
SDLTLDVVHQVLQVAFDWTDSHLHRFSLGGGAFDWDSQLFLCPYDVVEAD
FEDDGVPAADTHLDETLTATGDALHYLYDYGDNWELTLRLEQVLPAEGAC
AAAVVVDGERAAPPEDCGHLVDAASLAKVLPDPARFEQDRINDALRGPFF
VLREAKVDPRLVDLVHRLGYTAHSDSLSHVALALTAEPARLEAADLVGHL
RGFQWFLDRAADGGIPLTGAGYLKPADVVEASKVVPVMADWIGAKNREAH
CYPLLQFREMLQDLGLLRKYKGQLLLTKTGQAAQRDVNALCEHLAGRLNP
KPGDEFHVQASLLMLAYAAASPDAQLPLSTISALLTELGWRHANGTPVTD
SALRHLPFYEVLSNVTDQPATWRRRNVISPGAAALARRALGL
315446135YP_004079014.1 hypothetical protein Mspyr1_46290 [Mycobacterium gilvum Spyr1]MKRLDLVVGSNGAGKSTFIELTLAPLVPRSVYVNADEIAKRRWPDDPARH
SYEAARIAANTRARLIELGESFIAETVFSHPSKLELLDVAHAAGYTIILH
AAMIPEELAVQRVRHRVQAGGHDVPESKIRQQYQRLWDVVATAAGRADEA
TFYDNSAIRGPRIVVQLAAGIAVGSALWPDWTPAPLTSRWAGG
315446134YP_004079013.1 hypothetical protein Mspyr1_46280 [Mycobacterium gilvum Spyr1]MSNTADRVTRIAADLMDSAAAEGARQSRSAKQQLDHWARVGRAVSSQHSV
ARRKVEAALAGDVPLRDLTDEEGVVFNAEISAAIQERLVRADYGAVLAAR
GVTTVALDEDGEIVQYAPDGSSVRLGPGA
315446133YP_004079012.1 hypothetical protein Mspyr1_46270 [Mycobacterium gilvum Spyr1]MSALVRSVRVMSDGRRNRKMKQARRDALRAKKRRVDAAPEPPPDDRPPIS
IAMENPWGLLMFASEKVEAAKPDPLANWRPGERNSLNFGHLLQNFLDAPN
SENALFVALFSELLDDEELQQRYRVALDAYQGPLPLWVTGLREVEVHRAV
RHSHVLGDFDELWIGARLADGREATCVIRMEHLEDSEIVDAGLWVDAIDI
HVRRSSDADVTTMDMSLADARAWIERSLQQKFIFRKTATWPGCRPLVQWL
VGQLPEGGDGYQWPGSAWGAGRELSDDFFGSEAGARFDRRDHTLLLTELM
ESGTGDPLRWSARRVEHVLESTLLHDHSLKVLLEVPALLRAYIPFAHQRS
GIRDGLTAEALAALDESQTGDGLSVAG
315446132YP_004079011.1 AbrB family transcriptional regulator [Mycobacterium gilvum Spyr1]MEAVIDSGGRVVLPKQLRDALGLTPGTKVDISAYGGGLQIVPGGRTARLE
RDDDGRLVAQADTVVTDEMMFAIIDSGRR
315446131YP_004079010.1 PIN domain-containing protein [Mycobacterium gilvum Spyr1]MLVTAVDTSVAVPLLVGSHREHAAVAKWAKGKTLGLSGHALTETYSVLTR
LPGDARLLPQDAVALIDANFTASLTLGARVARRAHRELARRGIGGGATYD
GLVALAAREHGVVLATRDARARATYEALSVDTEVVA
315446130YP_004079009.1 SEC-C motif-containing protein-tetratricopeptide repeat protein [MyMAAQLDPTDVLARILVENGPLREDDIAHRLREAGIRNPDDVLPQLLNEID
CPAVPLVDESWVWLPELMAGRILTHRVDAQELAHDILIVTPDLDPLTHLC
EFEEFARLADGTPISVALPAFDEDVLDERGVPPDMVDDGGALILPPGTLS
DLDVAAGELVGLRLTPAGLTLTRVTAETSPSVGAALAATLDPEEPVAFDS
AVWSACVADTALFTEPVEPLSEIADAHNLVRRLDVLAPAEFDYDRWRFDI
DCEVMSRRYDIAEDAALALRTLVSIYEQMSQLLTMPLSDDEEVPDGDAPT
PALAGYRELVAEFGAELADPHLAEVLLAETVGRNPDGAAALGLFAETLEP
QVPRRARVAFRWLRSVALERIGDIEAAERELLTAETMDTDWPLPLYDLAR
IASDRGDVERALALLHRAGAAPDDPLFTVLRSHRPEARPDVGRNEPCWCG
SGRKYKKCHLGKEQLSLPDRVGWLYSKAAQHALISGWRGLVAELNYERNR
HHDAPDEAIDPVVIDAVLFEGEALADFLAVRGPLLPDDERSLAEQWLLSE
RSLFEVEEVHPGRGLVVRDVRTGDVHEVRERTASRQLTARQLICTRLLPI
GDGTAQLFGGVEPVALHDRSALMELLDEGPAPVEIVAFLSRRFAPPMLTN
TEGDPLMICEAVVRVSDSARMEAALDGTYDRVEDAELPQWFEHVTTDGMD
RIRATVVLEGDTLRVETNSEERMDRVLETLERLDPGMQVVDDTRTPMDDP
REMAAKMPATAKGAVDPEDPQVAALLDAMILDYETKWLDESIPALDGHTP
RQAADDPTRRPDLIRLLDSFPTDAGRHAMNADRLRAALGLE
315446129YP_004079008.1 fatty acid desaturase [Mycobacterium gilvum Spyr1]MAIADVSTYTHLSSRDIEAIADELDAIRRDVEESLGEKDANYIRRTIAFQ
RALDVGARLVIAGSRSKAGWLLGTASLAYAKSIENMELGHNISHGQWDWM
NDPEIHSSNWEWDMVGSSAQWRYSHNYRHHVFSNVLGMDDDIGYRWLRVT
TDQPWRRAHLSTPVRNLVLAATFEWGIALHGLRSERDRGETPAAVAVEKR
KFFGKAARQLSKDYVVLPALSLRRWRRTLAANLTANLLRNVWVYVNIICG
HIPDGAETFDPAVLDGETRGEWYLRQMLGAANFKAGPLLAFSGGHLCYQI
EHHLFPDLPSNRLAQVSVRVRELCEKYDLPYNTGSFPRQYFRTQRTIHKL
AVPDGLLTAR
315446128YP_004079007.1 hypothetical protein Mspyr1_46220 [Mycobacterium gilvum Spyr1]MNPDVNAISPAEARRRFRDGLVTPTAGWSAGYAQANLIAVPRDYAFDLML
FAQRNPKPCPVLDVLEPGQYAGPLLAGGDIRTDIPAYRIYVDGELVTEVA
DATEYWTDDLVAFLIGCSFSFEAALLDSGVPVRHIEEDVNVPMYRTDRPC
RSAGRIGGPLVVSMRPLPPEQVADAVRITSRYPSVHGTPVHVGDPAGLGI
AHLSAPDYGDAVTIRPGEIPVFWACGVTPQAAVMQSRPPLAIGHAPGHML
ITDLRDSELVVP
315446127YP_004079006.1 Mn2+/Fe2- transporter NRAMP family [Mycobacterium gilvum Spyr1]MATPEEPLNPSVDTAPKPSEPARTALLGAMFLMATSAVGPGFITQTTEFT
VELGAAFAFAILASIVIDFAVQMNVWRVIGVAGIRAHELGNKVLPGVGYA
LAVLVVVGGLVFNIGNTSGAGLGTDAMFGLDPRIGGAISALIAIAIFLSK
RAGIALDRIVVVLGIAMIAMTAYTAIVSRPPLGEALRNAVLPEQISFLAI
TTIVGGTVGGYITYAGAHRLLDTGITGPENVSRITLGSTYAIIVTGIMRA
LLFLAILGVTAGGVSLASDNPTASAFEYALGAAGGIIFGVILWAASITSV
IGAAYTSVSFLTKSTTPRRRQNILTVGFIALSAALFVILGAAPVTLLVFA
GAFNGLILPIGFTVVLWVAWVRRDLLGGYRYPMWLKIVGLAVWLLTLYLG
WNSLSGLSSLWS
315446126YP_004079005.1 X-Pro dipeptidyl-peptidase (S15 family) [Mycobacterium gilvum Spyr1MRAGTYVGRVGGLAVALGIGAAVLVGAGAAAADDDTGSSQSRSSQSAKPA
TQESDPRSAANAAGDSSDEATEADSATASSDDDTETEETAAADTVVEDTV
VEDTAVDDSDADLADEESEAEEVATERHPAKVATAQLTRDIAVVVDDTQA
PETPAAPAITSLMTSVAAAGREATQEPAADRATTAEAPQYDLPTDVVVTE
WTPPLEWLQTVPLFGRFVMTPLVGLLHNIPLIGDVLHPVFGFPIDHNAPP
GTPRARSFRVTSFDGTRIFVNFMPAKGLQAGESAPTILNGPGVSLPGSTT
LELDVDSLLPDDVIGIGALRKAGYNVVTWDPRGEWRSEGRMQLQSPDFEG
RDVSHIISYLATLDEVQTVNGDPKIGMVGASYGGGIQLSTATIDHRIDAI
VPTIAWNSLAHSLFPNGAVRNGWGTILSTALILTLARPNERVLPATITGV
LTGKVAQSDLDLFESLNFADRLANITAPTLLVQGTVDTLLPLSQADLNAK
ALIEAGTTTKVVWYCGGHGACLSSVNNGDLVVDRTLDWLDRHVKGEGIDT
GAQFEWVDQNGDWYSSDTYPASQDLTPITAQRTEDQSMLFFPFVGGAGPN
PLIITRGLVATLLGLPSGAPAVNAVNLTVTVPPDDAGTTHVVGAPEVTLT
YSGTGTAKHVWAQIVDDETGLVLGNHTTPIPVQLDGNSHTVTVPLEQVAH
TLMPGQSVTVQIVTSSFAFLNFYSGGAITIDELSVRLPTLAAGQAAQTVA
A
315446125YP_004079004.1 hypothetical protein Mspyr1_46190 [Mycobacterium gilvum Spyr1]MSFKGAVNRATGSRTVEWIARAGYPVNGLLHLLIAYIIARIAFGFAGEAD
QTGALATLAEQRGGATSLWVVALGLVALAMWRLAETVVGLHPGEHSYAHL
RDAPLINRLKAFGLALVYLALAFTAAQFALGVGRKGTERAEGLSARLMQT
GEGKAVLVAIGLAIGAFGSYFVYKGAWRKFYGDLTVPGGRLLTVLGVCGH
VAEGVVLIAAGLSVIGASFLRDPSRATGLDAAVEAVGRAQFGQVLLLVAA
AGFAAYGLYQFALTRYSRM
315446124YP_004079003.1 nucleic acid-binding protein [Mycobacterium gilvum Spyr1]MALRPWLIDKSAYTRLAVSPDVELWMERIDRGLVRISTVTRLEIGYSFRT
AAQARSEVASPPLTLMPIEYMTPTVEDRAREIQLTLADRGMHRAPSIPDL
LVAATAEQAGLTVLHLHKDFDLIAGITGQPVEALRMG
315446123YP_004079002.1 hypothetical protein Mspyr1_46170 [Mycobacterium gilvum Spyr1]MADVLIRGLSEAAVAHIDAAAAAQGLSRQEYLRRRFEAERPRSDSGGRLT
IDDLRRASAAASDLDNPEAMDGAWH
315446122YP_004079001.1 ERCC4 domain-containing protein [Mycobacterium gilvum Spyr1]MVELLIVRNPDDGSRLQYLMRLPQPGGDLLFRTSDTWPRVKALYCHPVGL
DEWPDDPEIVERIPLRSCQRRGASIDVIAQRGRENRSQVVFTTARGRDAV
FWQSPRTRKQARPNVRTPTARAQGLEQLHILVDTHERYAYRFATQQSITV
PKPLPCGDYGLEVDGALVASVERKSLADLVTSLTTGRLRYQVADLAALPR
AAIVVEDRYSQLFKLDRVRPAVVADGLAELQVRWHSVPIVFCETRPLAEE
WTYRFLAAAHAWAVTEAAALQRISPVRIDVAVQAPTNGPSTADVRAWARS
AGLPVPDRGRLRPEVWQAWRDAHPE
315446121YP_004079000.1 hypothetical protein Mspyr1_46150 [Mycobacterium gilvum Spyr1]MSEQPITELSVHIPCGGLRGPVQLRGRRYAPGEVRWQSCSDEVRPVRWAD
SDVSRECDLCVICLRATAGGRSRWSWLACENCRAVNSAVETGWGIRPFAL
GRHSVMNGIAVRCGAPRDIRQQQIERVAWFADGFGRLREWRNDEFARLAR
RFDPEADVPLRLWQQEWPPGPRASRDAFARVIGPEFVPPPL
315446120YP_004078999.1 vancomycin resistance protein [Mycobacterium gilvum Spyr1]MRADRAQPQVITATAPAEPARPRRRRLLWTLIAAPFALLAVAYIGDLLYS
KDRVVRGVTAAGVPIGGLTLTDAEDRLRAEVSPRATRPIPVTAGPARDEI
DPASAGLTVDWRATVEQSGAQPVNPITRLTSLFETREIGVVSTADDDALT
AALDRLDETIAKDPVEGTVRFDGREPVAVDPENGLRLDVDTSADLLKRDW
ATGRTIDLPIVEPEPATTASDVREAIDDVAAPAVSAPLVITGDDDTRATV
DEDVIAAAMTFDVEDGDILATVDENVIVDAARPQLADSETPRRDATLDFA
VSPPAKVPSEDGRRIDYGETLNDVMDVLTSTDDREIAAVYVDAAATFTTE
DIAKLGPVEVIGEFQTSGFSGASGRNIKRAAEAIDGIVVAPGETFSLNGA
TNPRTAANGYVESGIILNGRPDTGVGGGVSQVATTLFNAAYFAGMDLVEH
QEHSYYISRYPAGREATVFGDEIDVKFRNDGPTPVQIQTTWTSSAITVQL
VGIKRYEVSSAQSPRSKPTSPRTITIPAGESCSASGGAPGFTITDTRTLR
DIVTGDIRTESHTVRYDPIPKVVCGG
315446119YP_004078998.1 acyl-CoA transferase/carnitine dehydratase [Mycobacterium gilvum SpMPSAGPLSGVKVVDLTAVVAGPYCTQIMADMGADVVKVEAPQGDNARYIS
VGPEPGLSGVFTNVNRGKRSVVLDLQTDAGKDALRTLVARADVFIHSMRA
AAIAKLGFDYAAVADLNPSIVYTNCYGYGRTGPYAARPAYDDTIQAECGL
AAVQEELTGTAGYVGSIMADKICGLTAVNATMMALFHRERTGEGQEVEVP
MFETMAAFMLVEHANGAMFDPPLGPALYPRTVARNRRPYQTSDGHLAALI
YNDKQWQAFIDAVKPAWATDRYATMAGRAADIDTVYGLIGDALRERTTAE
WLALFDELGIPASPLRSTGDLFTDPHLDAVGFFETVQTVHGPVRFPGVPT
GFSRTPGRVRGGAPRLGEHTAEVLADWGQEPVK
315446118YP_004078997.1 hypothetical protein Mspyr1_46120 [Mycobacterium gilvum Spyr1]MFARRAASAGIAAVAAVGLAAPAAAAPEDAVFLDRLQKAGIEVFNPSATV
FYAYGVCRQLDLGMPQTRIVDFVMSDNSNLDWEAAADYVVLANMTYCPPV
315446117YP_004078996.1 hypothetical protein Mspyr1_46110 [Mycobacterium gilvum Spyr1]MWLKWLTGQLMFGRRANAGYPRFPLSVGERIIVTWGRIDGRQANVVQTRG
SAGIAARVFGRWGMNDE
315446116YP_004078995.1 hypothetical protein Mspyr1_46100 [Mycobacterium gilvum Spyr1]MSDGFDGTPMVVCPHGHLNAWHYKFCGQCGSPIGAVAFPDDDPVEVERRP
RRRGLLIGGAVAAVVVLAAAVAVTVLMAGSSSDDVAVPQPGGFGAGTVDP
AGMVPACTTPPLVQAESVDMTGDGMTVDAAFMSRCAGGDTEAAPSARITV
ADGERDIAAGIFDFSAAPLSMKPGETARRTLVFPAGMYWRTTEMFSGAPQ
LVFHPGEQADATTATVSSGSDRLVAHAVAEPEHGSIDGVAEAVLRELRDA
DYGYVSASIANRWVPQISAKKAGLVVDGATITSADVLRDHYDLRAKYSGV
RLVSSAQWTTFDSDDFWVTVVGTPKLSPAEANGWCDANGLGVDDCFAKFV
STLFGVEGTTAYRK
315446115YP_004078994.1 hypothetical protein Mspyr1_46080 [Mycobacterium gilvum Spyr1]MNEPALLRVERVCAELATSGQPITFTTVAEHAQISRATLYRDHQLRAIVD
EHRTRQTDARTLTGLATEVAHLRTAVEALAAEVKRHEEQIRKLTKPPRR
315446114YP_004078993.1 site-specific recombinase XerD [Mycobacterium gilvum Spyr1]MLPEHDYAPTPETPAQIYAAYLVHLQRRDRGNTAYAQAARSFLRRWPRVQ
SWADIPLDEQLAANCSTRPFVTFLMVSRRLQPGYDYLVHRKLSSLWHELT
DSCLQPDLDQFISAALELGFTERVASAIGSQIIARLLIQTGRPLTGLRES
DLQELLHACHVRQERTGRGAKHYRSTTHSARQILFHLGILDTQARPAVTA
LTLEQRMVDVPVALRPAFVAYLNRKYATCVPKTVSSLATRLAHFGRYLAA
ADPSLTSLNQLDRRRHIEPFITSLTTATNSVTGEPITVADRIRRIHAVGN
FLAEITEWGWDDAPPRRLIFRTDLPRPPRCLPRYLPVDSDRKLTAALAKS
PYRLAADALLVQRACGLRIGELLDLELDCIHEIPGQGSWLKVPLGKLNSE
RMIPVNDEVLTLVDRITTTRSSGRPMIHPRTGAPADFLFTHHGKRLSQNA
VREELNRAAQAASLGHITPHQLRHTYATALINAGVSLQALMALLGHVSTQ
MSLRYAHLFDHTVRTEYERALDLAKSHIGALPKTAVGLPITDITGTGWKD
TPAIKSRLAGGYCLRAPAQGSCPYANICEHCPSFHTDSTHLAVLAAQRID
AQDLAADAEKRGWIDEAERHHNLVSRLDALITGSASA
315446113YP_004078992.1 site-specific recombinase XerD [Mycobacterium gilvum Spyr1]MTIQHQLRLQAGTDVAWVLSGPGCGKYALVNEYLRYLADRNYSPRTLRAY
GYDLLAFCRWLGSVDVELSSVTTETVLDFMRHCRQTPIAGRPTNVVSMTG
TRLDRYSSTTINHRLAALTGLFTFRELRDPGLRTPIPSGREARRVSAEER
NGLLGHLVRPKRRSALRLREPRRLPRALNRRETAELLSSLRTWRDRALAG
LMLLSGLRSGELLTLDVTDVDIGARWVKVMGKGAKERRVPLDVEVAGLIQ
TYLLVERPESDSNRLFLVAKGPHRGQPLTAAGLRTIFRYHRIKSGVLAGH
PHALRHTFGTAMAEAGVDLAVMQALLGHAHIDTTARYIHLAPTHVKAEYD
AARTRLRSHT
315446112YP_004078991.1 transposase [Mycobacterium gilvum Spyr1]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICLLTG
315446111YP_004078990.1 transposase [Mycobacterium gilvum Spyr1]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
315446110YP_004078989.1 hypothetical protein Mspyr1_46030 [Mycobacterium gilvum Spyr1]MGFCVFCGGALTDAMRCHSCGAVNIAGTWHESAYSGGTGGGWQPDPTGRH
EGRYFVGGQPTDLIRDGGVEALDPVGRHELEPAGVDRLPVSAGRRGRRGW
IVAAAVLAVLAIAGAGVGAYAYVNRDRTTVDDRYLVALKQSGFAGEFNSD
ANAVAHGKQVCRALEGGGPQQGMPADEVAVQYFCPQFVEGFHVLETATIT
GSFTLNDEDPNRYSPAIEVDGSSCVGAGGYSDVNPGTPVTVKNGKGEILT
TTYLEDGRGGRFRCTFGFTFEVIEGQDRYVVAVGRRGELSYSFDELRAGG
VSLVLG
315446109YP_004078988.1 Calcineurin-like phosphoesterase [Mycobacterium gilvum Spyr1]MTDGGYDIIGDIHGCAEQLEKLLHTLGYRQDGRGGEYRHPQRRAVFVGDL
IDRGAGQRRTLEVVKAMVDGGSAYAVMGNHEFNALAYHTESPPGSGKYLR
AHDDPDDPRSAKNTDQHQAFLVQVKGTERSHYLRWFTTLPLWLDLGGLRI
VHACWHDESIAVVQRECGSSAPFSDVRHLIAASTPDKPLYTAVETLLKGP
EISLVAHGQQPFKDKGGHPRKSARLRWWNGDARTLRELSEVAGNYTTVDD
KPYPPLPDLDVSAVSAPHLYTAQVPVFYGHYWRSGEPERGGDWTDYTACV
DFSAVMGGSLTAYRWSGEPTIRPEHYVGVPPRSGSAHPSTNDTPPARNSS
NE
315446108YP_004078987.1 ADP-ribosylglycohydrolase [Mycobacterium gilvum Spyr1]MTSHDDRIAGVLLGTAAGDALGAPYEFQPPRGPDLDVRMAGGGVWEPGEW
TDDTAMAIAIAEVAATGADLCDERAQDAILTRWREWSHHTKDIGVQTSSV
LRAASRGSAITAARARDASRAHHARSGRSGGNGSLMRTAPVALAYLDDED
AMVEAARAISALTHYDPEAGDACVLWCSAIRHGVLTGDLDVRVGLRHLGD
EGRVTWSERLDLAETSRPRDFPKNGWVVSALQAAWSAIATTAGSEADPDA
AGTGHLPRGLDAAVRAGFDTDTVAAIAGGLLGAVHGASAVPQAWRELLHG
WPGLDAAELAELAHAAAR
315446107YP_004078986.1 ADP-ribose pyrophosphatase [Mycobacterium gilvum Spyr1]MNAREYRDSSRKRLTDYPRPSVAVDSAVLTLDEQGGLVVLQVRRENRRGW
GLPGTFLHPGERLSDAVKRSLRVKANVEGLDPRQLYVFDDPDRDDRGWVL
SVAHVDVVRPERLADRFAESTRLMPVGSPGRLSFDHADIVARALSYLRDR
YARSPDPDHLLDDEFTIRELRLAHEAVAGEPLQRDWFRRAMEPQLVATGV
MTSRGRGRPAELFRRP
315446106YP_004078985.1 PE-PPE domain-containing protein [Mycobacterium gilvum Spyr1]MSSARHVGRIGALALALGIGIGLGSAAGTANADDSAVSNSRRAAASADAA
GGPSRGPATNSPDRDEPATAPAARTRAQAKPSSSRVSEARARKSDRLDDI
SDGDISNGDISDDAAEDRTPDADADADVPVTSAANSPEPPARSTSLWTVL
TAAWRQPGRSGTDATAGSQVTDPRKPTVDDPDIPATAPLEEPDSSPLPVH
SPTAPDVPSETRTVVTIGGLGSTPEEAGDYLQGYPKSPGNTWIPLVYPAA
ARQSSITQGAANLDRLLRSTTGFVDVIGMSQGAQVVGEWLSSFAQDADAP
EPDRMRFTLLGNPSRRLGSNPDLMGWNFRRVALTPEDTAYTVRDIAKRWD
GWANWENWPNITRESGTELIRLFLGMFTDHRGYDNVDVAALMVRAVVGNT
TYYVAP
315446105YP_004078984.1 hypothetical protein Mspyr1_45980 [Mycobacterium gilvum Spyr1]MADHSSPGDGSVLVAIFALLIIAGLVVRYIWWVVGAAALAGVVYLCVVLT
RKAEERRLRDEKLAAEREFERARLAERQHRWTMIGDSRAVYGEKGSAPTA
DITGTDSAPDTDEPIATLAATKAELDALIRDRPQGWEQALFASILMQRAA
PLASRLRDSELGYTEAGASGLMSAGELASTVVHMLDEMMRTIQQLDRFMM
APAFMAAFTAPDDVDEDGADPEAIAHIAHRVMDYHERLLELSERCRGISA
PAYYDDILADCARMLDAPLRSYREFIDEFAAVIRALPRVLPHASGPVDLG
SLGLYISIDNTLHSRILRRLDEITAPRRA
315446104YP_004078983.1 ribonuclease HI [Mycobacterium gilvum Spyr1]MAPKPVAGTRPLDIVTARSRPMLSVALAVRPRGRSVFAYSANSAQQCWSG
TVDAESADTATLDVIRRIRAAADAERIRFVVQLPARSTLWALRDEVALLM
PGVWIERPRFSDEALVRGALSGLREVMAAAPVCVATDGSVRGKITGYGWL
ASSGEYGLQGFRHSTKLIGPQVVLVAELRAIGAAVQRLRGRDITVLSDSR
PAIGMVKRWMDGEDVLPEGYLAYRESGKTPGLVRARQMIFEDRARITPLW
VKGHRGEPLNEGADALARLASRYALGDSALDAAEYHRRASDLAVTFSREF
TRARSA
315446103YP_004078982.1 nuclease-like protein [Mycobacterium gilvum Spyr1]MAITPDETPRLANNAERKVYQLLLDQLGDGDLVIPGKRVTDHLKDHEIDF
CVALEGAGVLCLEVKGGEVWHDGKGWRQLRGGREVSIEPVRQAREACYAL
RDFVEKDPRWSQHRLRWDHVVVLPNTELPQDFALPECPRWKVIDRTDLAD
LAARLRRILLDQELDRPLLSAAGIGQLIRVLDGRGLPQRSVVARALENED
AADVLTEQQSVILDAIKLLHRVEIRGGAGSGKTFLAMEQARRLARAGRRV
ALVCYSHGLASYLERITATWNRRHRPAYVGEFHDLGKQWGAPAGPDESVR
NDETVRFWEHDLPSQMTRLATQLDPGHRFDAIVVDEAQDFADAWWDPLLA
ALKDDETGGLYVFSDEGQRVFDRFGAPPVPLVPLILDHNLRNTRQIADAF
QPLVDHPMRALGADGPAVKYVPCSREDAMDTGDDEVELLLDQGWRPEDVA
LLTTGSRHPEQRERQAAGSAAYWDSFWDAEQVFYGHVLGFKGLERRVVVL
VVNEESAFERSRERLYVGLSRARDQLVVCGDPEFLRTVGGPDLARRLNIP
Q
315446102YP_004078981.1 redox protein- regulator of disulfide bond formation [MycobacteriumMLGRPPGRATASRLRHPVTNPEQLFAVGYAACFHSALRVVARQQKADVSD
SAVGAKVELGSLEDGGFGLAVELEVTLPNVDHETAQKLTEAAHQVCPYSN
ATRGNIEVTLTVTDD
315446101YP_004078980.1 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protMHVDEVTGHLMEGQPGIPADLVRTLLGVLRQRLGLDTAWLSSFHDDTQTI
EVLDGDAASFGLSPGLRTPLSESYCVRVIDGRLPSVVPDTSQNQTTHALP
VTDEMGLGAYIGVPVPGHAGTTSGMVCLVSQEPKPYLGDDDLRLVKQAAE
LIGTLIESPVRQADSVDRRSAIRRVVSELDFEVVFQAIHDVASGRAVGVE
ALARFPCEPFRPDAFFAEAAQLGIGIQLETAIVRRVLSLLPQLPDDVFVS
INISPAAALVAPWSELLADVEPSRIVLEITEHDAVPNYGALDDVLEGCRA
QGVRVAVDDVGAGFASFSHVLELAPEFVKIDHSIIRHIDVDDARRRLAQA
IAEFAGQFGAMVIAEGVESQRELDAVRAAGIGCTQGFFLSRPKAHGHGFP
AATATADPSEPLPAAVDLLGERRFELALAHSPIGMAVVGLDGSFLRTNRA
LRAMLGYSRRAMSELTFQDITHPDDLDLDLALVNECLEGRRRSYRIDKRY
IAADGSIVWCALTAVLVHAPRDQPRCFVSQIVDVTADRLREAELARRAST
DPLTSIANRSAAWTRLEQLDQSGEGYGVLFCDIERFKSVNDRHGHHAGDQ
LLVEVAQRLHDTLDPFDLAARWGGDEFLVITRCVEEPALACLAGRIIDRM
DATPIRLPGGVEESVAMTIGFAAHRPGDGRSVDDVLDLADQEMYEQRRRR
PRVRRKLSVSRPR
315446100YP_004078979.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPDSEPHPHGLRERKKVQTRLAIRRAAFELFDTQGYANTTVDQIADAADV
SPRTLYRYFGVKEALLISDDQISPIVEAFADAPPDLPIVDAYRHAVATVF
RELTPEEREDAAAGQRLMYGIPEARGLLYSEYIRLIEMITDALTSRPDAP
ADHLERRVIAGAIVGVLIAAAHDTPMPDTALERSLTILSKRMAR
315446099YP_004078978.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MAERLSAGRHRLSRDEVAAHQKQRLFKALAVVMGTKGYNNTSVNDLIKHA
GVSRATFYELFDSKQDCFMAGFAGMQGHVIDAILAAPAGTTPLERFGVML
DKYLGFMALDPPTATLYLVEVYSAGPDAMHRRAELQQQFVDGVAKIFKVR
SKADKFACKALVAAISALVTTALIDGDPAAILALKAPVLTFAERALRAGP
G
315446098YP_004078977.1 dihydroxyacid dehydratase [Mycobacterium gilvum Spyr1]MAGARALLRAAGVDGADIGKPIVAVANSFTEFVPGHTHLQPVGRIVSEAI
RAAGGVPREFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMINAHCAD
AMVCISNCDKITPGMVMAALRLNIPTVFVSGGPMEGGTAVLIDGTVRTRL
NLISAIADAVNTDVSDPDLARIEESACPTCGSCSGMFTANSMNCLTEALG
LALPGNGSVLATHTARRALYEKAGATVMDLCRRYYDEDDASVLPRAIANH
DAFDNAMAMDIAMGGSTNTILHLLAAAREAELDYTLEDIEKRSRQIPCLC
KVAPNGHYLMEDVHRAGGIPAILGELWRAGHLHETVHAVHAGSLAEWLRR
WDIRGGEASAEAIELFHAAPGCVRSASAFSQSERWDSLDTDAAEGCVRDV
RHAYSEDGGLAILRGNLSPDGCIVKTAGVDESILKFSGPAVVVESQEDAV
DAILNGRVQPGDVVVVRYEGPKGGPGMQEMLYPTSFLKGRGLGAVCALVT
DGRFSGGSSGLSIGHVSPEAAAGGTIALVEDGDQITIDIPHRTIELDVAD
DELDRRRAALEGGGYRPRHRERPVSAALRAYAALALSADKGAVRDIGAI
315446097YP_004078976.1 hypothetical protein Mspyr1_45900 [Mycobacterium gilvum Spyr1]MDTRAQRRLALGKFLRARREAIRRADVGLPELPRARTGGLRREEVAVTAG
VSVTWYAWLEQGRDINPSKQVLDAVADALRLSPAEHEYVLALGGYAVDAA
VSRGPLPPHIQHFLDALEGYPAFAITPDWGIAAWNTTYAALYPNVERVPE
TDRNLLWLVFTDPYIHELLPNWDTDSRRFLAEFRADAGPRVGEPSYTALV
SRLSSESPHFAAAWQATSIERFTSRERLFRHPAAGELRLEHHQVAPVDVP
DIQIVAYLPVPDSGASERLRMLRSQADTAR
315446096YP_004078975.1 hypothetical protein Mspyr1_45890 [Mycobacterium gilvum Spyr1]MLEISGLTWGVTIGVIVGLLAIDLILAALRPHRVGFREATAWSVFYIAVA
IGFGVWFAMAHGGDFGTEYFAGYIVEKSLSVDNLFVFVIIMTTFAVPEEH
QHKVLTFGIILALIMRAIFIAVGATLLSLFSFMFLLFGLLLIYTAIQLFR
HRDEDPDVENNIMIRATRKVLPISDDYDGGKLLTRREGRRMATPLLAVLI
AIGSVDLLFALDSIPAVFGVTSEPYIVFTANAFALLGLRALFFLVKGLLD
RLVYLSTGLSIILAFIGVKLILHWGHVDINPQIPEINTYLSLVVIIGILA
IVTVASLIKTRKDPTAKAHPGSLRASRKRPEEQRDATG
315446095YP_004078974.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MTGPTSVDPDLVEMLDAVFADHREQLGAQRPAATWDAGLWDRLGELGLTW
LTGSEESGGSGAGWREGAELLRAAVQNGVQVPLAEHDLLACWLLESAGLP
VDDARRTVCVLDDGVAHGVPWASEADRIVVVWRTDGTAQVADVAAGDLAI
TAGANLAGEPRDTVAADPAALAGTPVPNASVDQLFLRGALVRGLQVCAAL
DRIVALSIAHTTDRTQFGRPLAKFQSVQNLVSDSAAEAALARAATEAALT
EAVRTGWSGTNLEFLVAVARSCTGHATSVVVRNAHQAHGAIGTTREHRLH
EFTQPALAWRSEFGSVHYWDELLTTAALAAGRDGLWPLITA
315446094YP_004078973.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MNTSRLVPPVADDPHAMDGLRDEVRQFVAEQRDAGRIGRQVDSWLTGWDE
DFSRALAARGWLGMTVPEEYGGHGRSFLERFVVTEELLAAGAPVGAHWIA
DRQIVPSLLKYGTETQKRRYLPEIAAGRCYFGIGMSEPDSGSDLASVRTK
ASPVDGGWSVTGAKVWTSGAHRADAFICLARTEPVDPAHRHAGLSQFIVD
LRSPGVDIRPIVSMDGRHHFNEVLLDEVFVADDMVFGTIGDGWQQVTSEL
AFERSGPERFLSTFPLLAEVAALMDDGLPRHNDLGRYVARVAGLHQMSTA
VAGALERHEPADTAAAVVKVLGTSTEGDIADFADLLTDACAPDHGGYRAM
LDDAVVQRPGFTLRGGTNEILRGVIARGLGMR
315446093YP_004078972.1 thioredoxin reductase [Mycobacterium gilvum Spyr1]MSFGSTPLGCAKNRTLIRPSNRWVLPTGMPNRADSGNRPSVDYECAVVGA
GAAGLSAALVLGRARRSTVVVDTADPSNRAAPVIGGLLGFDQRPPDELYE
TGRAQLRAYPSVEYRHGEVLAGRASDHGFELDIDDGRQIRAKRVLLATGM
SYCPPQLPGLAELWGTAVFHCPFCHGWEMRDRKLAALAAGDAGLHAALML
RGWTDDVVLLTDGKTDLTPDDERVLTAAGVRIDDRRVVELHGDDGELESI
AFADGDTLARDGLLVEAPVRQRSALAEQLGATCTPGPLGTEPLSVDEMAR
TSTGGVFAAGDVCTEQPHISGAIAAGSEAAMIIVQSLLADDFGLPYPPGS
315446092YP_004078971.1 hypothetical protein Mspyr1_45850 [Mycobacterium gilvum Spyr1]MTTWELDPSDGELLLTTGVTGPAAKMGHRLTIAVQWRATVQWDGDRPVSV
EMTVDVGSLEVLGGEGGVTGLSGPEKALARANALKTLQAKRFPQIVFRTS
SIEPADHGYLLHGTLDLHGRSRDRVLEVEVEDLGEQWQMACRASVSHADH
GLKPYSMMMGAMKVADEVAVSFTARHPK
315446091YP_004078970.1 arabinose efflux permease family protein [Mycobacterium gilvum SpyrMTSPVSTSTWAPLQSPVFRALWIAQFVSNLGTWMQTVGAQWMLVDDPAAA
VLVPLVQTATTLPVMLLALPSGVLADLVDRRRLLIATQGAMAAGVGLLAT
LTGSGLTTPTVLLTLLFVIGCGQALTAPAWQAIQPDLVPSDQIPAAAALG
SMSMNGARAIGPAIAGALVSLTGPTIVFALNAVSFVGIVLVLMWWRRPPV
RSDYPPERALAALSAGGRYIRSSPIVRRILLRTVLFIAPGSAVWGLLPVI
ARDQLGLGSAGYGALLGALGVGAVLGAFALSRLRARFGQNKLLIAGAAGF
GMATAVLALVHNVAVVAAALVIGGAAWLLTLSTLNASMQLSLPSWVRARG
LSVYQLIFMGGQAVGSLLWGLLAGGTSSVTSLLVSAALLIFCALSLWWWP
LHAGTGTLDLTPSSHWPEPTLLFEPEPLDGPVLVITAYRVLPENEEPFMA
AMARLGRSRQRTGASMWQLFRSIEQESTFVETFIVRSWGEHMHQHYTRLT
GQDQLIEQDVERYTEGDAVAEHYLAVRDAR
315446090YP_004078969.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMYVDVMTTPQPLRSTGDLARRTQEAGFDGMLFTETGRTAYLNVAAAALAA
PGLQLSTGVAVAFPRSPFVTAASAWELQEACGGNFRLGLGTQVRTHVVRR
YGVEFEHPGPRLRDYVLAVKACFGAFRTGTLDHHGDFYNLDFITPQWSAG
PIDAPDPMVDVAAVNPWMLRMAGEVADGVHVHPLGEPGYIARHVIPKVAE
GAQKSGRSPSEIALIVPVMTVVGDTDEERHRERELVRASMSFYGSTPNYA
FIWDEAGFEGTTARIRDKQKAGDIKGMAAQITDEHIAVFATESTWDGLAD
ALSARYGGTATRIVLYNALADPERFERYGIVAQRLSNAQQA
315446089YP_004078968.1 anaerobic dehydrogenase- typically selenocysteine-containing [MycobMTLDATPKPLTIVRGACPHDCPDTCAMLYHVEDGKLVDVQGDPNHPMTRG
GLCVKVKNFHEHHYQPDRLLYPMRRVGAKGSGEFERSTWDEALAEIKSRW
TEIIDTYGSQAIMPHAYLGHQGVLNGLTSGDAFFNRLGSTVAEKTYCESG
SSTAWHMTVGGSGGLDVESMAHSKYIIVWGMNMTSTNLHGWPFLLEARKN
NGAKIVVIDPVKNRTARQADWHIPIRPGTDGALAMGMIQQIIAQGLVDTD
YVERYTVGYDELAERAAQYPPERVEEITGIPADDIRKLAYEYATSQPAAI
RQGVALERSRGGGQAIRAITCLPALVGAWRHVGGGTMEMPIWEFPTKFDA
ICKPEWIPEGTRVVNELDLGMALTGEMELDPPIKSLFVYNSNPVSQGPAQ
EKTMRGLMRDDLFTVVSEHFVTDTAKFADLLLPATMQAEQLDIMVTWGHL
YISLNQPAIAPPGECVPNVELFRRLAHVMEFDDESMAYWNRTDREMLIDF
HDWDAPALAGITYEKLEEVGWMRLAVGTPDVRAPHAEGNFPTPSGKCEFK
SSLAEGGNFVVPVWRSMYEGMQPGGYVDPVPDYVPPFESPQSNPELAQRY
PLSIISPKPHAFLNSQYGNAADKQKVQGGQRVFIHPADAAERGIAEGDVV
RVFNDRGSFQGPAAYDDGLMAGLVMANVGHWQGKTSGTTVNAITADRHCG
LGNAGVYGDNLVEVEKVAEEAFEDREAS
315446088YP_004078967.1 hypothetical protein Mspyr1_45810 [Mycobacterium gilvum Spyr1]MAVHWTPNWTCATATGLTATLLLAGCSRGPDDEGAAPIRERATAAVDFTL
PDAQRYHRLATYPVHLNKPAADPVDGETVAEISTVTPDGNTVIYTDAAGK
RIGFLDIRDPANPVGLGTLSLAELGHADDQPTSVAAVGEYVLVVVDTTGG
DFANPSGRVDVVRVADRTRVHSVDLGGQPDSIAVAHDGSFAAIAIENQRD
EEFTPPGAEEGDLPQPPTGFVQLLDLAGAPDTWVPRRVDFDVDAARAAGL
DTPEDLEPEYVSVNPRGQVAVTLQENNGIAIIDGRTGAVQKIFSAGTESV
TRIDTAEDGRVEQTGSITDTPREPDAIGWIDDTHVATANEGDWKGGTRGW
SIFDTGTGEVVWDAGNSIEKLAVRTGLHIESRSESKGPEPEGLAITEIGG
RPVALVASERSNFVAVYDVSDATNPQFRQMLPATPGPEGILPVPARDLLV
ISSESDDAEARVRATVTVYGFGERYAGAPPFPSIVSGDVDGVPIAWGALG
ALTVDPADENRLYTAPDVAYGPSRILGVDLTQTPALIDTELPVTEAGEAV
TLDVEGVAARPDGGFVLAVEGEEGPGNQLVFVGADGAIERRVSLPSEVAA
GLGGQGFEGVALDGDAVWVAVQRQVKTDPSGVARLGRYTPDSDTWEWFGY
PLESTDVDGDWIGLSEIQVHAGALLVLERDKLNGPDARVKAIYRVALPTG
AGAAGAAAPPLLPKVLARDLLPDLQATRGYTQEKVEGFAIAGNGSLYVVT
DNDGLDDANGETVFLDLGPAGDALR
315446087YP_004078966.1 hypothetical protein Mspyr1_45800 [Mycobacterium gilvum Spyr1]MTEQFHLSRLQVINWGVFDGYHDIPFSDGGALIAGASGSGKSSLLDAISL
GFLPFNRRNFNASGDNTAAGSSAGRRTVDKYVRGAWGQRSDGGTSRVMYL
RGDGTAWSAVAVTYSSDSGRTVTGLVLKWLTGESRNDSSSRFVLGDGDLD
IEDVCNRWAAGRFDTAVFKDSRGERSDGRSHGWRFTTKVESQYLAQLYAT
IGIRASDAAQQLLGKAKSLKSVGGLEQFVREFMLDEPESVTRLPEALKQI
DPLVEARELLAVAQKKRKILGDIEKIQQRYASESTDLGIIDLVDLPMVRA
YTDHVRLAQCPAQVSQLDTTIDQLDNEHEDITRSLNLAKAEADSLNAQIS
GSSASIGPLQSQVTAAETEAEQVSRRRNAYEDMLAAQGLDAPETADAFWN
LREELLSQATDLLAKVERNREASTDAEYAQKSARLARDEAAKELKRVEHV
GSALPEFALTMRDQICAAVGVDATDLPYIAELMDLKADQTRWRTAVEKVL
RGVGLRLMVPDQHWTEVLRFVNETNMRGRLQLHHVRAKFLGATPADPEPN
TLAGKLFAVDPEHPCAAEAVDVVTAAGDHICVDTPEVFARFRRAVTDTGL
YKDSDRLAIKDDSRPLKQSEYLYQGDVSAKINALTVDLAAAEEAYQKARR
VADDIAAQRQQWRDRAAACKAICEQYPQWSQIDTETADGHADRLREQYEL
LLAEHPDIEALNARADECWSQIQKLMTRRGAVQTRRDALDDRRTRLLELA
ERLQPAFVSEPLTELLHRYAGQLPVSLELLEPEPHRDALFTAIKKEREQL
RESRRRSYDELARILNTFDTSFPDAIPNDSDNFDERVHDYVALCRHIDEC
ELPEAYERMMRLVTEQAPDAILTLHRVAEQEARRISDQIDRVNTGLGAVE
FNRNTRLTLRATPRSLTAVSELTEIVRAISRRIAEVGLGDKQAILDQYAD
ILRLRNRLASTAPEDKAWTRDALDVRNRFTFDCAEWDVASEELIRTHSNA
GDNSGGEQEKLMAFCLAGALSFNLAAPESSDNRPVFAQLMLDEAFSKSDP
QFAQQALQAFRKFGFQLVIVATVQNATTIQPYIDSVVMVSKTEATGRNAR
PVATVSTRTISEFTDLRHAMRAEAKVPAGV
315446086YP_004078965.1 hypothetical protein Mspyr1_45790 [Mycobacterium gilvum Spyr1]MTTESEADFAAFSALPEVDQTARPPHQRRPRFDGDVSELPDRACWALQHL
LTRRYISAESDADIYAWVLEYRSQLSTRLSELDLILRVVDGTDVAFVEQA
RYESAKGIKLLRREPLGTYDSILALHLAQMMRAAGGQSVLISREEMHGLF
SGVLNDTDRDAVTFAGRIDAAIARLAGLEILRKSRDDEDSYTISPVITAV
MTASVISELQQQFELLINGATAEAETDLD
315446085YP_004078964.1 hypothetical protein Mspyr1_45780 [Mycobacterium gilvum Spyr1]MDDNATLSAADLLERNRELQSSRAIRLLAATNLSLYATLMERHCADGVVP
ETELVVRLERDLDDLGDPQSGIALIKSWAAQGWLHRIVDPRSDQNVCYLT
QDARRALDFLRGMRRQDTLATGGSINGIASRLKQVAIRVGNDPARIRKSI
EAEIAALHEELDELDNGARPEPDVTDAYDEARAIAMQMERLITDIGQYGS
MIEQATAALDEPIDSNVAYRDRQRQMYADYQAAWDSQGRDSHRAFLRMIN
DPDQRAEFEADVAAVADALPALDPALRKVMAGFFELVGHQIDEVERIQQR
CAQRVKRFTAFGTLEQSRGVARQLNEAIGAARNLLKSSLIDSRLDLELPL
ARHAISSVGALSFKIGDLSNPKPAKPAEGDVDLASFAALTTQVDAPAMSD
MLNSAVARGAVSLPEAVAMVHNAYLGHVIVLWSWALKQPNEASPGSATVR
FRSLDGKDREMAVPRLMFTEPISVGVTQ
315446084YP_004078963.1 2-nitropropane dioxygenase [Mycobacterium gilvum Spyr1]MAGEMDTLSTPWSAELGLDVPIVNAPMGGAAGGTLAAAVSRAGGLGMVGM
GSSASAAQLRAQLAELGELKRPFGIGVIDWVIRKEPELLTAALDARPTVL
SVSFGTEWDWVARARDAGCVSVTQVADVKAALRAVDAGVQVLVARGAEAG
GHGTPAVATLPLLSAILDRVEVPVLAAGGIASGRALAAVLAAGAAGAWIG
TAFATCPESLFPDEARRALLTADATDTLTTRVFDVALGYPWPAHFPERVL
RNAFTAAWDGRTPDDDARARLAEAIATDDFRVAPVNTGQGVDDITAVEPA
AVVIARLCDDARRLLAKPPTR
315446083YP_004078962.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMTVVFVHGNPETAAIWGPLTAVLGRDDVVLLSPPGFGAPLPDGFGATFVE
YRDWLEAELEQIDGPIDLVGHDWGGGHVVNAVMHRPELVRSWASDVVGLF
DPDYQWHDMAQVWQTPGAGEELIANMMGGGLEARTELMSSLGIPADIAAA
IAEHQNDDMGRAILALYRSATQPAMAEAGRSLEAAAARPGLSLMATEDPY
VGVNDNRRRAADRAGARTTVLDGLGHWWMVEDPQRGAAALTEFWDSL
315446082YP_004078961.1 Zn-dependent oxidoreductase [Mycobacterium gilvum Spyr1]MRAAVLEAVGQAPTVREFDEPTRDVVRVSLAGCNPVDLALASGEMGDPVI
PSVVGKEGIGRTADGTRVYFDSPISPFGSWAELAQLDPDLAFEVPDDVDD
DLAVALGIAGLAAWLPLTRHADVSAGQSVLILGATGIVGNIAIQAAKILG
AGRVVGAGRDAGALQKAQELGADAVVQLGTDDDAAALKSEVKDGYDVVVD
LIYGDPFLAALDATTVGATLITVGQGAGTPAIPFAKLMGRTHVGHMNNLL
PASVMRQAYAELVGLASEKRLTVETTRYSLDDAEKAWDAQADSPHVKIGI
AP
315446081YP_004078960.1 hypothetical protein Mspyr1_45740 [Mycobacterium gilvum Spyr1]MTTHRNTAPTEPPERLAPVEVPERLVPDDVPETPPEPATTPDPGPPQRAT
IGAA
315446080YP_004078959.1 L-threonine aldolase [Mycobacterium gilvum Spyr1]MGQVPASAAFASAAFASDNAAPAHPSVLDALHRANDGSAPSYGADAVTAQ
AADAIRTAFDSPGADVLFAFTGTAANTIALASATRPWHEIFCSDVAHVLV
DEAGGPVRLSGAQLTRLPSVDGLIAPEELERRVRGRGAVHHSQPRIVSIT
QSTESGRVWTADAIAEFVDHAHALGLLVHVDGARIANAVAALGISPVEAI
ADADIVSVGGTKNGLLFGDAILVRRPEHFDGIHWVQKQIGHLASKHRFIA
AQFVALFTDGLWLRNAEHANAMARRLSAGLQGLGYQLASPAESNEVFVRI
DGDALGHLTRAYLVHQPDHNEPVVRFVTSWATTEAEVDDALAALTR
315446079YP_004078958.1 hypothetical protein Mspyr1_45720 [Mycobacterium gilvum Spyr1]MTELVLTEEFREALALLAGGRHVFLTGKAGTGKSTLIRRFMADTDRNVVV
VAPTGIAALNVDGYTIHRMFGFRSTTTLDDVRSGEYRPGRFTKTLAALQT
LIIDEASMVRADVFDMVAAALERFGPEPGTPFGGVQIVLVGDLYQLPPVV
REDEVAYFSTACPPRYETPYFFSANAFHRDDFPTVSLTTVFRQLGDDRMT
AILNEIREGVLLGHAQEQLNARADKDFVPPEDEFWLTLAPTNRLVTARNR
QQLERLPGEEFVHHAKASGDLAMFEAPVEETLRFKVGAQVMMLTNDPGSR
WVNGTVARVVGVGYDRYGAVVEVEFPDGTTADVSPFTWEVTRPVMSGSSL
SREVVGAYTQLPFKLAWAITIHKSQGQTLERVVVDLTGGMFSTGQLYVAL
SRCTSLAGLVLKRPVLPKDLKTDRRVTRYLRTSSGVAGARRYCAIGMLTV
GDEGRMSRPRPVELAVAFDDGTAVTTLVNPQRDLADARKAFGIKVSDVLL
APTLREAWAVIAPMLAGATPVGPGVDETLGLLDFELKRLGFVTPMPLGVE
LRGTRAQGRTALERARSALQAHRAADAEGGASAFDDPETVELSGLLVSRD
ASVPTPVADHLPGLSALLRISRDVGSVLLGGTAPPRDDATGWEAGARQSV
ADQLRAAASRVQLTDEVLSRLHAAEELLGVEILSGTELLDRPDVDGILAP
GARICFTGTAQDPDGRVVERDEMERLATAAGLVPVKSVTKTRCDVLVTAE
AGTQSGKARKALEYDKPVLCADDFFTWLAAH
315446078YP_004078957.1 hypothetical protein Mspyr1_45710 [Mycobacterium gilvum Spyr1]MTDPTDAPETSKRRALARLALVVAVLAVLFYLTAIARVIDVEAVRDLIES
TGPLAPLTYVGVSAVLGALLVPGPLLAAGSGFLFGPVVGTVVTLGATVGN
ALISAYVGRRAGRQSARTLLGTQRAEQVDRLIERGGLWAVVGQRFVPGIS
DSLASYAFGAFGVPLWQMAAGAFIGSMPRAFVYTVVGSSIGEFSAPLAFA
AAAVWCVTAVIGAFAAHRGWRRWRARQ
315446077YP_004078956.1 hypothetical protein Mspyr1_45700 [Mycobacterium gilvum Spyr1]MSVTAGELTGTERAVLLVLMAASRPVPNRELAVRGPALDKTGRDKLNRLG
LIESERVGSRFVHELTDRGWRLCRELIDAGPPPRSTGPAKTLYTVLGALG
RYLDGAGLSLADVFGASDGSPVRTEDRIRAVYARLAARPGGWVPLTMLRA
ELDAPRAEVDAALAVLHRTPGVSVIPQEDQKLLTPEDRDAAVIIGDRPKH
LIAIED
315446076YP_004078955.1 ATPase [Mycobacterium gilvum Spyr1]MDTLQREALASLRLTWAPTSDDLWRPQAATHVTGLNEHAVDDVMDAFGDA
LRDEASSPMGVVIRGSAGSGKTHLLGQVRERVQAGGGYFFVVELLDAASF
WQSVRSGVLESLGRPGTQRETQLKDLLWELSSLAHVSRADRRAIIGDDDL
DAETLYRFIKALSGVAKETVRQCHQVLRALVLLASNDFIAHDIGEGFLQG
SDEFSIAERGPWGLRSAPESAQMCVRDISRLVALAGPAVLAVDQIDTLLA
QSLAGSDGDGVLEQVAHGLMALRQTTRRTVPVVACLPAVWEHIQDRAAAS
VADRFRVTGMLTPLPSADIGRAILERRFAASYRAVGFDPPYPSWPLAPSA
FEEAPSYTPRQLLIRADTHVRECLKRGEVAELTHLRADAQPDWDTVSTTD
DVTVSTALDRRFAEYRRRAVPAAALAHDGEDVTVPELLSAALTAWIAERD
GEATFVCDPPPGTHVMLHARLRETLDSATDDERHWAFRAVAGTNASAVLS
RVRKALTASGFGSGGDRRRLFLLRNSPWPSGKKTTEEIELFHSAGGRTLP
LSDDDIRTMTALRDLFADDDPELAAWLRARRPAHGLTLLREALGGDSESA
EPAVPEPDPDPEEEVVADYDVSADEIPLGLDLQDEKPVTVQLSALRKHVA
IFAGSGSGKTVLIRRLVEECALRGVSSIVLDPNNDLSRLGTAWPQTPAGW
RRGDDARADDYLTNTEVTVWTPRRTNGRPLAFAPLPDFAGVLDDPDEFTE
AVEAACSALEPQALITGKTQKATRSRAVLREALQHYGKTGSPTLGGFIRL
LADLPEDVSDIAGAHAIAGDLSQNLRAAMVNDPMFGGAGTPVDPGVLLTP
SDGYRARVSVISMIGLPSDDQRQSFVNQLQMALFAWIKRNPAGDRPLGGL
LVMDEAQNFAPARGFTACTRSTLALSSQARKYGLGLVFATQAPKGLNLNI
PGNAATQFYGLLNAPAQIETAREMARAKGGLVDDISRLRAGNFYVATEGE
SFHRIAAPWCLSHHPASPPSAEEVLNLATSV
315446075YP_004078954.1 hypothetical protein Mspyr1_45680 [Mycobacterium gilvum Spyr1]MDLGLSGKRFVVSGGTRGIGRAVVEGLLAEGASVAFCARTPAAVEQAQAE
LSANGAAVAGAVVDVGDAAAVEAWVTQAAGMFSGLDGVVANVSALAIPET
HENWRTTFEVDLMGTVGMVDAAMPYLLESDAGSIVTVSSVSGREVDFAAG
PYGTMKAAIIHYTQGLAFKYAGQGVRANSVSPGNTYFPGGVWTSIEENDP
QLFAAALALNPTGRMATPQEVANAVVFLSSPAASFITGTNLLVDGALTRG
VQF
315446074YP_004078953.1 acetamidase/formamidase [Mycobacterium gilvum Spyr1]MEHVTFIPTPDQYRYTFGGAEPVMRIKPQTVLTLWAEDAYGGRITSADDV
ASAVLDTPDLNPQTGPFHVEGAEPGDTLAIHLVDLTPARTWGASTLIPFF
GGLTSVPVSPTLQDPLPERTWIYEYDSAAETLAFNAHGSDFSVALPANPM
LGTVGVAPDRREVRTALVPDIFGGNMDTPEMAAGATCYLRVNVPGALFSL
GDGHYRQGEGESCGTAVEGAMHVTAIVDLIKGGNSAWPRLETDTHLMCVG
SGRPMEEAWRASQVEMITWLGELYGLDRYDAYQLLTQISLCPIANVVDTN
YSTVTKIDKRLLPTAPAYGGLHSELRSAAAALGSVNY
315446073YP_004078952.1 esterase [Mycobacterium gilvum Spyr1]MTFFARIAVAVLLAAGLLTVAPSPQAAAFSRPGLPIEQLDVPSPSMGRTI
RVEFQGGGPHSVLLLDGLRAQDDFNGWDINTSAFEWFYESGVSVIMPVGG
QSSFYADWYRPARNNNGTLTYKWETFLTNELPTWLATHRGQDPFGNAVVG
LSMSGSAALTLAAWYPRQYKFAASLSGYLAPSQKFWPSLIDIAMQDAGGF
DSFDMWGKPGSPAWLRADPMLNINRLVANRTALWVYCGNGVASDLDTGTD
LGVNISAGSLETITIATNKEFRDKYLAAGGRNAIFNFPPNGTHSWGYWGA
QLQAMKPDIVRLLNPPPPPPPAPLPPGAPLPPGAPLPPPPAPPAPR
315446072YP_004078951.1 hypothetical protein Mspyr1_45650 [Mycobacterium gilvum Spyr1]MAKQKVPKPGDIMAAAQEAAEAAQAAATSALRIPPASLKLVAEVPDLIEN
LAVATERLNVAVDRMERYLALASPMLRTMDALLPQLEALVATGNDVYRAV
SSVPGVSTLGRFTGRGRTEEPGEK
315446071YP_004078950.1 glycogen/starch/alpha-glucan phosphorylase [Mycobacterium gilvum SpMTDLANPTSGESLGVNGSAVGPTGQTRSGMSADALRAAVRDHLVYSIARP
AAVLTPEHYYRALSLAVRDRMQKRWMATTQDWLDLSAKVTCYLSAEFLMG
PQLGNNLLNLGIEKQAREALSDLGQDLDEVLACEGEPGLGNGGLGRLAAC
YLDSLATLERPSIGYGIRYEFGIFRQEISDGWQVEKTDNWLVRGNPWEID
KPDASYVVNWGGHTEQYEDVTGRLRVRWVPQRVLQGVSYDTPVQGYGVNT
CNTLTLWSARAVESFALEAFNTGDFYKAVDEEVVSETVSKVLYPNDEPEA
GKRLRLLQQYFFVTCSLQDILSIHLKRAHLPLHRLPDKWAIQLNDTHPSI
AVAELMRLLIDEHHLAWDDAWDLTVRTFGYTNHTLLPEALETWPLRIFGE
ALPRHLELIYEINDRFLDEVRARFPGDEERVSRMSLIGEDGGKSVRMAHL
ATVGSHAVNGVAALHSELLKQSVLKDFYEMWPERFGNVTNGVTPRRFLAL
SNPGLRALIDDTIGPGWLTDLERLHGLESFVDDPAFRLRWREVKRANKSR
LAEYVHSITGIELDPTWMFDVQVKRIHEYKRQHLMVLHIIALYQRLKNNP
GLTIPPRAFIFGGKAAPGYFMAKRIIKLITAVGDTINADPEVNRCMKLVF
LPNFNVKNAHLVYPAANLSEQISTAGKEASGTGNMKFMINGAVTIGTLDG
ANVEIRQEAGAENFFLFGLTESQVEKVKADGYRPLSHVENDAELAGVLEL
IANGEFTHGDTEVLRPVVDNLVHHDPFLVLADYRSYVDCQDEVSRAWLDR
DAWSRMSIRNTARSGKFSSDRAIREYCDEIWGVRPMSVDLE
315446070YP_004078949.1 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protMATGGDHGETVRPSDADWMPPLSRLLAWTLAVGVVCFVVRGLVHADSWSY
AMAWPAIAPQLVALLTSPRRQWPVYLASFAAVQIIPARLVLDFAPELGLL
ATMTTVVAAALLLHRDQDWVRGRSDSLRSWLRFLVLASAAPLAGAPLGVA
SLVLNGEVGTTGSELLNAAMAWYLSEAVGIAFLVPLMLRWDHYLRRGHSR
REVLWFAAMTALTAGLCAAAITESSFVLMFLSGLPSMAVLIRSGIAGAFA
AMIVGPATVLGATFAGYGPFAASLPTPGQAMISAQVFVLGAFTMVVMVAA
ALEDRTRLAALDNASYKAYELVAELTGDVVILVDAEGNVLRRASPGHEIL
SLPDGPLTKEAWLDQVHPDDRAGRADFPKISGPGPSDPFRIRKSDGTWGW
YVVHSRRTEDGLTVAVLRDVTLEREVQESLTDMANTDPLTGLANRRGLAQ
HAADLWSRARAAGEQVTALFIDLDHFKSFNDLYGHQAGDECLRRVADVLA
HLADDSVCVAARYGGEEFAVVLVGCDAPQEFADGLAAAIRALRIPHLGTD
SGMVTISVGVATLRPWHTTDSDAEAVVAELLDRADKALYVAKSRGRNAIS
IYGDDTALRDGAALRDGVVLLGEQVHHTAKHPREAAGGRHDD
315446069YP_004078948.1 flavin-dependent dehydrogenase [Mycobacterium gilvum Spyr1]MIDLVVAGGGPAGLATAIHAARAGLETVVIEQRTGPIDKACGEGLMPHAV
RQLALLGAQPAGIAFRGISYFDADHAVTALFDSGHGLGVRRKTLHAALLT
EADRAGVKLVHAKAGPLTQDADSVSVNGFRARYLAAADGLHSPIRARLGL
ELPTAGTKRWGLKRHIAVAPWSDMVEVYWSDDPGSGEAYVTPVAPDCVGI
ALLTSRQGGFDEHMAAFPELRDRIAGFAHEPDRAAGPLRQRVRRRVAGRV
LLVGDAAGYVDALTGEGLGLAFAAARLLVDSVAADRPGDYEARWRRATRR
YRVMTAGVLRAGTSPLRSVIVPAACRLPRVFRGVVNLLAQ
315446068YP_004078947.1 hypothetical protein Mspyr1_45610 [Mycobacterium gilvum Spyr1]MFAYTLLIAAVAVERLAELVVSQRNLKWSKARGGVEFGAGHYPVMVVLHT
ALLVGCLVEASHREFIPALGWTMFAVAIAAQALRWWCITTLGPQWNTRVV
VVPNAGRVTGGPYRFMSHPNYVAVVVEGIALPLVHTAWITALVFTVLNAA
LLWTRISVENKALRTLTAAR
315446067YP_004078946.1 naringenin-chalcone synthase [Mycobacterium gilvum Spyr1]MTDVHTPVSVIAGVQGALPPHRYSQAEVTDAFLAAPAFAEVGDLLRSLHT
NAKVDARHLVLPLEQYPDLLDFGDANDLYIHHAVELGCQALTAALDEAGL
APSDLDVIMSTTVTGIAVPSLDARIAAKLGLRPDVRRVPLFGLGCVAGAA
GIARMHDYLRGAPGHVAALISVELCSLTRPALAPTIGSLVGSALFGDGAA
AVVAVGEERAGHIRASGPDVLDSRSRMYPDSLDIMGWSVNHNGFQLVLSP
ELPALIERYLPDDMAGFLGEHDLGIGDIATWVSHPGGPKVLEAIASALDL
PDDALELSWRSLAEIGNLSSSSVLHILRDTIAKKPPAATPGLLMAMGPGF
CSELVLLRWH
315446066YP_004078945.1 RND superfamily drug exporter [Mycobacterium gilvum Spyr1]MLTVALGVFGIPVAQSLSPSGFSDPGSQSAHAAALLTDTFGQGDVQMLIV
VSSPDGIDDPRVRDVGTDIVDLLTADPHVAEVSSPWTSPPGAAADLVSRD
RTAGLVVAGITGDEAEQQTYAKDISDRVTRDRDGITVRTGGTAMVNVQIT
EQSQRDLLMMEGLAIPLSFLVLVWVFGGLVAAALPVAIGGMAIVGALAVL
RLVTFTTDVSIFALNLATAMGLALAIDYTLLILSRYRDELAAGASRPDAI
ARTMATAGRTVIFSATTVALSMAVMVLFPMHFLKSFAYAGVVTVAFAAAA
AVIVTPAALALLGDRLDSLDVHRLARRVLRRPEPVPVPVEQRFWYRCATT
VMRRALPLGTVVVVLLLVLGAPFLGVKWGFPDERVLPRSASAHQVGDQLR
TEFADNTDTGVAVVVPDSAGLSPADLSAYAAALSQVPDVPAVSAPTGTFV
DGAQAGPPSAPAGERDGSTFLTVTSTAPLFSDASETQLDRLHEVPGPGGR
DVQMTGTAQINRDSVDAITSRLPLVLGLIAIIMFALLFLLTGSVVVPLKA
LVLNMLSLTAAFGALVWIFQDGHLSGLGTTPTGTLVANMPVLLFCIAFGL
SMDYEVFLVSRIREFRLQGHGNDESVALGIAHTGRVITAAALIMSISFAA
LIAANVSFMRMFGLGLTLAVLVDATLVRMVLVPAFMHLMGGVNWWAPRFL
TRIHRRLGFSDDPPTHQRAHPTEQTEQVPS
315446065YP_004078944.1 hypothetical protein Mspyr1_45580 [Mycobacterium gilvum Spyr1]MPAVAAAMTAVLVQCAPASSPAPPPPEPPPPPVRQLPPETFRTVAPPPPP
PTEIRPVTAAELGATWRPGCPAGPEELRLVELDHWGFDGQTHRGRLVVHR
DVAEAVVDVFARLLEMRYPIEKMRTVENYPGADDELSMRDNNTSAFNCRG
IPGSDSWSLHAYGRAIDVNPKLNPYVPRSGVHEPANAGPWVDRSRSEPGM
LHDGDAAVLAFTDRGWRWGGHWRSPLDYQHFEIG
315446064YP_004078943.1 hypothetical protein Mspyr1_45570 [Mycobacterium gilvum Spyr1]MVGIGDGAMMPQAVDSPRSAHASGQVNWMLALLMLMILVGAIAGVAVALF
SGMPTIALVIALIAGAIFAGVAC
315446063YP_004078942.1 P-type ATPase- translocating [Mycobacterium gilvum Spyr1]MTPRRNAVPAQQAVEDAEFAGLAHARSRADILAALHATADGLTTADAADR
LTNTGPNRLPAPPHRSPLVRFLAQFNNVLIYILIAAAVLKAILGSWVDAA
VIGAAAIINSVVGYLQEGKAEKALDSIRDMLSVSARVLRDGQWVDVDAEK
LVPGDVVRIGSGDRIPADLRLLEVNNLRVEESALTGESVPAAKSVTHVES
DAGLGDRTSMVYSGTIVAAGTGVGVVTATGTATEIGRIQTLISEVEGIDT
PLTRKLAQFGRQLSVLILGMAAVMLVIGRLIHQFSIEDLISAAIGFAVAA
IPEGLPAVVTVTLALGVQQMARRNAITRKLPAVEALGSVTVICSDKTGTL
TQNEMTVRTVVTARHHYAVTGAGYAPHGDIELDGAPADLGDHPDLTVLVV
AMALCNDSRLTETDGHWRVVGEPTEGALRALAHKASVEAPMRRLAEIPFE
SAHKFMVTLDEASDGHRWLHVKGAPDRLLERSGTQLRSGVAEPLDRDFWH
ARVEELSAQGLRVLAAARRPAGTADGVDPSDVDAGLEFVGIVGIVDPPRP
EAVAAIANCHSAGIRVKMITGDHVGTATAIAREMGIVEGPKPTALTGADL
QSMSQPRLREVVGKVDVFARTSPEHKLRIVSALQAEGDVVAMTGDGVNDA
PALTRADIGVAMGVKGTEATKEAAGIVLADDNFATIERAVEEGRRIYDNI
RKSVLFLLPTNGSQALVILVAVLFGFALPLQPVQILWVNLVTGVTLALAL
VFEKAEDGLMNRPPRPADQPVVRLVDVSMIALVSVLVAGAALAIFFIAQA
HGQPLAVAQTAAVNMLAMGQLAYLFNCRFVSTTSLRPAALRGNPWVWRMA
GALLVLQLVFIYVPFMNSWFHTAPITVLGWAVALGFSVVIFLVVEAAKAV
GLRLGY
315446062YP_004078941.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MTRIAVIGAGPCGLAALHAFEQARLDGVDVGEVVCFEKQSDWGGLWNYTW
RTGLDEHGDPVHGSMYRYLWSNGPKECLEFSDYTFDEHFGGPIPSFPPRE
VLYDYITGRAKKSNVRQFIAFDTAVRRVSFDDRTQMFSLALESWETGESA
VRTETFDYVLVATGHFSTPNMPEYPGFASFPGRILHSHDFRDAVEFAGKN
LLILGSSYSAEDIALQSRKYGARSVTIAYRNAPMGFGWPDGIDEVPALQH
IAGRTAHFADGTSRDVDAIILCTGYQHHFPFIDPELRLTTTNNLYPAGLY
KGVVWTANPKLIYLGMQDQFYTFTMFDAQAFVARDVVLGRLPLPGADAMA
ADVDAWLARYATVEDVPGQIDFQTDYVRDLMSMTDYPGFDLDMVRQHFVT
WEHDKEDTITGYRDKSFASPCTGTVGPSPHTTWWDELDDGLARFLQR
315446061YP_004078940.1 glycine cleavage system protein T (aminomethyltransferase) [MycobacMVQRFRVAPGSVTAVPVFGGDRFDIVDQYGRQPAELTVLAADPRAVADAP
PDTAATVLRSLIPGSDENGYAAQRILSLLAGHRVDQQEAVATRLFGHHSP
AGSRATFTVDADAVVLVAAPASPMHPHSDDPNPPSEVRVAVYRADPGRPA
TPELPPPLAEPLLDRRIDAETAASYEVREGQFIQIIDVAGRQCSDFLAFD
ARGLADGREYGLDATTTRTIGGAAYPRPGLFGKFFDARARPLVEVVRDTV
GRHDTFALACTAKYYADLGYLGHVNCTDNFNGALARFGVDRRQGWPALNL
FYNTAFDAAHQLISDEPWSRAGDYVLFRASADLVCASSACPDDIDPANGW
VPTDIHVRVYDSSRRFSVAVGHRLTPDSEPVLTKSTAFARRTGALTTDFT
EYNGYWLPNSYANHGPHDEYWACRERVAVMDLSALRKFEVLGPDAEALLQ
ATLTRDIRRLSRGQVVYSAMCSESGGVVDDCTVLRLGDNNFRFIGGDPHG
GVWLRTQAERLGLHQVWIKDSTDQMHNLAIQGPASRAVLDGLIWTPPGQP
ALRDLGWFRFLTGRLDGPDGAPLLVSRTGYTGELGYEVWVHPGDAETLWD
RLWDAGRPHGLTPLGLEALEMVRIEAGLVAGGHEFDDQTDPFEAGIGFTV
PLKTKTDDFVGRAALVERKAHPQRTLVGLRLDSNETTAQGDCVHLGRTQV
GVVTSATRSPLLGASIALCRIAVQHSEPGTRVEIGKLDGHLKRIPATVTT
IPFYDPDKTRPRS
315446060YP_004078939.1 hypothetical protein Mspyr1_45530 [Mycobacterium gilvum Spyr1]MTSIAAPTFLVTSGFWQKLPQMSLEQYPGTEGFIDDVYANPSGVPMSSGY
FELRNTDAPLDYYYDYDEMKVVLEGEFRLENVDTGQVEIAREKDAIFFPK
GSRILFSTPTRALAFYVGYRSFAP
315446059YP_004078938.1 hypothetical protein Mspyr1_45520 [Mycobacterium gilvum Spyr1]MRVDGQDVAVSGSLLQPLTRRTNDIFRLSLAGIFLVVVVTSSLITRYEWE
ALEKSISGIVGVLSPTQSNTVYLIYGIAILGLPFFILIGLILARQWKLLG
AYGAAGVIAILALSITGNGIAAPRWHFDLTVRLDTVLSQFLDDPRWIAML
AAVLTVSGPWLPARWRRWWWALLLAFVPIHLVVSAVVPARSLLGLAVGWF
VGALVVLVSGTPALEVPLDGAVRALMRRGFPPAELRVLRPAGEGPLVLDA
TASCNSKADSDTEPETALVELYGPHQRGVGFLRQFWGKLRLRDDETAPLQ
PSMRRAVEHRALMALAVGNLGMANTQPIAVATLDRGWTVYAHKPARGIPL
ADCADETPVARVWDSLGVLHSQQISHGDLRRGEITVVDGRPLFGGFSRAE
FGASDAHLHTDIAQLLVTTADLYGPPKAVAAAITVFGNDSVLAASRRLTR
AAVPKAVRDSVRDAGATMSKLRDEVKYQTGADQIKTETITRFTRNQVIQM
VLLVALVYVAYPFISSAPVFFSELRSANWWWALVGLAVSALKYLGAAAAL
WACADGMVRFRSLTVMQVANTFAATTTPAGVGGLALSTRFLQKGGLGALR
ATTAVALQQSVQVITHITLLILFSAAAGASANLSRFVPSTTVLYLIAGVV
LGAIGVSLFVPKLRHWLATAVRPRLKEVLDDLMLLAREPKRLALIILGCA
TTTLGAALALWASIEAFGGDASFITVTIVTMVGGTLASAAPTPGGVGAVE
AALIGGLAAFGVPAAVAVPAVLLYRILTCWLPVFVGWPIMRWLTRKEMV
315446058YP_004078937.1 DNA helicase/exodeoxyribonuclease V subunit alpha [Mycobacterium giMSLDAFAEVFEPADIHVAQRLTELGRDSDPTVALAVALAVRAVRSGSVCV
DLRTVAAQVGVPELPWPDPDGWLSTVGASPLAEHKVVRLDGDLLYLDRYW
REEEQVRDDVVALLSSPPRTAVPGLERLFPAGWEEQRAAAEAALTRSLTV
LTGGPGTGKTTTVARLLAAFAEQAELAGGPPPRMALAAPTGKAAARLQDA
VQAEVDRLSAVDRARLAGLRATTMHRLLGSRPDTSSRFRHHRGNRLPHDV
IVVDETSMVSLTMMARLLEAVRPDTRLLFVGDPDQLASVDAGAVLADLVD
GLGEAGVVELTTSHRFGERIGALALAIRSGDADATVEVLRAGGDAIGWLD
TDDAADALRGPLVDRAADLREAALLGDGETALRILDGHRLLCAHRRGPFG
VAHWNRQIERWLAERTGQSIWSQPYAGRPLLVTANDYGLGVYNGDTGVVV
AAPEGLRAHIGTPASSRELAVGRLGEVETMFAMTIHKSQGSQADEVTVLM
PPQDSRLLTRELFYTAVTRAKERVQVVGTEASVRAAVGRRAVRASGLARR
LSTAR
315446057YP_004078936.1 DNA helicase/exodeoxyribonuclease V subunit beta [Mycobacterium gilMEPFDLLGALPEPRTTTVLEASAGTGKTFALAGLVTRYVAEGVATLDRML
LITFGRAASQELRERVRSQILDALRAFDDPAAIGDNEVVRHLVTGDAEEC
DARRRRLRDALAGFDAATIATTHQFCQLVLRSLGVAGDTDSGVELVESLD
DLVAEIVDDLYLAHFGQDRDEPLLTHESALRLAHAVVGYAHTELRPRDPA
PGSDAAVRVEFAKAVCAELETRKRKLGILHYDDLLSRLADALEAPDSPAR
ARMQRRWSIVMVDEFQDTDPVQWQVIDRAFRGHATLILIGDPKQAIYAFR
GGDIVTYLHAAATAGVQRTLGTNYRSDAPLVEGLQAVMRDAQLGDPRIVV
RRVDAHHREHRLQGAPHNEPFRLRVCTRDQFRVRTDRMIPIDVLRNHIPK
DMAADIAALLNSGATHCGEKLAPGDIAVIVESHRDGHACFAALADAGIPA
VYTGDSDVFSSPAADDWMCLLEAFDQPHRSGLVRAAATTMFFGETAEALA
LQGDSLTDRIAETLRQWADFARERGVTAVFEAAQLRGMGARVLRWVDGER
HMTDLAHLTQLLHDTAHREQYSLPALRDWLRAQRDDRGGLRGTVERNRRL
DSDAAAVQIMTVWVSKGLQFPVVYLPFAFNRNVQPRDVVVFHEPVTSDGA
ADIRCLHIGGESSPDFAAVAQQARLEAAGDDVRLTYVAMTRAQSQVVAWW
APSRDELNGGLSRLLRGRAPGDPVVPDRCDPARIDDAEAMARLRAWDDEG
GPVLEESIIAERVEVELPAPPDTLAVRHFHRRIDPLWRRTSYSGLIRAAE
QESGVGSEPEVVELDDEVAELRGPDTEPATPDVDMASPMAGLPMGAKFGT
LVHAVLETADPFAVDLAAELEAAVVEHSLWWPVDVPPAELAAALVPMHDT
PLGPLAPGVTLRDIGLRDRLREMEFEFPLAGGDRRDDTPDITLADVGRLL
RAHLPADDPLAPYAARLTTGALAGQPLKGYLNGSLDAVLRVDGRYLVVDY
KTNWLGDPAGELTAADYAPARLAEAMLHSDYPLQALLYCVVLHRFLRWRQ
PGYSARRHIAGVLYLFVRGMCGPDTPVLDGHPAGVFSWQPPAALIEELSD
LLDAGAVPA
315446056YP_004078935.1 DNA helicase/exodeoxyribonuclease V subunit gamma [Mycobacterium giMALHLHRADRTDLLADGLGAMLSDPPADPFAEDLVLVSARGTERWLSQRL
SHVLGRGSGQDGICAGVTFRHPRSLIAELTGTREHDPWSPDAMVWPLLAV
IDDCLAEPWCSTLGAHLGHFADGEERELRQGRRYAVARRLAGLFASYATQ
RPRLLEDWLAGRTDGLDADLRWQPELYRALVDRVQADPPHVRHAETVARL
VDSPTDLPERLSLFGHTRLPVTEIELLAAVATHHDLHLWLPHPSDALWTS
LRDVRDVIPRRDDTSHRRVGHPLLATLGRDLRELQRCLPTDTVSDESLGS
VARPDTLLGWLQSDIGADRVRAEGRTHDAGDRSVQVHSCHGPARQVDVLR
EVLLGMLEDDPTLEPRDILVMCPDIEAYAPLIVAGFGLGDVVSGAHPAHR
LRVKLADRALTQTNPLLGVARRLLELAGSRATAGEVLDVAEAAPVRARFG
FSDDDLDAVGTWVRESNIRWGFDRDHRRPYGVDFVQNTWRFGIDRVLAGV
AMSDDSRAWLDTTLPLDDVSSNRVELAGRLAEFVDRLRDAVESLTGTAML
ADWLARIRTGVSELTAVPDSDLWQHSQLERELADIAAAAGVHAGTELRLS
DVRSLLDRHLAGRPTRANFRTGTLTVCTMVPMRSVPHRVVCLVGLDDGVF
PRVGVVDGDDALARDPMTGERDIRSEDRQLLLDAIGAATEKLVITYTGAN
EYSGQRRPPAVPVVELLDTLDVTTSSPVRDRVHTSHPLQPFDIANVTPGA
LNMPVNTPFTFDPTTLTAARATTGDREEHRPLLAEPLPAPPADDVALDDL
IGFFRDPVKGFFRALDFTLPWEVDGLDDAIPVDVDALQEWKIGQRLLDDM
QRGMSPAQAQQAEWRRGSLPPGRLGWRRAQEITARSAALAAAAQQYRTPD
PHAVDIDVAVGPARRLTGTVPRLYGERMVAVTYSKLAGRHLLESWIRLVA
LTAHRPGTDWTAVCIGRGDRGRPTRERLLGPPDSAAEVLADLIAMYDAGR
RAPIPLPLKTSYAWAETDFHRGQPLREAGWKWKTGRYPGEDQDPAHVRVW
GPHFPLEDLVAAGLPDFAARLWLPMLRAERSAH
315446055YP_004078934.1 hypothetical protein Mspyr1_45480 [Mycobacterium gilvum Spyr1]MEPNGDPEARIRDLERPLADRARASELGTHPYGAPPVPPYQDVALPPMPP
GVEHPAPVYGSPYYAPPQRVVHKRSNTALWLIPVVVVVVLAAGIIGIVAY
FSSGTPDSYTYTPPVSGGGGPLDAPLPPQVQTRTDSTEQVITVDSGGFVS
IGGVEKNQTIVCDEGTVSISGVNNTIEVTGRCGSVTVSGVDNTVTVESAG
TISASGFHNRVTFLAGDPQTSTSGSGNVIERQ
315446054YP_004078933.1 NAD(P)H-nitrite reductase [Mycobacterium gilvum Spyr1]MAAPGFIAVGSGPAGVSAAETFRRRHPRIPVRILSADPALPYSKPPLSKE
FLGGGHTNLELHSVGWFARNDIDLHLGVTVDHIDVDTQEVVTVGGARYRY
WHLVLAPGSAAVPLSVPGGDSAQPLRSFSDAVALKMAARFADTAAVIGGG
LVGCETAARLAGMGLSTTLVVPEPAPLCRRFGPDVGERVHKMLTDAGVRV
VTSTTVIEVGSDGVTVATGERIAGEVVVAATGVRPDIRLAAEAGLATERG
RVVVDAHMRTSARNVYAAGDVTLAHNVAAGRPVVAEHWRDAAQQGLVAGL
TAAGTPAVWDKVPGFSATIGTFTLKYRGWGGRHDTSDLSERAGGFAVAYR
AGGRVVGTLDVTANPAP
315446053YP_004078932.1 Mg2+/Co2+ transporter [Mycobacterium gilvum Spyr1]MTHVHGRIWRDGKTADDFEFSAISEYLATEGTLLWCDIYDPDHATLKSLA
EEIGLNEWAVEDAIADAERTKAVVYKTHTFFTVYDVWVKDPAPEDNSEST
LEIHRISGFVLPRGLITVRISPHVDMEKVSRRYDDLGGQEHGVGSLVHAL
LDVVVDGHFAAVQSLDDGIESLEDDLFAERPLRGRLQRRTFQLRKDLVAL
RRVVLPMREVVTALQHRRLDARNAVELDAVYADLYDHVLRASEWTESLRD
MVTTVFETNLSLQDARLNIVMKKLTGWAAIIAVPTAITGFYGQNVDYPGI
DTVGGFVTSTSIIVVLVIVLYWTFKARDWL
315446052YP_004078931.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MTGTVSYDLADSVATVTLDDGKVNVLGPAMQAAINDALDRAEADKAKAVV
LAGNSRVFSGGFDLGVFQSGDAAAALGMLSGGFELSVRTLTFPVPVIIAA
TGPAIAMGSFLLLSGDHRVGQPKTRCQAIEVAIGMTIPIAALEIMRARLT
PAAFERSAALASTYVGDDAVAAGWLDEIVEADQVLTRAQQVAAEAATTLH
AGAHLATKLKARKYALDAIRAGIDGLATEFTLG
315446051YP_004078930.1 hypothetical protein Mspyr1_45440 [Mycobacterium gilvum Spyr1]MKNIALCFDRDRDGVAESTNASVSAVLLQRSADQIVWSPTCPGHRRGAFG
AGHTALDAARAAVAGAYGFLVDEWAPGDRLFLFGAGRGAVSAYALARLLG
TVGVLNGDVPGWTTDDFREYALSTYALPRTPRDAADWRRIAGVVAGLSDR
DDVAVEVAFLGLWDCVAPAGFARAGAVGRLPTVRSARHAVAIDGGYPHPG
PQLLGGAAGGGVEEVWFRGTHGDITGGRGARPWLAGVALDWVLDGAVRAG
AALRQCPERYATRGADALAGGVPAVTFRKVPEEATVHASVQCFLRAHPSY
WRRLPSRVVWADPDWDARSERLVPGSAAPPPAAEIPALVAAS
315446050YP_004078929.1 Zn-dependent hydrolase [Mycobacterium gilvum Spyr1]MADTDRLYFRQLLSGRDFAAGDMIAQQMRNFAYLIGDRETGDAVVVDPAY
AAGELVDALEADGMHLSGVLVTHHHPDHVGGSMMGFTLKGLAELLERVSV
PVHVNAHEADWVSKVTGIAPSELTTHQHGDTVSIGDIDIELLHTPGHTPG
SQCFLLDGRLVAGDTLFLEGCGRTDFPGGDVDDMFRSLQALAQLPGDPTV
FPGHWYSAEPSAPLSDVRGSNYVYRAGNLDQWRMLMGG
315446049YP_004078928.1 50S ribosomal protein L33 [Mycobacterium gilvum Spyr1]MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLEIKKFCPNCGKHQA
HKESR
315446048YP_004078927.1 acyl dehydratase [Mycobacterium gilvum Spyr1]MSFLDGFVGTHFRYPDHYVVGREKIREYAVAVKNFDPAFFDEDAAAELGH
DALLAPLTFISVFGYQAQWAMFAANNIGISDAKIVQVDQSLRFVRPIKAG
DELYCDVWIDSIRKAHGTDIIVTKNIVSNGNGDVVQESYTTLAGRSEEDG
ESGFSDGIA
315446047YP_004078926.1 acyl dehydratase [Mycobacterium gilvum Spyr1]MALREFSSVKVGDLLPEKVIPLTRADLVNYAGVSGDLNPIHWDDEIAKQV
GLDTAIAHGMLTMGVGGGYVTEWVGDPAAVTEYNVRFTAVVPVPNDGKGA
EIVFNGRVKSVDPESRSVTIALSATSGGKKIFGRAVAIAKLA
315446046YP_004078925.1 hypothetical protein Mspyr1_45370 [Mycobacterium gilvum Spyr1]MALKTDIRGMVWEYPDVFVVAREQIRQYANAVKAKDPASHDEAAAAELGH
GGVVAGPTFMSIFAVMIQNHFFQNVDIGLETMQIVQVDQKFLFHRPIKDG
DRLRGVMTILTVDERFGADIVTTRNVLTDDAGDIVMESFTTLMGHEGDNS
ISAGWDPETGQVVRKPVKHDEDVAEDVPEDVTAAE
315446045YP_004078924.1 protein translocase subunit secE/sec61 gamma [Mycobacterium gilvum MSDERDGVSSADTDNGTETDDGDNRGQTAVVTRPQRPTGKRSRRAVEADD
DADESPETDSSGSGSKDDDGRGPKARKKTSKRPKDQPSRNPIAFVINYLK
EVLGELRKVIWPNRKEMIAYTTTVLFFLIFMVAMIGGVDIGLARLITWIF
A
315446044YP_004078923.1 transcription antitermination protein nusG [Mycobacterium gilvum SpMTSFDGEAPSGDTVDIIDADDTNAEAGSDAVRSDEDAVPAEVADVVEGAD
AGESADETAPAEPEDEDPAVALKKELRLKPGDWYVIHSYAGYENKVKANL
ETRVQNLDVGDYIFQVEVPTEEVTEIKNGQRKQVNRKVLPGYILVRMELN
DESWGAVRNTPGVTGFVGATSRPSPLSLDDVVKFLLPPAAAKKPGKATAA
STAAAEVGATERPVIEVDFEVGESVTVMDGPFATLPASISEVNAEQQKLK
VLVSIFGRETPVELTFNQVAKI
315446043YP_004078922.1 50S ribosomal protein L11 [Mycobacterium gilvum Spyr1]MPPKKKVTGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATES
QRGNVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVPKGSGEPHKTKVA
KVTWDQVREIAETKKEDLNANDIDQAAKIIAGTARSMGITVE
315446042YP_004078921.1 50S ribosomal protein L1P [Mycobacterium gilvum Spyr1]MSKNSKAYKEAAEKIDRDRVYSPLEAAKLAKETSSKKQDATVEVAIRLGV
DPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKAEAAVAAGADVVGSDDL
IEKIQGGFLDFDAAIATPDQMAKVGRIARILGPRGLMPNPKTGTVTPDVT
KAVNDIKGGKINFRVDKQANLHFVIGKASFDEKALAENYGAALDEILRAK
PSSSKGRYLKKVVVSTTTGPGIPVDPTVTRNFTEEPAQS
315446041YP_004078920.1 hypothetical protein Mspyr1_45310 [Mycobacterium gilvum Spyr1]MGDGRSATNFLAEWYLADLAEATVDDITTRIRTATEVTTAEGAPIRLVAT
LAVPSDEVLYGVFDAASSDAVVAACLRAGFPQQRLSCDVLTRFASGAA
315446040YP_004078919.1 methyltransferase- cyclopropane fatty acid synthase [Mycobacterium MSDNSTGTKDMTPHFEDIQAHYDLSDDFFGVFQDPTRKYSCAFFTGPNAT
LSEAQIANVDQHLDRLDLKPGMTLLEVGCGWGLTLQRAMEKYDVNVIGLT
LSKNQKAYCDQLLAKVDSERTFDVRLEGWEQFHSPVDRIVSIEAFEHFGK
DRWDDFFKTCFDILPEDGRMTVQSSVGYHPYDLAERGKKLTFELARFVKF
MITEIFPGGRVPTTQMMVEHGEKAGFVVPETLSLRNHYIKTLGIWASRLE
AAKDEAIAATDEENYNRYMKYLTGCQYYFIDEAIDVSLVTYLKPAGAA
315446039YP_004078918.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMQIRTGTARSGELEIHYEDMGDPNDPAVLLIMGLGAQLLLWRKGFCEKLI
NQGLRVIRFDNRDVGLSSKLTGHRAGAPLLPRMARSLAGLPSPAAYTLED
MADDAAALLDHLDIDRAHVVGGSMGGMIGQVFAARHHPRTKTLGVIFSSN
NQAALPPPGPRQLAAILQRPKGSSRDEIVDNAVRVSRIIGSPGYPAPLDR
LRTDAIEGFDRSYYPAGVGRHFAAILGSGSLRRYDRQITAPTVVIHGKAD
KLMRPSGGRAIARAIPGARLVLFDGMGHDLPEPLWDDIVGELKTTFAEAP
315446038YP_004078917.1 protein kinase [Mycobacterium gilvum Spyr1]MSSTQKNQRTPHRAVARLDRVPLPMEAARIGVTGWQITRTGGRVLSSLTT
RGTLQQKVVKQIPQAFADLGPTYVKFGQIIASSPGAFGEPLSREFRGLLD
RVPPADSDAVHKLLREDLGDEPQNLFKSFDEKPFASASIAQVHYATLHSG
EEVVVKIQRPGIRRRVAADLQILKRGARLVEFAKLGQRLSAQDVVADFAD
NLAEELDFRLEAQSMDAWVAHMHASPLGQDIRVPQVYWDLTSERVLTMER
ITGVRIDDVAAIRKKGFDGEALVKALLFSVFEGGLRHGLFHGDLHAGNLY
VDDDGKVVFFDFGIMGRIDPRTRWLLRELVYALLVKKDHAAAGKIVVLMG
AVGTMRPEAEAARDLEKFATPLTLKSLGDLSYAEIGKQLSTLADAYDVKL
PRELVLIGKQFLYVERYMKLLAPKWQMMSDPALTGYFANFMVEVSREHGT
DTGPDA
315446037YP_004078916.1 hypothetical protein Mspyr1_45270 [Mycobacterium gilvum Spyr1]MFLPHQIVGDQLNKQFDANVRTNFFRGMDFAGPVGDPGWFGPGSAVWHVH
SHMPALVFGLQCAAFLERLDPSIYWMGVHHSRLVKPETKNNPMPEIDPQG
FWARLGHSVAFFTGTAYGSTPTAERLALAVRSMHHTIKGTRPDGARYDAD
DPEWLRWNYATVVWGIATAHELYHPQPLRGKKLDRYYGEFVRVGHALGGT
DLPATKQDTLDCLKSYLPRLAVTYGAAMATGPGLPIPLAALNWAVRDTMP
SWAKGLIQHRDPNIVERTARRATVWSVINGWHAAAGPLPEFAEATARVAD
GIDPDLAPHTVPAYQPGSDPVRTRTELEDAFA
315446036YP_004078915.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSGAPHATRWAGVPLTDRRAERRALLVDAALRLFGDGGESAVSVRSVSRE
CGLNTRYFYESFGGTDDLLGAVYDRVSAELSVAVADAMDHAEDSLRARTR
AGMAAVLHFSSADPRRGRVLFTDARSNPVLTARRAATQDLLREAVLTEGW
RLHPDTDPIAAATGAAMYTGAMAELAQQWLSGNLGDDLDVVVDHALRLVL
R
315446035YP_004078914.1 hypothetical protein Mspyr1_45250 [Mycobacterium gilvum Spyr1]MPALPPPIADERAGLREYLAAQQYAFHAIAFGLTDEQARSTPSVSALSIG
GLIKHVTHCQRGWMERVAAAPELCESDRRPMEDQADEYGDEFVVREDETL
ADILAAFQRQNDETLRLLESVDLGAAVPIPQHVPWFPKDVPAWSVRWVFF
HMIEELARHAGQGDIVRESIDGATLYELVAGLEGWPATEWLTPFTPAEV
315446034YP_004078913.1 hypothetical protein Mspyr1_45240 [Mycobacterium gilvum Spyr1]MSNDLTRRLAEQLDWHWAHQLRPRLAGLTDDEYFWEPVPDCWTVHRDGTV
DFAYPPPTPEPVTTIAWRLAHLIVGVLGARTHSHFGGPPADYGTWNYALD
AESALAQLDEAYAGWITGVRGFDDADLTKPCGPAEGPYAAEPMTALVLHI
NREMIHHGAEIALLRDLFAHTKEN
315446033YP_004078912.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MSETTGRVLQLLGLLQSRRVWSGDELAARLRVTTRSVRRDIDRLRELGYP
VHASTGHGGGYQLGAGAALPPLLLDPDEAVAVAVCLRVAAGGSVAGVGES
ALRALSKLDQVMPSRLRSQVAAVHDTTVTLAGATDTPVEPEVLMTLARAS
RDHEHVTVGYTDVRGNVTSRRLEPYQLVTTGRRWYLMCFDRDRDDWRSLR
LDRMSDVRAVGTTFIPREAPDAASYVRRAISSSPYPYVARVRYRAPADVV
ARVFPAASVDVEPDGPDACIVTVGADDPQRMVPWLAMPGCEFEVLEPDEV
VDAVRVVAERIARAGAGGD
315446032YP_004078911.1 hypothetical protein Mspyr1_45220 [Mycobacterium gilvum Spyr1]MAAPSRILARSAAMLGIASLGAVGAVAFISVGAGTAGADVKRMAPRPVVT
SRQASQNSVIRINDMGVARGISEARLGDAGVVHAQGDVRDSTKAVLGNKA
RPFRGGFPSGPSIGEW
315446031YP_004078910.1 alpha-mannosidase [Mycobacterium gilvum Spyr1]MDVLSAASTELFTGPPDAPMQVVRVTYRDCAMPTPVRVEGAGLRTVGEPV
AEPGGVSVEVSVQVADPAPGRRRDATVVAGDTSAAFDFVDAEPGWTMFMV
SHFHYDPVWWNTQAAYTSVWTEDPPGRCRQTNGFELVSAHLDMARRDPEY
TFVLAEVDYLKPFWDTHPWERADLRRLIAEGRVEIMGGTYNEPNTNLTSP
ETAIRNFVHGIGFQRDVLGAEPATAWQLDVFGHDPQFPGMAADAGLTSSS
WARGPHHQWGPMAEVDGRAGDPARMQFASEFEWIAPSGRGLLTHYMPAHY
AGGWWMDSSATLQEAEDATFELFTNLKKVALTRNVLLPVGTDYTPPNKWV
TDIHRDWNARYTWPRFVCALPREFFAAVRAELDARGGTASPQTRDMNPIY
TGKDVSYIDTKQANRAAENATLEAEQFAVFAGALTGATYPDAALAKAWVQ
LAYGAHHDAITGSESDQVYLDLLTGWRDAWQLGTTARDHALALLSDSVDA
SVVVWNPLSHNRCDMVTVRLEEPFTGGMIDRDGNAVPVLTEHGGRTVTWR
ARDVPSLGWQSYTFVPGDQGGGWEPSEGDEIANDRYRVRVDPARGGGVCS
LQADGRELVAEGRVGNELTVYAEYPAHPVAGEGPWHLLPRGPVTSSSQHP
ATAVRRYRSALGERLVIDGGIPGLFTYTQTLTLWHGVDRLDCRTTVDDFG
GSDRLLRLRWPCPITGAMPVSEVGDAVIGRGFALLHDPDSGESVDAAVHS
HTLDNPAFGWFGLSSALRVRFRGDAVRAVSVAEVISPSGCEPAVRKLVAA
LARAGVTATCTAADAPRYGDLSIDSNLPDLRISVGGVDENAFTATILTGV
VGDPPRWIPAARPLREVWVPGADLRDPSALPVLVVGADGDVDDAIAALID
DLADAQIRIDQDVDEHFESYTVAMINRGVPGFAVEADGTLNASLMRSCTG
WPSGTWIDPPRRTAPDGSNFQLQHWTHAFDYAVVAGEGDWRDLRMPSRAA
EFNQPLLPVPARHDPSRGGLPSWGSLLDVAPERDVRVAALKAHGNPTARG
SARRGGPHDGVTLRVVETLGRDAEVSVQSGLRHIDAPQRLNLIEEPLRET
RRTAHLAGYEIATLRTELNFPRIRNAEQMSLAPDAEPVQPLYARYWLHNR
GPAPLGGLPAVAHLHPHRLQAVGSEVVTLRLTVASDATDTALHGRVRLVA
PPGWDLGVDELPFVVPPGEYLESTVEVRVPGDVMPGHYPVRAELALVGGE
IPAAWHQTVEDVAVISVGGHADPLLHWVAEPQAVHVDAGQVASLGITVGS
AAHADLTVEAHLISPWGTWEWLRPNIVGGALPARGGLALHFEVAPPVGTA
PGRWWALIRVACAGELLYSPAVPVVVRR
315446030YP_004078909.1 hypothetical protein Mspyr1_45200 [Mycobacterium gilvum Spyr1]MTGWAATVGADVITVAEVDAREDRLRAGDRAHALPRPGTAEARQLRRWLT
QVLVAERIVAASPGTDPAPSAQDLLLDEVGYRELGSVAAATLATPHGRAV
YAGVTSEVQVGDDAVADYHHRNPYRFARGDARPGTWRGPSSPPQFDDVLP
LIRAHLLAAARRREYRRWLDARCAALVTLAGGYEHPGDPRQPDNTHRH
315446029YP_004078908.1 glucokinase [Mycobacterium gilvum Spyr1]MSDLTLALDIGGTKLAAGLVDADGNLVHRAQTPTPDGDPEILWAAVASLL
TDVRSAAEATIGAVGIASAGPVDVPAGTVSPINITEWHRFPIVERVETAT
GLPAYLGGDGLCMAMGEWWRGAGRGRRSLLGMVVSTGIGGGLVLDGAPFH
GRTGNAGHVGHVVVEPDGDACTCGGRGCVETVASGPHLARWARTHGWAGA
DARQLAEDAAGGDEVALRAFARGADAVARTIASVAAVCDLDLVVVGGGVA
KSGALLFDPLRASLQTYAGLDFLRGLQVVAAELGGDAGLVGAAALAAHHG
RFG
315446028YP_004078907.1 50S ribosomal protein L10 [Mycobacterium gilvum Spyr1]MAKADKATAVADIAEKFKESTATVVTEYRGLTVSNLAELRRSLGSSTTYT
VAKNTLVKRAAAEAGIEGLDELFVGPTAIAFIEGEPVDAAKALKKFAKDN
KALVVKGGYMDGRALSVSEVERIADLESREVLLSKFAGALKAKQSQAAAL
FAAPASQVARLAAALQEKKSGAENSDAA
315446027YP_004078906.1 50S ribosomal protein L12 [Mycobacterium gilvum Spyr1]MAKLSTDELLDAFKEMTLLELSEFVKQFEETFDVTAAAPVAVAAAGPAAG
GGAAEAAEEQSEFDVILEGAGEKKIGVIKVVREIVSGLGLKEAKDLVDSA
PKPLLEKVNKEAAEDAKAKLEAAGASVTVK
315446026YP_004078905.1 organic solvent resistance ABC transporter ATPase [Mycobacterium giMGIGIQVEGLTKSFGSQRIWEDVTFDLPAGEVSVLLGPSGTGKSVFLKSL
IGLLRPERGKIVVDGTNIIECSAKELYEIRTLFGVMFQDGALFGSMSLYD
NTAFPLREHTKKKESEIRKIVMEKLDLVGLGGDEDKFPGEISGGMRKRAG
LARSLVLDPQIILCDEPDSGLDPVRTAYLSQLLIDINAQIDCTILIVTHN
INIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVKQFLNGRRIGPIGM
SEEKDESTMAEEQAMVDAGHHDGGTEEIEGVPPQVMATPGMPERKAVGRR
QARVREIMHTLPPAAQEAIRADLENTQQTQPYPDGYSDGTTAHHARHDDE
TPTGRIPVAGER
315446025YP_004078904.1 hypothetical protein Mspyr1_45150 [Mycobacterium gilvum Spyr1]MGDRLSVLIGAGVLAAGMSTAVLTGAGVAVASPDTASSTSATSETSDTSG
SERVSEKPADPRGEKADETPDETEAPDSVEDVVQDLDDEPDETDDRDDAA
TEADLDTDVAVDADEADEVADVEEPQADVEVPAVEVPAVVDQPASTVAVE
EPVAAVLVPATTTTPIEAHVARASASEAATPPRRQTLLSVLGAVVFNIYS
VALRVLGGPPILPPNSTVTVRSSTLTIDCGDGYEVPADWYVPDGPTPTRL
IYFQHGFMAAGPFYSFTAARLAEATHSIVVTTSLTSNFLACDGCWVGGTP
MHRAVADLFGDGNSALGDSAVAAGYAGALLDGVDKVALIGHSAGGGLAAG
AAAAMTGNGAFDRLAGVVMLDGVGFGDVTPRALERLPLDFPIYNLAARSY
FWNMSGTTNTEMETWRPGGFNGVKLDDSSHGDAMTGGNVFVQVAMNLVTG
WPKPANARAAELISAGWLDDMFTATSASGFYGAPNATLSIETASGVATAR
VLPGPAEKLTFIDRLFTAGSMILFGIDFATCADTDAGPEAQIGESAGIGR
PNTALSLDGRAKAGQSIGQQCVHG
315446024YP_004078903.1 DNA-directed RNA polymerase subunit beta [Mycobacterium gilvum SpyrMLEGCILAGSRQIESTTNNSVPGAPNRISFAKLREPLEVPGLLDVQTESF
EWLIGAEDWFQRAVDRGDVDPKGGLQEVLEELSPIEDFSGSMSLSFSDPR
FDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMT
EKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVKVIPGRGAW
LEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMST
LEKDNTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARV
GRYKVNKKLGLNVGQPITSSTLTEEDVVATIEYLVRLHQGDQTMTAPGGS
EVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQDVEA
ITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPG
GLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGF
IETPYRKVVDGVVSDQIDYLTADEEDRHVVAQANSPLDGDGRFEEERVLV
RRKGGEVEFVSASEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANM
QRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVTDKAGVVEEVSADYITVM
ADDGTRHTYRMRKFARSNHGTCANQRPIVDAGQRVETGQVLADGPCTENG
EMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARD
TKLGAEEITRDIPNVSDEVLADLDERGIIRIGAEVRDGDILVGKVTPKGE
TELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDEL
PAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGT
PVDIILNTHGVPRRMNIGQILETHLGWVAKAGWNIRLASDGADGSTEVPA
WAAKLPEHMLSAPADSIVATPVFDGAQEGELQGLLGATLPNRDGETMVNS
DGKAVLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQ
QPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYE
AIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDED
LERAAANLGINLSRNESASVEDLA
315446023YP_004078902.1 DNA-directed RNA polymerase subunit beta' [Mycobacterium gilvum SpyMLDVNFFDELRIGLATADDIRNWSFGEVKKPETINYRTLKPEKDGLFCEK
IFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAP
VTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITAVDDEMRHNELST
LEAEMVVEKKAIEDQRDADLEARAQKLEADMKELEEEGAKSDVRRKVRDG
GEREMRQLRDRAQRELDRLDEIWTTFTKLAPKQLIVDELLYRELQDRYGE
YFEGAMGAESIKKLIETFDIDAEADSLRDTIKNGKGQKKLRALKRLKVVA
AFQTNRNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINR
NNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALE
LFKPFVMKRLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVISEHPVLLNR
APTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAE
AQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYFLTTEIEGDKGEFT
PAAKDQPESGVYSSPAEAIMAMDRGALSVRAKIRVRLTQLRPPAEIEAER
FPDGWNMGDAWTAETTLGRVLFNELLPRGYPFVNKQMHKKVQAAIINDLA
ERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPEKQEILERYEA
AADSIEKQYQRGKLDKGERNEALVKIWQDATEEVGQALRSHYPKDNPIIT
IVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPIKSSFREGLTVLEYFI
NTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRETDCETERGITVTL
AELQGDQLLRDQHIETSAYARTLATDAVDANGNVVVERGHDLGDPAIDAL
LAAGITEVKVRSVLTCATGTGVCAMCYGRSMATGKLVDIGEAVGIVAAQS
IGEPGTQLTMRTFHQGGVTGGADIVGGLPRVQELFEARIPRNRAPIADVS
GRIRLEESDKFYKITIVPDDGGEEVVYDKLSRRQRLKVFKHDDGSERLLT
DGDHVEVGQQLLEGSADPHEVLRVQGPREVQIHLVKEVQEVYRAQGVSIH
DKHIEVIVRQMLRRVTIIDSGATEFLPGSLTERGEFETENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLQGLKE
NVIIGKLIPAGTGINRYRNIQVQPTEEARAAAYTIPSYEDQYYSPDFGQA
TGAAVPLDDYGYSDYR
315446022YP_004078901.1 K+dependent Na+ exchanger related-protein [Mycobacterium gilvum SpyMNALWFVVGLLTVIAGAEVMVRGGAEVAARLGISPIIIGLTVVSIGTSMP
ELAVGVVSAADGSGALAVGNIAGTNVVNILLILGLSALLVPLALAMRTIR
FELPMMAVAALLFWGLAADGNLSRLDGGILVTAAVGYTAAVIWSARRESR
AIAAEFASEFAPEPVATTTEVRRRTATHVAMTVGGIVVVVIGADWLVDGA
VGMARQFGVTDALIGLTVVAIGTSAPELVTTVMTTLRGDRDIAIGNLIGS
SIYNILLILGITCLVPAGGLALTEGLVRIDIPVMVVVGLACIPIFLSGRR
VSRMEGGMMVAAYLGYLAFVLSTQT
315446021YP_004078900.1 endonuclease IV [Mycobacterium gilvum Spyr1]MLIGSHVHGDDPLAAAEADGADVVQFFLGNPQSWKKPPPRDDADVLKAAS
MPIYVHAPYLINVASANNRVRIPSRKILQDTCDAASDIGATAVIVHGGHA
DDNDMDAGFERWVKALASLKTDVPVYLENTAGGDHAMARHFDTIARLWDH
IGDMGIGFCLDTCHAWAAGEALIDAVERIKGITGRIDLVHCNDSRDAAGS
GADRHANFGTGQIDPQLLVAVVTAAGAPVICETSDDGRKDDIAFLREHVS
315446020YP_004078899.1 collagen triple helix repeat protein [Mycobacterium gilvum Spyr1]MTAAIQLTSTGSDASEPWYVVNFGGGAAPSTNALANAVDYSRACGLICNG
ADGTAENPNGQAGGILFGNGGNGWNSTIAGVDGGNGGNGGLFGGNGGNGG
NGYWGVVGAAGAVGAPGAAGAAGAAGAASGVVGGWGTAVPNGDLPDLPGL
PPIGGAGAVGAIGTPGTVGSTGSTGTTGAVGTVGADGDNGEAGASGAPGA
AGATGVTGSSGGNGGVGFLGGAGEAGEAGGVGGVGGVGTTGGAGGVGGAG
NQGGNGGAGATGNAGLQGLPGLKGGKGLAGGAGGVGGVGGTGSASLSIGG
AGSTGGVGSKGGNGGNAGLFSLFGKGGNAGNGGTGGTGGAGGAGGTGGTG
GTGGTGGTGAQGGTGGTGGTGGTGGTGGTGGTGGTGGQGGTGGTGGVGGT
GGDGGVGGTGGNGGNGGTGGTGGAGGTGGATGTGTGSGIGGTGGQGGTGG
TGGAGGTGGTGGAAGLGGAGGTGGVGGVGGAGGTGGAGGTGGAPGVGGAG
GDGGDGGAGGAGGAGGAGGAGGPGGSTGGAGGAGGQAGSAGKGGLFGGNG
KAGTNGATGAAGASGAAGATGSQGATGATGAQGAQGATGAVGQDGLDWGD
DGADGATGAAGATGSAGSNGANGAGGAAGEQGEAGEAGEAGSPGSPGTAG
SGTTGGEGGDGGAGGSGGSGGEGGAGGSNGASGDD
315446019YP_004078898.1 formyltetrahydrofolate deformylase [Mycobacterium gilvum Spyr1]MNEPVQHDIQMGKDVGRLLLRCADRPGLVAAVSTFLAEAGANIISLDQHS
TQQTGGTFMQRTIFHLPGLTAARDALERDFGERVADVFGMDFRLTEAAKP
KRVAIMASKEDHCLIDLLWRNRRGELDMSVVMVIANHPDLADQVRPFGVP
FIHVPARKDIRESAEQRQLDLLRGNVDLVVLARYMQILTPSFIDQVGCPL
INIHHSFLPAFIGASPYRRARERGVKLVGATAHYVTDDLDEGPIIEQDVV
RVDHRHSVDDLVRLGADVERAVLSRAVLWHCEDRVIRFGNQTIRL
315446018YP_004078897.1 glycosyl transferase family protein [Mycobacterium gilvum Spyr1]MSARTPTICLNMIVRNEAHIVHEVLDSVAPYISSWVIVDTGSDDGTQDKI
RNHMAALGIRGELHERPWRDFGHNRSEAISLAQGHADYIWVMDADDLVVG
TPDFSNLTADVYQLLYGPGVSYWRRQLFRDGLPWRYVGVLHEYADCDAPC
VEERLVGDYHIESRRLGGRNLDPEKYARDAEILLAEVERHPDDPRSVFYL
AQSYYDYGDFGNARKWYQRRTELAGFDEELYMAHLRVAEAMARLGEPWPD
VQDAYLRAWEFRPTRAEPLHAIAHHYRSNQRYQLGYFFAERAARIPLPEQ
DVLFVNTAVYEWCAVDEQAVCASWIGKHEEAFALCRQMLARADISDEDRR
RIAANRDCSAGPMIEAALAYPATSVRGWGVRIGGDVTITLIAGRSRETTE
RTLNSFLNCCTDVSRLARTLIVDVGLEPEDVALLADSYPFVEFRKLPPNL
DLRQLRAQVETRYWLHLGMGWQFFAPDDLIGRLAGVVESGAEFVQVGINY
GDADKLGDGQVPEQSARREAPGGHYVLAGTPVSGPALFDCLRLDSALAKD
VDSRVTIAELGRHADETGLTIATLDEVLCTRQL
315446017YP_004078896.1 O-methyltransferase [Mycobacterium gilvum Spyr1]MSIDTAYMRDAMTRRLLRRGASTGQITLPAVPGMLDQYVSMCNNIFAALG
RKFSRDELDHLRSLLAKELANAFAGSNRSNIVISYDAPIGTTLNYFIQPQ
AMSLADTYDNWVATRKPPLFGTNPDARVMALANEIADPAAGRVLDIGAGT
GRNALALARRGHPVDAVELTSKFADILRAEAYKHLFNIRVIDRDVFETMD
DLRKDYQLVILSEVVSDFRNAMQLRAIFELASECLAPGGHLVFNTFVPRP
GLLSDDAVRELADAAREFGQQVYTSIFTGEEIDTASAGLPLRLLTNDSVF
EYEQANLPAGCWPPTGWYADWVSGLDLFDVPREQSPVEMRWLVYQKTG
315446016YP_004078895.1 hypothetical protein Mspyr1_45060 [Mycobacterium gilvum Spyr1]MADPKEDERDSNAESRVSRVPQKVSRQTSPLTPIALVVSLIAVGIAVWAL
VSAPEPSSVSSEGVPLTGDPKDRICTAGHAVAMAVQLQTNANVGADPAAI
EAVAANARLAMLGGGDYLLSQISEDAPKDVADTARSFGNTLQQLGLNALA
GVANDNDLQAGRYREAEESRNKLAQLCVR
315446015YP_004078894.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MSVPDTHAVINQVPPLENFNPASSPVLAEALIREGGGWGADDVADLGALA
GSVTAVRWGELADRNRPMLRTHDRYGHRVDEVEFDPSYHELMNVAVTHGL
HAAPWADDRVGAHVVRAAKTSVWTPEAGHLCPISMTYAVVPALRHNPDLA
AVYEPLLTSRVYDAELRVPTTKPGITAGMSMTEKQGGSDVRAGTTEARAN
GDGTYRLTGHKWFTSAPMCDIFLVLAQAPGGLSCFFLPRILPDGTRNRMF
LQRLKDKLGNHANASSEVEYDGATAWLVGEEGRGVPTIIEMVNLTRLDCT
LGSATSMRNGLMRAVHHAQHRKAFGRYLIDQPLMRNVLADLAVEAEAATM
LAMRMAGATDRAVRGDERETLLRRIGLAAAKYWVCKRATPHAAEAMECLG
GNGYVEDFGMARLYREAPLMGIWEGSGNVSALDALRAMATRPECIEVLFG
ELAETDGQDPRLDAHVHRLRLELSDIDAIEYRARRVAEDISLALQGSLLV
RHGHPAVAEVFLASRLGGQWGGAFGTLPVGLDLAPVIERAMVKA
315446014YP_004078893.1 phenylacetic acid-responsive transcriptional repressor [MycobacteriMVIRPLTARSVVLSVLLGAHPASASAAELVRLAGDFDIRESTVRVALTRM
VTAGDLVRSKDGYRLSDRLLARQRRQDDALSPRRTDWDGMWRTVVITSVG
NDARARSALRNSLQEKRFAELREGVWMRPDNIEIALDAEVMSRVRILRAC
DEDPEELAQKLWDLPKWGAIGHDLLGEMADAADFPGRFVVAAAMIRHLLT
DPVLPDALLPPHWPGAALRSAYENFAAELVSRRDGIDLMEAR
315446013YP_004078892.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MSDSGGVRVEKRGPVTTVIMNRPHARNAVHGTAASELYAAFDAFDKDESA
AVAVLWGDNGTFCAGADLKAIGTPESNPTHRTGPGPMGPTRMVLSKPVIA
AISGFAVAGGLELALWCDLRVVEQDAVMGVFCRRWGVPLIDGGTVRLPRL
IGHSRAMDLILTGRPVEAEEALAIGLANRVVPKGEARRHAEDLAAELARL
PQQCLRSDRLSVLNQWGLSEADAMDAEFASLSRVAAESLVGAKRFSAGAG
RHGTSA
315446012YP_004078891.1 hypothetical protein Mspyr1_45020 [Mycobacterium gilvum Spyr1]MENERTKYAACPLCESGEISALATVNCTGHAMWREPLEPNITWMQCGTCD
HVFTDGFFTEAALDVLFGNTQDMQIVGNDIEYHRNISAKMVQRVVEALGL
PNDRLWLDIGFGNGSLLMTAKEFGFDVFGIDLRKKNVEDLNACGFSAYHG
TLRSAASEVTFNSRPSVISMADVVEHEPYPLETLRTARELISSPGMLLIS
MPNASAPLWHYWNATDQNPYWHEIEHYHNFTRERLYDVLRDSGFEPRHYA
ISERYRCCMEVLAATA
315446011YP_004078890.1 hypothetical protein Mspyr1_45010 [Mycobacterium gilvum Spyr1]MIGVLGAAAVTLAGCSFGGGDDPTVTAGTSGAQIEIGNTINYGSFGTTAE
IDCADGKSVNVGGSNNTLTVKGTCAKANIGGADNKIDFERVETELSVVGL
NNTVTYRDGDPQVNDTGSNNTITKG
315446010YP_004078889.1 hypothetical protein Mspyr1_45000 [Mycobacterium gilvum Spyr1]MTATAAGRVLAVSALSAAAALMSTSPVAQAENGDTHITGVGVVRTIDCKD
STLFVNGNGNQVFAIGNCYAVTVQGSSNLVVVDSVANDITVYGWDQKVFY
KNGSPFVWDRGRELGMTNQINRVPA
315446009YP_004078888.1 hypothetical protein Mspyr1_44990 [Mycobacterium gilvum Spyr1]MLQRVGRVAFPFLVAVSAAATATSCAHTVTGTAQSAQANVPDADRSYGYV
DDRCGLLEDGTVQELLGADVVTRPYSGAVCQYVLALKSAPTATTIDVVYS
WFDAGTLQRERDLATARGAVVEDTVIERHQAFLARRDTTGAACSATAAAG
SGVLAWWVQYRGRESAGDPCAEAEKLLSATLRSDM
315446008YP_004078887.1 hypothetical protein Mspyr1_44980 [Mycobacterium gilvum Spyr1]MTAGSAARLAAALSLGALLAGCGAPDRPVTPPSSPAAPGDGFESADCNGV
TDADVARAAGPGMFAPAVVSDVGCFWQEDTMIEDVGAGMGITTWWYRGSD
MDTERDLEQLAGRTLTEWSIDDNEGFKAFDDSACSIYVAKGGDVITWSIQ
TMNSATMPDLCPVVEQLAQLSQQRVN
315446007YP_004078886.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAARPPRTAKLSRDSIVNAALTFLDREGWDALTINALANQLGTKGPSLYN
HVHSLDDLRRTVRMRVVGDIIDMLNTVAQGRNPDDAVVVMASAYRSYAHH
HPGRYSAFTRMPLGGGDDPEFTEVTRAAAAPVIAVLSSYGLDDEAGFYAA
LEFWSAMHGFVLLEMTGVMNGIDTDAVFTDMVMRLAAGMQTR
315446006YP_004078885.1 30S ribosomal protein S12 [Mycobacterium gilvum Spyr1]MPTINQLVRKGRRDKIAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALR
KVARVRLTSAVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
315446005YP_004078884.1 30S ribosomal protein S7 [Mycobacterium gilvum Spyr1]MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLDGKKSLAERIVYGALEQA
REKTGTDPVVTLKRAMDNVKPSLEVRSRRVGGATYQVPVEVRPDRSVTLA
LRWLVSFSKARREKTMIERLANEILDASNGLGAAVKRREDTHKMAEANRA
FAHYRW
315446004YP_004078883.1 translation elongation factor 2 (EF-2/EF-G) [Mycobacterium gilvum SMAQDVLTDLSKVRNIGIMAHIDAGKTTTTERILYYTGVNYKIGETHDGAS
TTDWMEQEQERGITITSAAVTCFWNQNQINIIDTPGHVDFTVEVERSLRV
LDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKLGADFYFTV
RTIEERLGARPLVIQLPIGAENDFIGIIDLVEMKAKVWRGETALGEKYEV
EEIPADLADKAEEYRTKLIEAVAETDEALLEKYFGGEELSIDEIKGAIRK
LTVASELYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVESVTGHVPNKED
EVISRKPSTDEPFSALAFKIAVHPFFGKLTYVRVYSGTVESGSQVINSTK
GKKERLGKLFQMHANKENPVERASAGHIYAVIGLKDTTTGDTLCDANQQI
VLESMTFPDPVIEVAIEPKTKSDQEKLGTAIQKLAEEDPTFKVHLDQETG
QTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYRETIRRKVEKVEFT
HKKQTGGSGQFAKVLIDLEPFSGEDGATYEFENKVTGGRIPREYIPSVDA
GAQDAMQYGVLAGYPLVNIKVTLLDGAFHEVDSSEMAFKVAGSQVLKKAA
QAAQPVILEPIMAVEVITPEDYMGDVIGDLNSRRGQIQAMEERSGARVVK
AQVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIAKATGQ
315446003YP_004078882.1 translation elongation factor 1A (EF-1A/EF-Tu) [Mycobacterium gilvuMAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDQYPDLNESRAFD
QIDNAPEERQRGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQ
MDGAILVVAATDGPMPQTREHVLLARQVGVPYILVALNKADMVDDEELIE
LVEMEVRELLAAQDFDEDAPVVKVSALKALEGDEKWVKSVQELMAAVDES
IPDPVRETDKPFLMPVEDVFTITGRGTVVTGRVERGVINVNEEVEIVGIR
PTVTKTTVTGVEMFRKLLDQGQAGDNVGLLVRGIKREDVERGQVVVKPGT
TTPHTEFEGSVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGT
EMVMPGDNTDIAVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
315446002YP_004078881.1 Cutinase [Mycobacterium gilvum Spyr1]MIGMSAGVATAQPAQPACPDVHWIGAAGSGERLGAGAADGEMGRVIAKSY
RDFAGLIQQSGRTITAEAVNYPAVAVPEDGGILDWAGFMGSVDTGTAALG
QQYQAFVAQCPTSQVVLAGYSQGAMVVHRNLHSLDASPNLAAALLVADGD
RLPQDPTVNIGSVTAVPGAGKGVAQDWPILAHAPAPLPVTMGARTISVCN
LGDAVCDYDPDAEDEMNPAAVAVHTSYARKAGAMDSWTVPLYQLVTQRQA
PLPAYPVQVTAGS
315446001YP_004078880.1 hypothetical protein Mspyr1_44910 [Mycobacterium gilvum Spyr1]MSTFWRYVKIQAFVLLCGIVGPIFLVIYFATGADPLLAWMFWTGLLITAA
DVLIALAITGFGARSAAKKQALEATGVLALGQIVGIHETNTRINDQPLVK
IDLQVSGPGITPFSTQDQVVASVSRLPMITNRQLAMLVDPITNDYQIDWE
RSALVSGMMPATFTISEDNQTYDLTGQTEPLMEILQVLKSHGIGVDHMID
LRSNPAARQQVQAIVRRAVAQQAPPPPVPAGAPYLAAAPEPTTAQRLQEL
ETLRATGSITDDEYAAKRAEIIAEL
315446000YP_004078879.1 hypothetical protein Mspyr1_44900 [Mycobacterium gilvum Spyr1]MPMSSGTPLEGRVALITGAARGQGRAHAIRLAADGADIVALDVCKPVSES
VTYPMPTSEDLAETVRLVEETGRKVLAREVDIRDLAAQQQLVADAVEQFG
RLDIVVANAGVLSWGRIWEMSEDQWDTVVDVNLNGTWRTVRAAVPAMIEA
GNGGSIIIVSSSAGLKATPGNAHYAASKHGLVALTNALALEAGEFGIRVN
SIHPYSIDTPMIEKDAMMEIFSKYPTFLHSFAPMPFKPVARDGKPGLQEF
MTVEEVSDVVAWLAGDSSATISGSQIAVDRGTMKY
315445999YP_004078878.1 ornithine aminotransferase [Mycobacterium gilvum Spyr1]MTAVHATTDALIAAEARHVAHNYSPLPVVAASAQGAWITDVEGRRHLDCL
AAYSAVNFGHRNPEIIAAAHAQLDAVTLVSRAFHSDQLGPFAEALAGLCG
KDMVLPMNSGAEAVESGIKVARKWGTDVKGVSDSTIIVARNNFHGRTTTI
ISFSDDDTARRGFGPYTPGFRSVPFGDADALEQAIDGNTVAVLLEPIQGE
AGIIVPPDDYLPRVRALCTEHDVLMIADEIQSGLARTGRTFACDHWGVAP
DVYLLGKALGGGVVPLSAVVADRDVLGVLHPGEHGSTFGGNPLAAAIGRT
VVDILERGEFQQRATDLGAHLQARLTALTGRGVVAVRGKGLWAGVDIDPA
HGTGKQISLRLAERGVLVKDTHGSTLRFAPPLVITADEIDWAVARLEEVL
T
315445998YP_004078877.1 N-dimethylarginine dimethylaminohydrolase [Mycobacterium gilvum SpyMDIAAARPLRHAPTPRSARPRRYLMTAPQFFAVDYVINPWMDASVVVDTD
RAITQWETLRQTYLDLGHSVDLIDPVPGLPDMVYAANGGTVLNGRAVVAR
FAHPERAREAVAYADWMTRNGYDAFETRHVNEGQGDLLTVGGVVLAGFGF
RTDRRAHDEVAGHIGLPVVSLELVDPRFYHLDTALAVLDDATVAYYPPAF
SQDSRATLAGMFPDAIEVASADAYVLGLNVVSDGLNVVLPAAATGFAEQL
RAAGYRPVGVDLSELLKGGGSVKCCTLEVFS
315445997YP_004078876.1 AsnC family transcriptional regulator [Mycobacterium gilvum Spyr1]MDRLDDTDERILAELADNARATFAEIGQHVNLSAPAVKRRVDRMLDNGVI
RGFTTVIDRSALGWTTEAYVQVFCHGTIAPAELRAAWKDIPEVVGAATVT
GTADAMLHVLARDMRHLEEALERIRSSADIERSESIVVLSNIIERSPG
315445996YP_004078875.1 NAD(P)H-nitrite reductase [Mycobacterium gilvum Spyr1]MVIVGGGLAAARTAEQLRRAEYPGAITIVSDEDHLPYDRPPLSKEVLRAE
TDDVTLKPAEFYDENNITVLLGNGAKSVDTAAQTLTLADGSTLGYDELVI
ATGLVPKRIPSFPDLPGIHVLRNFDESLALRREAASASRAVVVGAGFIGC
EVAASLRKLGVEVTLVEPQPAPLASILGQQIGDLVTRLHRAEGVDVRCGV
GVSEVSGDDRVRKVTLGDGTDVEADVVIVGIGSHPATSWLEGSGLELDNG
VVCDEAGRASAPHVWAIGDVASWRDTVGGQVRVEHWSNVADQARVLVPTM
LGQEPPAAVSVPYFWSDQYDVKIQALGEPEATDTVHIVEDDGRKFLAYYE
RDGAVVAVVGGGFPGKVMKTRAKIAAGAPISDLLG
315445995YP_004078874.1 hypothetical protein Mspyr1_44850 [Mycobacterium gilvum Spyr1]MKNLTIATTAAAALSAAFLGLAAPALAAPTGGDAQATISSLEAQGNRVIV
HKLADVDLDDASVVGINRGPAIRGTVQDNANDRTYQNTITGHIYYVNVK
315445994YP_004078873.1 hypothetical protein Mspyr1_44840 [Mycobacterium gilvum Spyr1]MFDTMHRGLGEADLLAAIEQAAREEAQAGARRLAAIAELVDLTVDEDDER
GMWAFDPWKNAACHIGAALSISERRASAQMCIATALRYRLPQIAALYVQG
RLSTRLISEITWRTGLVADDVIATVDAALAGKAEKWGPLSEDKLIDAINT
VIARHDPDAVRRTKEALKKRDVHIGAHEDTDDVTTIWGLLLPPDAAAYTA
RIAALVKGLCDADPRSAGERRSDAMGAIGRGENQLACRCGSPNCTASGPS
TSPVVITVIADQAAVDTAQQLIADQDAEQQNTTATTAEPTCTKDPGSALL
PGAQILPIPVLAEAIRSGAKITPLWLPGPDPEPHYRPSAKLAAFIRSRDL
FCRFPGCDVPADRCDIDHVVPYPFGPTHASNMHCKCRSHHLMKTFWGGPD
GWRERQLPDGTVLWTTPAGTTYTTTPGSRLFFPAWDTTTAELPPMTTPPP
GAGREIQMPKRQRSRTADRAARIKAEREHNGTQRNLEERPRRGQPPPDYG
NDPPPF
315445993YP_004078872.1 hypothetical protein Mspyr1_44830 [Mycobacterium gilvum Spyr1]MTDPMDALRGGDLPVDPDPAFARRLRSRLEAAANLFEQQPDRTKDIIMSG
TDTVLAELTEPTSGGLIPYLTVTDARAAIDWYVDVLGASVVGAPITMDDG
RIGHAELTVSGATLYLADEYPEIGLKAPASQHVSASMMLTVTSVDGTLER
ARSARAFVQREPYEDHGARTAAIVDPFGHRWMLTGPITGAPVPIRHGDVG
YVSVRTPDAQRAAAFYGHVLGWVFDPETQRVTNTGQRIGITTAPGRHTLF
CCYAVTDLDGARDSIVAGGGTVDDVVEFDFGSVLGATDPAGAEFGVYRPA
PDEPRPLLNGGGPGELSYITYQVPDSAEFRAFYSRVLFWTYEPGRVDDGW
GVVGAHPMSGAAGGHVEAVTVPMWTVADIDAAVARVREAGGTVIEEPSQQ
PYGKSALCTDDQGARFYLGEF
315445992YP_004078871.1 RNA polymerase- sigma-24 subunit- RpoE [Mycobacterium gilvum Spyr1]MSADSEGAASEGAVPEGLDAPSALLALYDEALPAVYGYFVRRCGDRGTAE
DLTSETFLAAMDAARKPSPPDLSVRWLIGVARHKLADHYRRRRDRFATPV
AELPEPADPADEWDAELDRIVAEQVLTRLSDQHRAVLVLRYMDGCSVPEC
AELIGRTVHATEALLVRARRAFRAMYPEPEGGLS
315445991YP_004078870.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSAARPRVGRRRSTSWEHISDVAIDLFMARGFDDVSVDDVASAAGIARRT
LFRYYPSKSALPWGDFDAHLDHMRALLADLDPEVPIRDALRTALLAFNDF
DDPDRHRQRMRLILETEALQAYSMTMYAGWRAVVAAFVADRLGVGGDDLR
PQTVAWTMLAVSLSAYEHWLADETACLQSSLGEAFDLLASGLSGLESGVS
EFAPGARR
315445990YP_004078869.1 hypothetical protein Mspyr1_44800 [Mycobacterium gilvum Spyr1]MDQNQQVGAEELVTESLVEEVSIDGMCGVY
315445989YP_004078868.1 hypothetical protein Mspyr1_44790 [Mycobacterium gilvum Spyr1]MAAPTITFDADRNWRLHPQVAVRPEPFGALLYHFGTRKLSFLKNRTIVEV
INSLSDHPDARSACRAAGIDDSQLAPYLHALGVLVQSNMLVAGENR
315445988YP_004078867.1 Fe-S oxidoreductase [Mycobacterium gilvum Spyr1]MTLAAPVPRLVDQFERGLDAPICLTWELTYACNLSCVHCLSSSGKRDPRE
LSTQQCKDIIDELERMQVFYVNIGGGEPTVRSDFWELVDYATEHHVGVKF
STNGVRIDKTVAAKLAASDYVDVQISLDGATAEVNDAVRGPGSFAMAVRA
LENLKEAGFKDAKISVVVTRHNIDQLDDFKALADIYGATLRITRLRPSGR
GADVWDDLHPTADQQVQLYNWLVAHGERVLTGDSFFHLSGLGEPGALAGL
NLCGAGRVVCLIDPVGDVYACPFAIHDKFLAGNILTSNGFEDVWQNSELF
RELREPQSAGACSGCNHYDACRGGCMAAKFFTGLPMDGPDPECVQGYGEP
ALAADRDKPKSSVDHSRSGGRGKPKGPIPLTLLSAPPKKFCNESPV
315445987YP_004078866.1 alpha-hydroxyacid dehydrogenase [Mycobacterium gilvum Spyr1]MARDTWFETVAIAQQRAKKRLPKSAYSSLISASEKGVSVSDNVEAFAELG
FAPHVVGATDKRDMATTVMGQDIPLPVIISPTGVQAVHPDGEVAVARAAA
ARGTAMGLSSFASKPMEEVTAVNDKIFFQIYWLGSRDAIAARMERARAAG
AKGLILTTDWSFSHGRDWGSPKIPEQMDLKTILKMSPEVLTKPRWFFSFA
KTLRPPDLRVPNQGRPGEPGPTFFEAYGEWMGTPPPTWEDVAWLREQWGG
PFLLKGLVRVDDAKRAVDAGVSAITVSNHGGNNLDGTPAAIRCLPAIADA
VGDQVEVLLDGGIRRGSDVVKAVALGARAVMIGRAYLWGLAANGQAGVEN
VLDILSGGIDSALRGLGKSSIQELTPEDILVPEGFTRTLGV
315445986YP_004078865.1 protein- amidase [Mycobacterium gilvum Spyr1]MVFPRELGNSTSRQLHDAHAIHMPTLVVPVGSTEQHGPHLPLDTDTRIAT
AVADAVVTRLRARDETHWVMAPAIAYGASGEHEGFPGTISIGTPALAELL
VEFVRSACRWTPRVAFVNGHGGNVDALRRAVTQLRHEGRDAAWSPCVAGN
ADAHAGHTETSVLLHLSPDAVRQEERVPGNRAPLAELMPQMLRGGVAAVS
SLGVLGDPTTATADEGRRIFAEMVDACAARVVRWEPDRGGMLT
315445985YP_004078864.1 glycosyl transferase family protein [Mycobacterium gilvum Spyr1]MTGPRLPDGFAVQVDRRVRVLGEGAALLGGSPTRLLRLAPAAQTMLHGGR
LEVHDAVSAQLARTLLDATVAHPRPLSGPSHRDVTVVIPVHNNATGLTRL
VAALRGLKVVIVDDGSSRPVNEADFASAACDIRVLRHSRRKGPSAARNAG
LAVCATDFVAFLDSDVVPRKGWLEALLGHFCDPAVALVAPRIVAHEPSDN
VVARYEAVRSSLDLGLREAPVIPFGTVSYVPSAAIICRRSAILEIGGFDE
TLVSGEDVDLCWRLNESGARLRYEPIAMVGHDHRTELRKWFARKSFYGGS
AAPLTIRHPGKTAPLVISGWMLVVWMLVAVGSGIGYAASVAVAAVTGRRI
AKSLSTVQTEPMEVAVVAAHGLWSAALQLASALCRHYWPIALVASVLSKR
CRRVVVVAAVLDGVFDWVTRNGNADEDTKRVGILTYILLKRLDDIAYGLG
LWSGVVRERHAGALKPQIRA
315445984YP_004078863.1 choline dehydrogenase-like flavoprotein [Mycobacterium gilvum Spyr1MSVLIVGAGSAGSVLAERLSADPGCEVTVVEAGPGLSDSRVRDQISDGLR
LPIGAASSVVRRYDTALTEEPRRHARIMRGVVVGGSGAVNGGYFCRALPA
DVDGWGMDGWSWDDVLPHFRAIETDLDFATPVHGDTGPITVRRVAEFDGA
TASFVDAARTAGFGWVEDLNGATAEHAVPAGIGAVPLNIDRGTRVGPGGA
FLQPALGRANLTVLTDTRVLRLTFAAGRVTGVLCVGPDGPVTVGADRIVL
CAGAIATAQLLMVSGVGPPPVLRAAGVPVEIDLPVGVDTIDHPEWVLPVS
WAPTHGVPPLEAVLTTDDGVEIRPYTVGFEAMMTGRRDDPTDQPHLGVTL
MRPLSRGRVTICSADPDADPVIEHRYDSAPADVALLREGAQLASELAGAT
VQSEPSWATSQHLCGTAKMGAVVDERCRVYGVENLWVVDGSILPDIPSRG
PHATIVMAGHRAAEFVSSSAGA
315445983YP_004078862.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAAVSSDPRPARSRARLLDAATALLRSGGPSAVTIDAVTRKANVARATLY
RHFPSANDLVAAAFVGLIPPPPMPPSTGSLRERLLAIVVEWAESIAEAPT
TLTAMAWLSLGPDIEQVPSAGGSQVGSLRERIAEQYSAPFDAVFDSPDAA
AELRPVDRTMAFALLIGPLAFGRISTLTEFDYRAVAIAAVDGFLSTFSAT
NTGREGA
315445982YP_004078861.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MSTPTMDRDSQEAAKVLADPKAYADDDRLHSALSYLRANDPVVWVDHPPY
RPFWAITKHADIMAIERANDLFLSAPRPLLVTAEADDLGKSQQEAGIGLR
TLIHMDDPHHRKVRAIGADWFRPKAMRDLKVRVDELAKRYVDRMRDIGPE
CDFVTEIAVNFPLYVILSLLGLPEEDFGRMHMLTQEMFGGDDDEYKRGTT
PEEQLAVLTDFFNYFAALTASRREHPTEDLASAIANGLVDGEPMSDMDTL
SYYVIVASAGHDTTKDAISGGLHALIENPGELARLKGDLSLMPTAVEEMI
RWSTPVKEFMRTAAEDTTVRGVPIAKGESVYLAYVSANRDEEVFADPFRF
DVGRDPNKHLAFGYGVHFCLGAALARMEINSLFTELLPRLDSIELAGEAE
LSATTFVGGLKHLPVRYSLR
315445981YP_004078860.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MSTPVIDDAAKVLAEPRAYAEEPRLHAALAHLRANAPVAYVDVPDYYPFW
AVTKHADIMAIERANELWINEPRPMLNTKATDDLAAANLANGGGLRTLIH
MDDPLHRDIRKVGADWFRPKAMRALKERVDELAKRYVDRMVEIGPECDFV
QEVAVNFPLYVILSLLGLPESDFGRMLKLTQEMFGGDDDELSRGKSAEEL
HEVITDFFRYFTKLTADRRENPTEDLASAIANAKLDGEYLNDIDCLSYYV
IVASAGHDTTSAAISGGLLALIENQDQLARLKADPSLMGTAVEEIIRWTA
PVKEFMRTATADTEVRGVPIKKGEAVLLSYVSANRDEDVFDEPMRFDVGR
DPNKHLSFGYGVHFCLGAALARMEINSFFTELLPRLESIELAGDPEFIST
IFVGGLKHLPIRYSLR
315445980YP_004078859.1 carboxylesterase type B [Mycobacterium gilvum Spyr1]MVVRGIAVLVALVVAVACGSQASPQPAPDPAVVQTSTGPVRGTVADDHRL
FAGIPYAAPPVGALRWQGPRPAPKWDGVRDATAYGPRCMQDLDGDLELGR
QTDEDCLNLNVWTPPVAGDRPEPKPVMVWIHGGSFVAGSSGVYDSRRLVA
RGDIIVVTVNYRLGALGFLAHPALGPPGAVGNYGLADQQAALRWVRDNIA
NFGGDPARVTVAGESAGAMSVCDHLVAPGSDGLFDAAIVMSGLCQSQADL
PTAEKRSLDYAAQAGCGGPVPAECLRGLDANALRTPVWYYDIGDDRLSGP
VTGSAVLPTAPPVAFGDGKAARVPVLMGTTRDEWTLFVALQHLRDGKDYA
PQEYPRLLADTFGADAPAVEAHYPLTAFSSVALAYAATVTDGVFACAGRR
WAGDLAETAPVYFYEFDDRDAPAPDPLRTVPFPVGASHSLELRYLFDTGG
APPPSPAQVRLGEQMIDYWASFVKTGDPGFPGIDSGVMSLQPDGSRMIED
FDRVHQCVFWDGLG
315445979YP_004078858.1 30S ribosomal protein S10P [Mycobacterium gilvum Spyr1]MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
315445978YP_004078857.1 50S ribosomal protein L3P [Mycobacterium gilvum Spyr1]MARKGILGTKLGMTQVFDENNKVVPVTVVKAGPNVVTRIRTTERDGYSAV
QLAYGEISPRKVNKPVTGQFAAAGVNPRRHLAELRLADNEDAGALYEVGQ
ELTAEIFADGAYVDVTGTSKGKGFAGTMKRHGFKGQGASHGAQAVHRRPG
SIGGCATPGRVFKGTRMSGRMGSDRVTTQNLKVHKVDAENGVLLIKGAIP
GRNGGLVVVRSAIKRGEK
315445977YP_004078856.1 50S ribosomal protein L4P [Mycobacterium gilvum Spyr1]MANKTIDVVTPAGKKDGTVELPAALFDAEPNIALMHQVVTAQLAAKRQGT
HATKTRAMVSGGGKKPYRQKGTGRARQGSTRAPQFTGGGVVHGPQPRDYS
QRTPKKMIAAALRSALSDRARNDRIHAITEVVEGQSPSTKSAKAFLATLT
DRKQVLVVIGRADETSALSVRNLPGVHVISPDQLNTYDVLKADDVVFSVE
ALNAYIAAATKTTEEVSA
315445976YP_004078855.1 50S ribosomal protein L23 [Mycobacterium gilvum Spyr1]MANVVDPRDIILSPVISEKSYGLIEDNVYTFIVHPDSNKTQIKIAIEKIF
KVKVDSVNTANRPGKRKRTRTGYGQRKATKRAIVTLAAGSKPIDLFGAPA
315445975YP_004078854.1 50S ribosomal protein L2 [Mycobacterium gilvum Spyr1]MAIRKYKPTTPGRRGSSVSDFAEITRDHPEKSLIRPLHGKGGRNAHGRIT
TRHKGGGHKRAYRVIDFRRHDKDGVDAKVAHIEYDPNRTANIALLHYLDG
EKRYIIAPQGLKQGAIVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKMARSAGASIQLLGKEGTYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKASDKLIVRRRRTGKNKR
315445974YP_004078853.1 30S ribosomal protein S19 [Mycobacterium gilvum Spyr1]MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
315445973YP_004078852.1 50S ribosomal protein L22 [Mycobacterium gilvum Spyr1]MTTAIQYPSASAKARFVRVSPTKARRVIDLVRGKSVEDALDILRWAPQAA
SEPVAKVIASAAANAQNNEGLDPSTLVVATVFADEGPTAKRIRPRAQGRA
FRIRKRTSHITVIVESRPAKKQGASASAARARRAQASKAASQKEGSE
315445972YP_004078851.1 30S ribosomal protein S3 [Mycobacterium gilvum Spyr1]MGQKINPHGFRLGITTDWKSRWYADKQYADYIKEDVAIRKLLATGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTKKQVQL
NILEVKNPESRAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKV
WIYKGDIVGGKRELAAAAPAGADRPRRERPSGTRPRRSGASGTTATSTDA
GRAATEEAPATDAAATAPAAGQPETTES
315445971YP_004078850.1 50S ribosomal protein L16 [Mycobacterium gilvum Spyr1]MLIPRKVKHRKQHHPRQRGIASGGTSVSFGDYGIQAMGHAYITNRQIESA
RIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPG
RVLFELSYPDEKIAREALTRAIHKLPIKARIVTREEQF
315445970YP_004078849.1 50S ribosomal protein L29 [Mycobacterium gilvum Spyr1]MAVGTTTGELRELSDDELTDKLRESKEELFNLRFQMATGQLANNRRLRVV
RQEIARVYTVLRERELGLAAGPGGEDS
315445969YP_004078848.1 30S ribosomal protein S17 [Mycobacterium gilvum Spyr1]MADTKGEKHTPRTEDKRGRRKTAIGYVVSDKMQKTIVVELESRKSHPLYG
KIIRTTTKVKAHDENESAGIGDRVSLMETRPTSATKRWRLVEVLEKAK
315445968YP_004078847.1 arylsulfatase A family protein [Mycobacterium gilvum Spyr1]MTTEFNGKIALDIRDSEPDWGPFAAPTAQPEAPNVLYLVWDDIGIATWDC
FGGLVDMPAMSRIAERGVRLSQFHTTALCSPTRASLLTGRNATTVGMATI
EEFTDGFPNCNGRIPFDTALLSEVLSENGYNTYCIGKWHLTPLEESNLAA
TKRHWPLSRGFERFYGFMGGETDQWYPDLMYDNHPVAPPATPEEGYHLSK
DLADKTIEFIRDSKVIAPDKPWFSYVCPGAGHAPHHVFKEWADRYAGRFD
MGYEAYREIVLENQKRLGLVPPDTELSAVNPYLDVKGPDGQDWPAQDTVR
PWDSLSEDEKRLFARMAEVFAGFLSYTDAQIGRVLDYLEESGQLDNTVIV
VISDNGASGEGGPNGSVNEVKFFNGYIDSAEESLKVFDELGGPQTYNHYP
IGWAMAFNTPYKLFKRYASHEGGIADTAIISWPKGIAAHGEIRDNYVNVA
DITPTVYDLLDITPPATVRGVAQKPLDGVSFKVALENPNAPTGKETQFYT
MLGTRGIWHRGWFANTVHAASPAGWSHFDDDRWELYHVDADRSQVHDLAA
EYPEKLDELKALWFSEAQKYNGLPLGDLDIFETMSRWRPTLSGERSAYVY
YPGTADVGIGAVVELRGRSFAVLAEVEVDPGGANGVVVKHGGAHGGYVMY
LQGGRLHFCYNFLGEYEQTLAAPDPVPPGLHTLGFTYTVTGTAEGSHTPI
GDAELFLDTERVASLAEMRSQPGTFGLAGASLSVGRNNGSPVSEAYHPPF
AFAGGRIARVNIDTSGAPYVDLERDFARAFARD
315445967YP_004078846.1 hypothetical protein Mspyr1_44560 [Mycobacterium gilvum Spyr1]MLTDLVDLEGGSFRMGSTRFYPEEAPAHTVTVAPFAIERHPVTNAQFAEF
VDDTGYRTVAERPPDPALYPGASPHDLVPGALVFRPTAGPVDLRDWRQWW
EWTPGADWRHPFGPDSSVDDRPEHPVVQVCYSDAAAYARWAGRRLPTEAE
WEFAAGAGSTAVYAWGDEPAPGGQLMANTWQGAFPYRNDGALGWAGTSPV
GTFPANGFGLVDMIGNVWEWTTTRFAGHHRVNPPPPPTCCPPADPDPAVN
QALKGGSHLCAPEYCHRYRPSARSPQSQDSATTHIGFRCAASPV
315445966YP_004078845.1 50S ribosomal protein L14 [Mycobacterium gilvum Spyr1]MIQQESRLKVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVIVRTVKERRRADGSYIRFDENAAVIIKNDNDPRGTRIFG
PVGRELREKKFMKIVSLAPEVL
315445965YP_004078844.1 50S ribosomal protein L24 [Mycobacterium gilvum Spyr1]MKVRKGDTVLVISGKDKGAKGKVLVAYPDRNKVLVEGVNRIKKHTAESRT
ERGAASGGIVTQEAPISVSNVMLLDSDGKPTRVGYRKDDETGKNVRIAKS
NGKDL
315445964YP_004078843.1 50S ribosomal protein L5 [Mycobacterium gilvum Spyr1]MTSTETKTLPRLKQRYREEIREQLLKEFGYANVMQIPGVVKVVVNMGVGD
AARDAKLINGAVNDLMLITGQKPEIRKARKSIAQFKLREGMPIGARVTLR
GDRMWEFLDRLISISLPRIRDFRGLSGKQFDGTGNYTFGLTEQSVFHEID
VDSIDRPRGMDITVVTSATNDDEGRALLRALGFPFKEN
315445963YP_004078842.1 30S ribosomal protein S14 [Mycobacterium gilvum Spyr1]MAKKALVNKANKKPKFKVRGYTRCNRCGRPHAVFRKFGLCRICLREMAHA
GELPGVQKSSW
315445962YP_004078841.1 30S ribosomal protein S8 [Mycobacterium gilvum Spyr1]MTMTDPIADFLTRLRNANSAYHDEVTLPHSKIKANIAEILKSEGYISDYR
TEDARVGKSLVVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGG
LGVAIISTSSGLRTDRQASREGVGGEVLAYVW
315445961YP_004078840.1 50S ribosomal protein L6 [Mycobacterium gilvum Spyr1]MSRIGKQPVPVPAGVDVTISGQNVSVKGPKGTLTLDVAEPIEVSRNDDGA
IVVTRPNDERRNRSLHGLSRTLIANLVTGVTEGYTTKMEIFGVGYRVVAK
GSNLEFALGYSHPVLINAPEGVTFAVETPTKFSISGIDKQAVGQIAANIR
RLRKSDPYKGKGIRYEGEQIRRKVGKTGK
315445960YP_004078839.1 50S ribosomal protein L18 [Mycobacterium gilvum Spyr1]MATKTNTKETGHSPVGKNISETRRTSRLRRHARLRKKVSGTAERPRLVVN
RSSRHIHVQLVDDLAGVTLAAASSIEGDVRATDGDKKAASARVGQLIAER
AKAAGIEEVVFDRGGYTYGGRIAALADAARESGLKF
315445959YP_004078838.1 30S ribosomal protein S5 [Mycobacterium gilvum Spyr1]MAEQAGAGSAQDNRGGNRDDRGGRGRRDDRGGRGGRDDREKSNYLERVVT
INRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIAKGVEEA
RKNFFRVPLIGGTVTHPVQGEAAAGVVMLRPASPGTGVIAGGACRAVLEC
AGVHDVLAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPA
GMLRARREAEALAVSAAREGTA
315445958YP_004078837.1 50S ribosomal protein L30 [Mycobacterium gilvum Spyr1]MAELKITQVRSTIGARWKQRESLRTLGLRKIRQSVVREDNAQTRGLIKTV
HHLVEVEEVKA
315445957YP_004078836.1 50S ribosomal protein L15 [Mycobacterium gilvum Spyr1]MSDPIKLHDLRPAPGEKTKKTRVGRGEGSKGKTAGRGTKGTKARKNVPVM
FEGGQMPIHMRLPKLKGFRNRFRTEYGVVNVGDLNKAFPEGGTVGVDELV
AKGLVRKNVLVKVLGDGKLSAKVDITAHKFSGSAREAITAAGGSVTEL
315445956YP_004078835.1 hypothetical protein Mspyr1_44450 [Mycobacterium gilvum Spyr1]MIRHRRTIVAMVAAGLTMFGGAATAQAETPDERFANVVTTLGIPHTPDED
LSVVGKRVCDMLTGSLTGNPNPVPAVRGVVSTLSSNANITKQQAVGLMQA
STYIYCPQWARFTGR
315445955YP_004078834.1 signal peptide peptidase SppA- 67K type [Mycobacterium gilvum Spyr1MLALLSGVPGFDDVRHFARKLDTARHQGVPDGCILELDLQSAPPESAGFD
PVALLSGAGRPLLLREAVSALHRAAEDPRVAGLIARVQIDAAAPGAVQEL
REAIVAFTAKKPSLAWAETYPGTLSYYLASAFGEVWMQPSGTLGLVGFAT
NALFLRDALDKLGVEAQFIAKGEYKSAPNLFTEDRYTEPHREADTALVNG
LRTQVWDAVAASRGIDVATLDALADRAPLLRDDAVTAGLIDRVGFRDEAY
ARIADMAGADGVSPETGSGGIDPDGDDAPPRLYLTRYARAKRPTVPGLPN
RRRIAVVTLHGPIVSGRGGRQMSPRGGSNAGGDTIAAALREAAADDDVAA
IVVRVDSPGGSVTASETIWREVVRARESGTPVVASMGSVAASGGYYVSMA
ADAIVANPATITGSIGVVTGKLVARDLKERLGVGSDSVRTNANADAWSIN
APFTEEQHAQVAAEADLFYDDFVARVAEGRGLSIDAVEQVARGRVWTGAD
ALDRGLVDELGGLRTAVTRAKALAGIDEDTKVELQMLPGASLRDVLRPKP
SSQPAAASLPELLGALAIQSVAGVVDQTQRSLSGVNALWTGNPRF
315445954YP_004078833.1 methyltransferase [Mycobacterium gilvum Spyr1]MARTPDDSWDLASSVGATATMVAAGRAVASADPDPLINDPYAEPLVRAVG
LDFFTRMLDGELDLSVFPDSSPERAQAMIDGMAVRTRFFDDCCLAAASAG
VRQVVILAAGLDARTYRLPWPDGTVVYELDQPDVIAFKTQTLRNLGAEPA
ATQRPVPVDLREDWPAALRAAGFDATRPTAWLAEGLLIYLPPEAQDALFD
TVTALSAPGSTLATEYVPGIVDFDGAKARALSEPLREHGLDIDMPSLVYT
GARTPVMDHLRGAGWQVSGTARAELFARFGRPLPQDADGTDPLGEIVYVS
ATLAADA
315445953YP_004078832.1 methyltransferase [Mycobacterium gilvum Spyr1]MARTDGDTWDLASSVGATATSVAASRAFASRGPDALIDDPYARLLVEAVG
LPHFVKVARGEIDFDGDPLFGAQQAINQIVVRTRIFDDFLTDAGQREPQI
RQAVILASGLDTRAYRLDWPAGTVVYEIDQPEVIDFKTAVLTDAGVAPAA
DRRTVGIDLREDWPTALRDAGFDPDRPTAWIAEGLLPYLPPDAQDRLLDS
ITALSAPGSRLATEHMDAKALTGDWAKAMTERARRHGSDIDLTKLFYNGE
RRSATEHLGAVGWQTSVQTSNDAYIANGFGPIRDDLLAMIGDSGYLTAWR
P
315445952YP_004078831.1 methyltransferase [Mycobacterium gilvum Spyr1]MPRTENDTWDLASSVGATATMVAAARAVATRAEDPVIDDPYAEPLVRAVG
IDFFAKLASGELTPEDLDVSGDESPVGMSRFADGMAARTRFFDDFFTDAC
AAGVRQAVILASGLDARGYRLTWPEGMTLFEIDQPEVIEFKRTTLAGLGA
TPSTHLATVAIDLREDWPTALRDAGFDPSVPTAWIAEGLLGYLPPDAQDR
LLDTIGELSASGSRLAVESVPSQQSADQDEMREKMKDSTDRWRSHGFDLD
FSELVFLGERANVPDYLRERGWAVTATPTNDLLTRYGLAPLDTDEGFAEV
VYVNAAR
315445951YP_004078830.1 protein translocase subunit secY/sec61 alpha [Mycobacterium gilvum MLSAFISSLRTVDLRRKILFTLGIVILYRVGASIPSPGVNYPNVQQCIAD
VSGGESGQIYSLINLFSGGALLQLSVFAVGIMPYITASIIVQLLGVVIPR
FEQLRKEGQAGQTKLTQYTRYLAIALAILQATSIVALAANGGLLQGCSLD
IIQGQSEGLNVWTLAVIVIVMTAGAALVMWMGELVTERGVGNGMSLIIFA
SIASAIPGEGKNILDSRGGMVFTLVCVAALIIVVGVVFVEQGQRRIPVQY
AKRMVGRKMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPHLITQLITSAS
DSPSTGWWQSFVADYLTDPSSPVYIAIYFGLIIFFTYFYVSITFNPEERA
DEMKKYGGFIPGIRPGKPTAQYLSFVLSRITLPGSIYLGVIAVLPNLFLE
IGNTGSVQNLPFGGTAVLIAVGVGLDTVKQIESQLMQRNYEGFLK
315445950YP_004078829.1 adenylate kinase [Mycobacterium gilvum Spyr1]MRIVLLGPPGAGKGTQAQKLAEKLAIPHISTGDLFRYNISNNTELGIEAK
KYLDAGDLVPATLTNALVDDRLDDEDAAQGFILDGFPRSVEQAKALAEML
EKRGLTLDAVVEFRVPEEELVSRLKGRGREDDTEDVIRNRFKVYRDETAP
LLDFYSADLKTVDAVGELDEVFDRALTALGR
315445949YP_004078828.1 methionine aminopeptidase [Mycobacterium gilvum Spyr1]MVSLPGLRSRKVVPQRTAGELDAMAAAGALVAAALKAVQAEAAPGKSTLD
LDRVAEAVIRDGGGVPSFLGYHGFPATICASVNDRVVHGIPTADETLAAG
DLVSIDCGAILDGWHGDSALTFGVGDLIPADEALSAATRESMEAGIAAMV
PGNRLTDVSHAIEQGTRAAEARHGRKFGIVAGYGGHGIGREMHMDPFLAN
EGAPGRGPYLAPGSVLAIEPMLTLGTRKTLILDDGWTVVTADGTRAAHWE
HTVAVTDDGPRILTAR
315445948YP_004078827.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium gilvum SMEDADAAMMRVLYDEHAAALWRYALRLTGDRARSEDVVQETLLRSWRHPG
VIADLDRPARAWLFTVARNMIIDERRSARFRHETGVPDPEHVAEPASPDE
ADPTLDRILLGTALRQLSDEHRAVVRRAYYQGWTTGQIAADLQIPEGTVK
SRLHYAVRALKLGLQEMGVTR
315445947YP_004078826.1 hypothetical protein Mspyr1_44360 [Mycobacterium gilvum Spyr1]MTSADHYRTWDAAYVLGALSTDDRREYEGHLSGCGGCRSAVAELDGMPGL
LSLLALDEVIALDHEQPAPPLRPEVLTSVIDRMGARRRRARRATVWAVAV
AAALLALAIVLAVRPAIFGSDGGGEQTAPMQNMAKVSETPINASIALTGY
GWGTRIDMACSYGDWGQNPRGTPPQNLGMVVIGHDGSRSQIATWLGLSGA
TALPSGTTPMQVNEIRAVQLVSASDGEVLLEKQW
315445946YP_004078825.1 MarR family transcriptional regulator [Mycobacterium gilvum Spyr1]MIHTAGAPVRYERCVASDRPDPIATARDNWERSGWHDVADGMVAVTSVMR
AHQILLARVETALRPYDLSFSRYELLRLLAFSRTGALPITKASDRLQVHV
TSVTHAIRRLEADGLVERLPHPTDGRTTLVRITDLGRSTVEDATVTLNKD
VFGDIGISGEQSRALADAIETLRRSAGDF
315445945YP_004078824.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MIDRDDAGAWLVGAHADVVHVLDHPATFSNVVSRHVAVPNGMDPPEHTAF
RAVVDRYFTPSRLADVEPALRQISADLVAALPRGRTVEVMEWFAEPFAAR
AQCAFMGWPASLHEPLRQWVKRNHAATRARDRAAMADVASAFDGHIRAQL
DARRDGTGGTPQDATSRLLGDTVGDRPLTDDEIVSIVRNWTVGELATIAA
GIGIIAHFLATHPAVQEQLRRDATDLESAADEILRLHAPLLTNRRRTTES
VTLGGCTMAAGDPVLILWAQANRDEHAFDEATEFRRNREPSNNLLYGRGL
HVCPGAPLARMEFRVVLEELFRGTAHIAPDPDRAAEPASAPTAGFATLPL
MFSSRT
315445944YP_004078823.1 histidine kinase with GAF domain [Mycobacterium gilvum Spyr1]MTRPLLTADRELALLRELIQAASSGPGVEPLAAASARMITASTDSDVCFV
HVLDDTERSLTLAGATPPFDSEVGKIRLPLGQGISGWVASHRQPVVIRRD
KESDPRYLPFQSLRGRDFTSMVSVPMETDPGGLVGVLNVHTVAERDFTDR
DVELLLVIGRLIAGAMHQARLHRQLVARERAHENFVEQVIEAQELERRRL
AGDIHDGISQRLVTLSYRLDAAAQAAKSPADHAALTEQLDRARELADLTL
QEARAAISGLRPPVLDDLGLAGGLASLARSIPQIGIETDLDDTRLADHIE
LALYRIAQECLQNVVKHARASAARLTFAVDDNTARLEIADDGVGFDTFEH
PLGSDEMGGYGLLSMAERAEIVGGRLNIRSRPGSGTTVTATIPLHQGGA
315445943YP_004078822.1 LuxR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSSEPVRIVLVDDHEMVIEGLKAMLAAFADRVCVVGQSVGADQVMGVVTD
LDPDIVLCDVRMQGSSGLDVCQQLRRRDPDRKIVMLSVYDDEQYLFQAMR
VGASGYLLKSISSEDLVEQLESVHSGKTAIDPTMAARAVEWPGARQGLTQ
RESEILALVVNGLSNRAIAAKLIIGDETVKTHLSSIYRKLGVSDRTAAVA
TALREGIFQ
315445942YP_004078821.1 phosphatase/phosphohexomutase [Mycobacterium gilvum Spyr1]MRSVQSTQQKAWRAGRFWWDWSETGEPDGRSLTTLSAVIFDLDALADVER
TGHRLAFNAAFAELGLDISWSETRYRQLQELPDERRRVAAELRKRGVSTE
CDVLAELLVDEICATKEMILGETILDADITARPGMAELIAEAYGAGIAVG
LVSCGSHTWVEPLVRQLVGEGMVGAIVTVDDAPREDLFRAALAELGAPAH
GSLAFAGSQGSRRAAVAAGLPTVLVDGAETAPLRIADCQRIHDSWYETHP
RPTAA
315445941YP_004078820.1 3-hydroxyisobutyrate dehydrogenase [Mycobacterium gilvum Spyr1]MTTIAFLGLGNMGGPMAANLVAAGHTVHAFDVVPELRDAAEAKGANVFDS
AAAAVADADVVVTSLPNGAVVKAVYDEVVPAAKAGALLIDTSTISVDDAR
AIHEQATAGGLAQIDAPVSGGIKGATAGTLAFMVGGDDEAFERAKPVLEP
MAGKIIHCGASGAGQAAKLCNNMVLAVQQIAIGEAFVLAEKLGLPAQSLF
DVITGATGNCWSVHTNCPVPGPVPTSPANNDFKPGFATALMNKDLGLAMA
AVESSGAKAPLGTHAAEIYSDFAKEHAGKDFSAIIEALRD
315445940YP_004078819.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MDYFGLDDDDRVIAETAAAFAEKRLAPHALEWDETHHFPVDVLREAAELG
MAAIYCGEDAGGSGLRRIDAVRIFEKLSTADPTVAAFLSIHNMCAWMVDS
FGTEEQRKLWVPKLASMDAIASYCLTEPGAGSDASALRTKAVRSGDEYVL
DGVKQFISGAGTSDVYIVMARTGSDGPKGISAFVVPKETPGLSFGTDEVK
MGWNAQPTRQVILEGARVPADALLGGPDGEGTGFGIAMKGLNGGRINIAA
CSLGGAQAAYDKTVSYLADRQAFGGSLLDEPTIRFTLADMATALETSRAL
LWRAATALDNDHPDRVELCAMAKRYVTDACFEVADQALQLHGGYGYLREY
GLEKIVRDLRVHRILEGTNEIMRVVIGRSAASRARAS
315445939YP_004078818.1 methylmalonate-semialdehyde dehydrogenase [Mycobacterium gilvum SpyMTTRIPHFIDGKRSELASTRTAGVLNPSTGEVQSEVLLASAADVDTAVAS
AVEAQKEWAAWNPQRRARVFMKFIQLVNDHVDELAELLSIEHGKTVADSK
GDIQRGIEVIEFAIGIPHLLKGEFTENAGTGIDVYSIRQPLGVVAGITPF
NFPAMIPLWKAGPALACGNAFILKPSERDPSVPLRLAELFLEAGLPAGVF
QVVQGDKEAVDAILTHPDIQAVGFVGSSDIAQYIYSTAAAHGKRSQCFGG
AKNHMIIMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGEETANRLR
NRLVERVNQLRVGHSLDPKADYGPLVTGAALERVRDYIGQGVEAGAELVV
DGRERATDELSFDDQDLSKGYFIGPTLFDHVTTDMSIYTDEIFGPVLCIV
RAADYDEALSLPTKHEYGNGVAIFTRDGDAARDFVSKVQVGMVGVNVPIP
VPVAYHTFGGWKRSGFGDLNQHGPASIQFYTKVKTVTERWPSGIKDGAEF
VIPTMK
315445938YP_004078817.1 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [MycobMPGAHRSDVVVVGAGPTGLTLACCLRLHGVSVRVLDAAAGPATTSRANFL
HARGSEVLDRMGALGTLPQESLRALRITNYLGDRPLATLEFGDPGMRTAA
PPMVVSQAKVEAALRARLADLDVEPEWGRKVIDVREDADGVVADLADGAR
VRGQWLVGCDGTTSVVRRQTGIEFPGVRLSERFLLADIHLDWAVDRAGTT
GWIHPDGVVGAMPMPSTDGRDDLWRLFVYDPSLDRKPTDSEILDRISELV
PYRTGRRVEIGDAEWLSMFTVHRRLADTYRRGRVLIAGDAAHVHAPFGGQ
GMLTGIGDAENVGFKLALVVRGLAADDLLDTYEAERRPLATQVLRGTSAI
TRVNVAGNPIVRFLRDRVAPRVFGLPAVQRWTTDTASQLWVSYRNGPLGG
RGSKPRPGDRIDDAPCSRPDGTATRLHGELGGRWALLLPRGVPAVGAAAV
RGPAGYLADYLVTLHHGRDDVMLVRPDAHLAWRGAHDDVAGLDRWLATAL
HPGGTQ
315445937YP_004078816.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MTAPVRGRPRDPDADRAILQAALDLFIERGVEGSSIEQIAKRAGVGKPTV
YRRWGTKEELIAAAMETLVAEEVGWASPEAIETRSPHVLVEAAIDSAAAA
TAAPHYRALVARVYGSAVSHPELMTVYWDRYILPRRVQATRLLERARELG
TVAADTDLDVTIDMMVGAITYRVLQPNPPDVDEMRRYLREVYRQTGLLPA
G
315445936YP_004078815.1 dTDP-glucose 4-6-dehydratase [Mycobacterium gilvum Spyr1]MRLLVTGGAGFIGANFVLATVRDRPDVRVTVLDSLTYAGSRESLAGVDTQ
IRLVQGDITDADLVGRLVGESDAVVHFAAETHVDNALADPEPFVRSNIVG
TFTILEAVRHATASRPVRLHHVSTDEVYGDLELGDPAKFTESTPYNPSSP
YSSTKAASDMLVRAWVRSYRLTATLSNCSNNYGPFQHVEKFIPRQITNIL
TGRRPKLYGTGANVRDWIHVEDHNSAVWKILTHGAVGRTYLIGADGECDN
LTVMRTILRLMDRSPDDFDHVTDRAGHDLRYAIDATPLRDELGWRPAHRD
FEAGLRDTIDWYRHNRSWWGPIKDAVEAAYQSRGQ
315445935YP_004078814.1 hypothetical protein Mspyr1_44240 [Mycobacterium gilvum Spyr1]MTNSEGPSLKPALGRFGVWTGEPVSPDQAVEIEKLGYGTVWVGASPAADL
AFVEPILEKTESLQVATGIVNIWTADAGEVAESYHRIEKAFPGRFLLGVG
VGHPEHTQEYTKPYQALVDYLDRLDAAKVPTSRMVVAALGPKVLKLSAQR
SAGAHPYLTTPVHTGQARELLGPTVLIAPEHKVVLTDDAEKAREIGRGTV
DFYLGLSNYVNNWKRLGFTEEDLERPGSDRFIDAVVAYGSPDEIAARLSE
HLAAGADHVAIQVLGGGDELLSTLEELTGPLELTARD
315445934YP_004078813.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMSDVTPDLGRFGSFGRGVTPEQAQQIEALGYGAVWVGGSPPAELDWVEPL
LAATTTLQVATGIVNIWTADAGPVAESFHRIESAHPGRFLLGIGVGHPEA
HQQYRRPIDALVEYLDKLDEYGVPRGRRVVAALGPKVLKLSADRAAGAHP
YLTTPEHTARARELIGPEAFLAPEHKVVLTTDERSREEHVTDPDRAREVG
RKALEIYLDLANYLNSWKRLGFGDEDVAKPGSDRLVDAVVAYGTAEQIAA
RLREHLDAGADHVPVQVLTGSDKLVPALAELAGPLGLESTEEQR
315445933YP_004078812.1 histidine kinase [Mycobacterium gilvum Spyr1]MGEKCLPDELRSLFLFEKLTDDQLQDLCAHGHIATFEPGPICTEGDPATC
FYVMIDGELVMSKRSGGVDLETNRTSQRGVYCGAWSAYVPGEDKTYQASV
RVTRPSRFFVLDAAAFATFMQREFPMAVHLLEGHMVGGMRQRQIIDTREK
LLALGQLSAGLTHQLNNPAGATAGAVADLREGVGKMRHKLAMLADGKFTP
EALRVLVSIQDEVAEQVAKSKAQELTAIETSDREDQIGDWLEAHGISAAW
DYAPTFVDAGLDVDWLERVEASIDDVDCSATLPGAIGWLKYTIDNELLMN
QIAEASKRISALLAGAKQYSQMDRAEYQQVNVHELLFSTVKTIFGDKLGK
DKINLVWDKDKTLPELLCYPGDLNQVWTNIIDNAIQAMDGQGTLTIRTMR
ENEDLIRVEICDDGPGIPDDIIDRIFTPFFTTKPFGEGTGLGLDLAWRIV
VEKHKGNLTVQSQPGDTRFVICLPLAAPAPTGPSNE
315445932YP_004078811.1 thioredoxin reductase [Mycobacterium gilvum Spyr1]MTGPEHQPRKPVILTVDDDPAVSRAVARDLRRHYGEKYRIMRAESGPDAL
ETLNELKLRGETVAVFVADYRMPQMSGIEFLEAAMDIFPLARRVLLTAYA
DTHAAIDAINVVDLDHYLLKPWDPPQEKLYPVIDALLDAWRSTGDRAIPH
TKIIGHPWNARSSEVREFLARNRLYYTWFRSDEPKGAALLEAAGQDGMTL
PVIITEQGETLVDPTDAELGSTLGLTTTPSGDFYDLVVIGGGPAGLAAAV
YGASEGLRTVLIERTATGGQAGQSSRIENYLGFPDGLSGAQLAERARRQA
EKFEAELITAAEVTRLEVDGNARTVHLSDGRTIGTRAVILAMGVEYRQLP
ADGCADLTGAGVYYGATASVAADCDDDEVYVIGGANSAGQAAMHLARTAK
TVTIVSRRTLEDSMSHYLIQQIRAQDNIRELPHTVVHAVKGDGHLEGICL
ENTQTGQRDEVTCGRMFIFIGAEPRTEWLDGVVVRDDHGFIPAGPDLRDV
SGWTLDRPPHHLESSVPGVFVAGDVRADSAKRVAAAVGEGSMAVMLVHRY
LSET
315445931YP_004078810.1 universal stress family protein [Mycobacterium gilvum Spyr1]MPANVMVGYDGSPAACAAINAGAALFPNAHAWIAHIWQPPFAGKRLRRRL
RAAARTADELAELIEREGAREADTIASAGVALAKAAEWDAEPVVKRTYGS
DGMRLSQLAEQMHSDVLVLGDRGLDATDAVIGSVSDMAVHYSTVPVLVVP
NPLLAEEFAALARGPIVVAFDGSPGADAAAEKARTLFPDREVVLAGVRDE
DDDPAARQWPDDVEVLSTSEPNWLGRPRDRATADALIDFADRRDAAVLVV
GSRGRSAVREVLLGSVAVAAVNRSHRPVMVVHS
315445930YP_004078809.1 hypothetical protein Mspyr1_44190 [Mycobacterium gilvum Spyr1]MTKRMIRAAVAAAALYGARRYFRDWGTTKGESSSVLAGDELLGPPVLQAT
EGVSIDAPVDAVWPWVVQIGQDRGGLYSFETLENAAGLDYHNADLIHPEW
QHLAVGDSVRLVPRKWFGLADGVEMTVARMTAPQSIVLRAAPPGLPWEMV
WSFHLIPRGDDQCRLLIRSRLALRHPGEVVAAELVGPARAFVTRGILLGI
KRRAEKAVKMPPVQGFTPAHTAEDLRP
315445929YP_004078808.1 hypothetical protein Mspyr1_44180 [Mycobacterium gilvum Spyr1]MSNGAEAPPTVDVDVTTHGDFPGIAEYAQSKIGGLTRLARRPVSYARVRL
TRRHDPAVERPVIAQANLDVGGRPVRAQVEAATAQEAVDTLESRLRRRLE
HLHDRWDTPRGPGAAPPWRHDDKAEREIRSFGGTPREPRIIRRKSYSMAP
CTVDDAVAEMELLDYDFHLFAEKGSGTAAVVYRSEPTGYRIALVAPSLAG
EVAPFQGLVTISPHAVPCLREQDALERLRLLGLPFLFYVDAAQGRASVLY
RRFDGDFGVLTPAPITSER
315445928YP_004078807.1 universal stress protein UspA-like protein [Mycobacterium gilvum SpMTLPTNRPYGVVAAVDGSPSSLAAAQWAAREASLRDVPVTLVHVKPTDEI
GPWLDMPVVPEYTAAIDRRCAEIVAEAVKVVSAALQDRRQVPVKEVTLSG
RVKPMLVEASGEADLLVVGCRGLSGLGRLLLGSTTAAMLHHARCPVAVIH
DEEVEEAASSDPVVVGVDASPASEPAVALAFDEASRRGVGLVAVHTWMNS
ADFYVDVSVIDVAAQAEEELAQRLAGWGEQYPDVEVRRVVAQDNPTHRLI
DESRRAQLLVVGSHGRGGFTGMLLGSVSSAVAQAARLPVIVVRGAG
315445927YP_004078806.1 hypothetical protein Mspyr1_44160 [Mycobacterium gilvum Spyr1]MQTFTLGFGVWLRRLASRSPLVRSTDRVEAAVMTLIVVAGVCAVPIAGAV
GTAEYDRLTNSLAAERLTHREVDATVVRDSRTVSEPYETTYLTEIGWNVG
SVARTAEITTTRKSAGDRLTIWVDDSGDLVRKGLTDGDAATQAVVGALGV
WFAVTGLGVATWMLLRLRLDHLRSQNWDRELDDLADNGGRSNNTT
315445926YP_004078805.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMQAMVYTGPGQRSWQTVPDPVLVDATDAIVRVDTVTICGTDLHILKGDVP
EVESGRILGHEAVGTVTAIGSAVQTLSVGDRVLVSCISSCGACRYCRQGH
YGQCLGGGGWILGHLIDGTQAEYVRVPFADNSTHKVPAGVSDEQMIVLAD
ILPTSYEVGVLAGRVGPGDVVAIVGAGPIGLAAVLTAKLYSPSHIVVIDV
ADTRLEAAKKLGADVTVNSRSRRPRDVIDELTGGLGADVVMEAVGLPETF
EESVDLVRPCGHVANIGVHGAPATLHLERIWIKNLTITTGLVDTHSTPTL
ISLVANGRLDAATMITHRYPMDEFDTAYQVFGDAANSGALKVVLTATS
315445925YP_004078804.1 universal stress family protein [Mycobacterium gilvum Spyr1]MSALPLRHKPVVVGVDGSRAAVNAVRWAAAEALAREVCLRLVHAVASPAP
DDAVLDRAKIAALASHDSLEVEVVSTVGEPGPVLVRESRDASMICVGSRP
VASADAPTIGPTARALAAGADCPVAVIRTGRDGLPQTAGAIAVVLSDDDD
TDATVHLAMHEGRLRHATVRQIDRRTDSWVRRYPDVHVELVAAGAGRQYA
RNDLAPNGIGLAVVGRRDAVELAEVGRNNSHPILGYPDCSLLLVRS
315445924YP_004078803.1 universal stress family protein [Mycobacterium gilvum Spyr1]MVRSSAVLVGVDGSATGAAAAAWAVKEAASRDLPLRLVHAVTATGDGRVD
AQDLARAGRIVHNAVTAVEALGAPVRIESQIICGATAPALSAASHDAAML
CLGFTDGASGRHRARRSTAAEIASSARCPVAIIHPAGNHSPGARWVVAES
GASPSDDATSTRAVDEALLRGAPLRIVAAWPSRYPDMYDDHAVARKNRLV
KARWERWLAPRRRQHPELDAHVTAAPGSILNYLARHRKGIRLAVLSHERA
DDVAELLAPCVDCEFDILICDAPPGRRHDRTSSSEQSG
315445923YP_004078802.1 nitroreductase family protein [Mycobacterium gilvum Spyr1]MHDTAVDIEVITDAVALASRAPSLHNSQPWRWVADATAVMLFLDDAAAPR
HTDPTGRELVISCGAVLDHFRVAMAAAGWRSHTERFPNPNNLDHLATVGF
SRLDFVTDAHRRRADAVSRRHTDRLPFAEPAHWDGFLRGLTPFSASQGVS
LHVLPDASRAALVEASELTRTIRRYDSDYHAELIGWTADVAVAEGIPSAA
LLSPIESAHVGIARDFPAAGHGDRRGEIAEDHARVVVLSTGDDSRAVFLA
CGEMLSSFLLDATLAGLSTCTLSHLIEVPESRKTLAALTGSPDSPQLLVR
VGTAPSSRATGPPTPRRPPSDILRFED
315445922YP_004078801.1 heavy metal-translocating P-type ATPase [Mycobacterium gilvum Spyr1MAGSGHTRWRPLLEPALTILTVGALGAGAVAWLSGADRIADMCWAAGTAV
AIVPAVAWVILALRSGRLGVDLIAVLSLGGTLLVGEYLAGALIAVMLAGG
RALDAAASRRASRDLTALLERAPRFARRRTGTEVQTMPIAEVAVDDVLVI
APGDVVPVDGRVVDAVAVLDESALTGESLQVDHPVGEAIRSGVVNAGDVF
ELRVTATSENSTYAGIVRLAQQAGAESAPLVRLADRYAAYFLPLALTMAG
IAWLASGSAVRAVAVLVVATPCPLLLAAPVAIVSGLSRASRSGVVIRSGG
ALENLGRATTLVMDKTGTLTMGQPRVVDVVTGPGTDAAEVLRLAASVDQV
SPHVLADAIVTEAVNRGLRLTLPTEAAEEPGRGVSAVLDGRRVTVGKLGD
DAAQSAWAQGAVNRARLDSAALAWVCVDDRPVGAVLLRDPLRRQAPRTMR
RLREAGFDRLVMLTGDRPEPAREVATVLGLDEVYAQQTPADKVAAVRDER
ERAVTVMVGDGINDAPALAAATVGVAMGARGATASSEAADIVLTTDRLDR
LADAMDIARWSRRIAVQSAVAGMSLSLVAMAAAAMGWLPPAVGALLQEAI
DVAVIVNALRALRHDPRTKVDLTAGTESMLQGFAAEHDELRDALGQIRDS
ADLLAGSAARPGAAAFDSVKQSYALLTERILPHERAEETELYPALAVPLH
SGEATATMSRMHAEIQRLSDRIGTHVHLAESSGGIQPYQVDDLLACLYGL
HALLRLHFVQEEENYFTLVQTDPDR
315445921YP_004078800.1 universal stress protein UspA-like protein [Mycobacterium gilvum SpMSDSSPDLGILVGVDGSPESHAAVRWAAQEAVLRRRPVTLMHVVTPIVVT
WPIDTVVANFYEWQEDNAQRVLKQSQETLAAAVSDSTAPTVNVELRHDGI
VPEFTEASKHADLLVLGSRGLGPVGGAVLGSVSRALLHHAHCPTVIAKEG
VVPRDAGALPVLLGIDGSPASENATAFAFDEASRRGADLVALHAWSDVAV
FPILGMDWHQYEQEGHEILAERLAGWQERYPDVHIRRRIVCDTPARWLID
ESRHSQLVVVGSRGRGGIAGLLLGSVSTTVAESALAPVAVVRG
315445920YP_004078799.1 universal stress protein UspA-like protein [Mycobacterium gilvum SpMTTANSDMPVVAGIDGSAAALGAALWAVDEAAARGTTLRLVYVTKPSDRS
AAEYAGDVRHGRQSLREAQVLVQSTGESVNVETEIVDGPPAQALVALSEN
AQMLCVGSVGIGRYARSILGSTAADVAAAAHCPVAVIRPESRVGVDTPNW
IIVAVNDRPHNDAVVEHALQEAALRHAPVLVLGDGRTAASAEVLEQRIRP
WHERYPQVHVYPIANRADVAHFLKKHDEPVLLAVLGDDEADEVAQIVGHG
RSALRHGASSALVVRS
315445919YP_004078798.1 phosphoenolpyruvate synthase [Mycobacterium gilvum Spyr1]MESGTRNTHVCDISALSIGDAEEAGGKGANMGELVAAKLPVPPGFVLLRD
CYRDSMRAGGVDAELASLHREALDDVADTARLGELCERMQGLVRKAGVDD
ATAADMLAAYHAMGPGAVVAVRSSATGEDGADASFAGMNATLTNITGDDG
LVTAVTRCWMSLFSPRVITYRASRGFLGTPAMAVVVQKMIDSEKSGVAFT
ADPSTGARDRVVIEAAFGLGEVVVSGSVEPDTYVVSKETMEPIDVRLGNK
TFKIVRGEDGSDTVVQLDDATAASRVLTDEELHSVAELAIATERHNGCPQ
DTEWAIADGAAYLVQARPITTLGHTTPPARTEHVVLARGLAAAPGIASGK
VRVLQTPDEGHRLQEGEILVAQMTNPDWLPTIRRAAALVTDTGGMTCHAA
IVARELGVPCIVGTRTGTRDLHDGTTVTVDGARGEVVSGVTAPAPQTTAT
PRSAPAPVTAEVTGTRVYVNLAMPESAETVAAQPVDGVGLLRAEFMLTEA
LGGRHPRDLIARGEQSMLVEKMVDSVGRIAAAFAPRPVVYRATDFRSNEF
RGLTGGAEYEPVEHNPMIGFRGCYRYIKEPDLFALELEALARVRERSPNV
ALMIPFVRTRWELEECLSLVDASPLGRQRGLHRWVMAEVPSVVHWLPEYI
GMGIDGVSIGSNDLTQLVLGVDRDSDVCAELFDESDPAVLHAIRRIIETA
NKFGITSSLCGQAPSTNPAFAEHLVRLGITSVSVNPDAVDATRRVIAAAE
RRIMLAAARS
315445918YP_004078797.1 trehalose 6-phosphatase [Mycobacterium gilvum Spyr1]MPVFIDPRHHDAVIFEVDDPVADEVALSASQGDLARRLTAAGIGVGCAES
AMLRETARRLGVHPGRCVVVAGGEAGVRTARAGGFALIVGIDRAERAEDL
RSCGADVVVPDLVAVTVRDGYRRMSELADALQSYGEIVPLAETRTPVVLL
DFDGTLSDIVGDPDTAALVPGARSVLDALAARCPVAVVSGRALADIRDRI
GVPGIWYAGSHGFELCSPDGGIQENEAGLEIVRVLAGALAEVRERVGAVD
GVLIEDKRFSIAVHYRNVAAESVDEVVTAVRNIAQCNGLRADGGRRVVEL
KPDTGWHKGRAVEWILDRIDGDELLLPVYIGDDLTDEDGFDAVRLRGIGV
AVRSAESGDRRSAARFALDSPAAVCAFLARLSDQLAVEQDLTNDPWTLTF
GGYLPEDERLREALCTLGNGYLATRGAAPECDASRLHYPATYVAGIYNRL
FDEIAGTTVDNESLVNLPNWLPVTFRVDGGAWFDIDAVEFTSYVTTLDLR
RATLTREFVMRDQAGRITRIRQRRLVAMHRPHVAAMATTVRAENWSGRLQ
LRSVLDGGVENLGVERYRALSSRHLTVDAMRELSRDAVLLQTHTGESQIQ
IAVAARHRVTGGEPESVDQRVFRDDCRIGHDIEVVVTAGQAVTLEKVIAV
YTGRDHGMSGPVTAAEREIAGADTFDRLEDGHRLAWAHLWERFNIDMGHD
PNLLRLVRLHQLHLLQTLSPHTADLDVGVPARGLHGEAYRGHVFWDELFV
FPVLNMRLPKVTRSLLLYRYRRLPEARRAAAEAGYAGAMFPWQSGSDGRE
ESQRLHLNPRSGRWNPDASARAHHVGLAIAFNIWQHYQVTGDIGFLIDYG
AEMLVEITKFWVSAANLDPHRDRYVIRGVIGPDEFHSGYPGREYDGVDNN
AYTNLMAVWVIVRTLEALERLPLSYRLALLETVGVGDEDLAHWEDVSRRM
FVPFHDGVITQFEGYDRLRELDWEAYRNRYDDLQRLDRILEAEGDSVNNY
RAGKQADTLMLFYLLSADELYELFDRLGYNFAPEQIPATIDYYQKRTSHG
STLSAVVHSWVLARGDRREAMHYFRRVLASDVVDIQRGTTAEGIHLAAMA
GSIDLLQRCFTGLELRRDRIVVGPMWPEPLGRLAFTFRYRGHRLRLTVLG
RSSTLSAEPSEASPILVECRGQAQTLVAGGTVEFTR
315445917YP_004078796.1 erythromycin esterase-like enzyme [Mycobacterium gilvum Spyr1]MTGVALAAAEESDFVPQISAPGREYRDYMTTARRAASDQPRRVFRDRREA
GQALAGLLGGYRGRENVVVLGLARGGIPVAWEVAAALGAPLDAFIVRKRG
APGHDEFAMGALASGGRVVVNDDVVRALRVSPQQLRDVAEREGRELLRRE
AAYRAGRPPLELAGKTVIVVDDGLATGSSMFAAVQALQEMDPAEVVIAVP
AAPESTCREFAAIVDDVVCASMPTPFLAVGESFWDFRQVTDDEVRELLET
PTVGFATARIRLAETPAEVIDRCAVDAPAGVPPLEALDELIGDARIVLIG
ESSHGTEEFYAARAEITKWLIEEKGFCGVAAEADWPDAYRVNRYVRGQAG
DGSAEEALRGFERFPAWMWRNTVVRDFVAWLRACNADRRAQGRREAGFYG
LDLYSLHRSMQEVIDFLDRVDPDAAQRARERYSCFDHSSGDDGQAYGFAA
AFGAGLSCEHQAVEQLVEMHRSAVEYARRDGLLAEDELFYAQQNAQTVRD
VEVYYRSMFGGRVTSWNLRDRHMAETLEALLRHLDRQGGSEPARIVVWAH
NSHVGDARATEVGADGQLTLGQLAREKFGDHVRLIGYTTYTGTVTAASEW
GGLAERKAVRPALNGSVEELFHEVDRPAFLVSPLISHAAAEPLDAVRLGR
AIGVIYLPATERQSHYYHVRPSEQFDGIIHIDRTTALEPLEVTSTWAAGE
TPETYPTGL
315445916YP_004078795.1 6-phosphofructokinase [Mycobacterium gilvum Spyr1]MSGTAAIVTLTMNTALDVTADADNVVPTEKIRCRAERYDAGGGGVNVARF
AHALGAPVSAVFTAGGSTGARVIDLVHATGVCEIPVLIEGGTRESFTVND
RASGRQYRFVLPGPVLSLGEQARCLEALRRAAGTAGIVVASGSLPPGVPP
DFYQRVADICSDVGAMLVLDTSGGGLRHVTSGVHLLKPSIRELRECLDRP
LHTEPEQIAAARELIDRGAAKVVVVSLGADGALLVTPDDSERLSAVPMTS
VSCVGAGDALVAGVAVGLARRWPLGRAVRFGIAAASAKLQTPGTAAFHRD
DVERYFVTQAAHSEA
315445915YP_004078794.1 hypothetical protein Mspyr1_44040 [Mycobacterium gilvum Spyr1]MSTSDFAAAEVEYSVDDDNQLQPEDTLVDRGVDDVLDEGYSPPERAYERG
HFADEEDPAARLNSLFDDAELQRSDDAEREAEFPEHREVGGRRAGRLVAP
DQGFGPDIDAELVADDVGISGGAASAEEAAVHIVEDIVEDGD
315445914YP_004078793.1 universal stress protein UspA-like protein [Mycobacterium gilvum SpMTDEAAPYGIVVGADGSPSSLSAVRWAATEAGLRHLRLTVAHVHEGSGAD
EADSVLDEATAEARNAAGVDGPDVEGRRLTGQPAAELVELSGDAQLVVVG
SRGRTGRSPGSVGLGLLHHARCPVVVVHDDLAPRNRPGRRPVLVGIDGSK
TSLHAAAIAFEEASRRSVDLLALHVCKDADTGGPHDHRMTILEEEAADFL
RETLADLQQRFPEVVVRPLIRFANPTRQLLVQAERSQLVVVGSHGRGAIA
GRLLGSVSAAVAEGCRIPVIVARRT
315445913YP_004078792.1 hypothetical protein Mspyr1_44020 [Mycobacterium gilvum Spyr1]MPATSTDHLALTRRQLDDIAWQFLRSEFTGDIYAQWSLDRSLDVFLLHRG
FRKLHDNGSAYSALMERVMANLGTAARLGLLRRPSVEAKP
315445912YP_004078791.1 acyl-CoA synthetase/AMP-acid ligase [Mycobacterium gilvum Spyr1]MTVIHKSPEDWRVTPNLVDYENTCTTFRWDAAPDVCAGMGDGLCNIAYAA
VDRHAGGSAGGRTALRFVSESALTGETSGRDLEYSELASLSSRFTAVLRA
LGVGKGDRVFTLLGRCPELYVTILGALRNGSVVSPLFSAFGPEPVATRLR
LGDAHVLVTTRAMYRKKVADSRSALTSLKHVLLIDEDIDDDIGEEEGATA
TGFWRWMEATPDGAPIEPTTADDPALLLLRDQVDLDSMDWLNFLVGIHKR
LHVDIPEADYRKLRTLADVVGYVGSREAPS
315445911YP_004078790.1 hypothetical protein Mspyr1_44000 [Mycobacterium gilvum Spyr1]MASRTSSAIAGIVVVVAVAVAVGIIAIVLSGRTQSPGTAGAPEAVDFSRW
WAGTHQHVTDLQKSLDDSKRALNRMDGPALDSACQRMHDAAGVGLVAHLP
APDADLTAELEAVAADAHDAAHMCLAVLEQSLNSYDAEFTTRVDQADRHL
KEAVAVVNRQLAQESRSSRG
315445910YP_004078789.1 hypothetical protein Mspyr1_43990 [Mycobacterium gilvum Spyr1]MTPSLRDTFGPLTRVGGYYARSWRDYLEGDSPRVPIARPTVGLAVEALRD
EVVLFGLRARRPLSDPASFERIHDEVVAALDFYGGRGCLADPARFFTTPD
ALADVEVTPVRRRNHTYARLRWESGYHPLAGEPGGDRWMTYTANRRGYAL
MLRHPEPRPWLMCIHGTEMGRAALDLALFRAWYLHEELGLNVMLPVLPMH
GPRGRGLPKGAVFPGEDVLDDIHATAHAVWDIRALLGWIRAENPGADIGV
YGLSLGGFIAGLLAGLDDGLTCAVLGVPVADLIDLLSRHSGLGRDDPRRR
TILLAAPLGRMISPLSLPPLVPMSGRFIYAGLADQVVHPREQVVRLWEHW
GRPNIEWYHGGHTGFFQSRPVQHFVTDALVRSGLVTGIGRPQSPDAATG
315445909YP_004078788.1 divalent heavy-metal cations transporter [Mycobacterium gilvum SpyrMLLWIVAAGLAMSALALVGGLALLIPDRLFTRVVLPLVALAAGALLGGAM
FHMLPEAIEIVGDSTTVFAWCAAGIVSFHVLEQFLNWHHCHRPVSRHRPL
GYLILVADGLHNLIGGLAVGSAFVVDIKLGIVTWLVAAAHEIPQELGDFG
ILVHSGWTPSRALFYNVVSALTFLVGALLAYAFAGRLDVEVLVPFAAGNF
IYIALADLLPEIATTPALRDKLFYSTTFVIGLMLLWAVAQSV
315445908YP_004078787.1 hypothetical protein Mspyr1_43970 [Mycobacterium gilvum Spyr1]MDGYWLDLALVAVLVLVNGLLSGSEAAFISLGEGQLREMERRGTRRDRIV
VDLAREPNRFLATIQLGITLAGFLASATAAVSLAEPVESRLQFLGGAAAA
VSIAAVTIVVTASTLVFGELAPKRLGMQYARRWAGLVAPLLRFLAIVTKP
VIWGLGQSTDIAVRVVGGDPDVGKKEPTFGELRELIAGHSGLNPEQRTII
SGALEIHERALREIVVPRPRVFRLRADLPVPQALHALAASGHTRAPVVPA
GELDDAIGVVHLRDLLGSAGTVADVARPALLLPDSLRVTAALSRLMDEHE
QFALVIGERGGVSGIVALEDLLEEVVGEIYDEQDKDIRAARLLPDGSRIL
PGSFPVHDLGDVGVDGSRLPRGNHTTVAGLILDSLGRIPEGPGDRIEIGG
YRWEVTAVDAHAITEVRVVPSPH
315445907YP_004078786.1 universal stress protein UspA-like protein [Mycobacterium gilvum SpMALTPDIAKVVVGVDDLSSSQPALEWAAAEAGRRGVPLVILYAATLPIGA
WPVVAVPTGFLDWQRQIGQEILTDARQIAEKLTAGAIPVTAEFAVATPTA
ALVEESRTAGMVVVGSRGRGGLARKVLGSTSMGLVHRAHCPVVVVRDDGS
APASDAPVLLGFDGSASAAPAVEIAFQEASQRGVGLVAVHAWWSPGAFEM
PGFDWEEVRPDVEREASRQLSDWQRRYPGVPVELVVVRDQPARRLVERSG
AAQLLVVGSHGYGAVTGSLLGSVSGAVVQAATTPVMVVRPGDS
315445906YP_004078785.1 diacylglycerol O-acyltransferase [Mycobacterium gilvum Spyr1]MADSGAVERMTAFDAGFLDAEDADRHVSLAVGAVSVVDGPMPDFDEIVAA
IGEKITTIPRLRQVVRRQPLDLSAPEWVEDPALDLAHHIRRAALPHPGDD
AALFRFTAEAMEPRLDRERPLWQAWIIEGLADDRWAILMKVHHCIADGIA
AMHMLAGLSDGGEGESYAGAIRAAHEVGAPRPTLPSPTLNPVRWARAGWN
ATTAVAATAAMTVEGAIGILSGLVRNPESSLNGPVTTMRRYSAVQVPLAK
VASVCQAFDVTLNDVALAAITDSFRSALKRRGEEPHRDSLRTLVPVSVRS
DDARDRLDNRVSVMLPHLPVDEPDPVEQLRTVHRRLNRAKSSGQRQAGTA
AVAVVKLIPFALATRAIRVVTSLPQHGVVTLATNVPGPQHRLQVMGREVV
RMFPVPPMALRLRTAVAILSYGDDLIFGITTDFDAFPDVDDLAAGIGAAV
DTLAVAARPL
315445905YP_004078784.1 hypothetical protein Mspyr1_43940 [Mycobacterium gilvum Spyr1]MGDDGVATEVLGEPGPTLVGDELRDVIATLRARYPECPTGEIEALVADIY
GRLNASATVSAHLIPLTMNLSLRALRTMSQRRG
315445904YP_004078783.1 high affinity sulfate transporter 1 [Mycobacterium gilvum Spyr1]MTSNFGELRSYRRSALRDDTQAGLSVAAYLVPQALAYATLAGLSPAAGLW
AALPPLLVYAILGSSRQLSVGPESTTALMTAAVLAPIVGGDDPVRYAASA
AVLAILVGLVCLGAGMLRLGYLANMLSKPVLVGYMLGVALAMVAGQLGRI
AGVEVTGDTVPAQLAAFAAAVDRVHWPTAGLALGVLVLVLTMERVAPTLP
APLIGVLVATVVTWAAELTRFGVAVVGDVPVGLPAPALPWLTADQIQALI
VPAIGISVVAFSDNILTARAFASQVGQNIDPNIELRALGVSNLAVGFLRG
FPVSSSASRTALAVAAGARTQMYSLVVLAAVAVVVVFGGGLVSHVPAAAL
GGLIVYAALKLVDVRSFRALARFRRSEVVLATLTAIAVTAFGLLYGVVIA
VALSVLDLLRRLSHAHDSVQGLVPGVAGMHDVDDYPDARIVPGLVVYRYD
APLCFANAEDFRRRALEAIDQMDQPTRWFVLNAEANVEVDMTAIEALDQV
RQDCRRRGIVFAMARVKQDLREALAAGGVLDEIGQDRLYMTLPTAVAAYQ
AWVASGNKG
315445903YP_004078782.1 translation initiation factor 1 (bIF-1) [Mycobacterium gilvum Spyr1MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLTRGRIVYRYK
315445902YP_004078781.1 50S ribosomal protein L36 [Mycobacterium gilvum Spyr1]MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG
315445901YP_004078780.1 30S ribosomal protein S13 [Mycobacterium gilvum Spyr1]MARLMGVDLPRDKRMEIALTYIYGVGRTRSQEILEATGISRDQRTKDLTD
DQVSQLRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
315445900YP_004078779.1 30S ribosomal protein S11 [Mycobacterium gilvum Spyr1]MAQAKKGAPKKGQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVIA
WASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVKKVDVFVKGPGSGR
ETAIRSLQAAGLEVGAIADVTPQPHNGCRPPKRRRV
315445899YP_004078778.1 30S ribosomal protein S4 [Mycobacterium gilvum Spyr1]MARYTGPVTRKSRRLGVDLVGGDQSFEKRPYPPGQHGRARIKESEYRTQL
QEKQKARFTYGVMEKQFRRYYEEANRLPGKTGDNLLRILESRLDNVVYRA
GLARTRRMARQLVSHGHFTVNGVKVDVPSYRVSQYDIIDVKDKSINTLPF
EVARQTAGERPIPGWLQVVGERQRILVHQLPERAQIDVPLTEQLIVELYS
K
315445898YP_004078777.1 DNA-directed RNA polymerase subunit alpha [Mycobacterium gilvum SpyMLISQRPTLSEEVVAENRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAA
VTSIRIDGVLHEFTTVPGVKEDVTDIILNLKGLVVSSEEDEPVTMYLRKQ
GPGEVTAGDIVPPAGVTVHNPDMHIATLNDKGKLEVELVVERGRGYVPAV
QNKASGAEIGRIPVDSIYSPVLKVTYKVEATRVEQRTDFDKLILDVETKN
SISPRDALASAGKTLVELFGLARELNIEAEGIEIGPSPAEADQAAHFALP
IDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIK
LHQLGLSLKDSPASFDPSEVAGYDVATGTWNSDAGYDSGYEADDNQDYAE
TEQL
315445897YP_004078776.1 50S ribosomal protein L17 [Mycobacterium gilvum Spyr1]MPKPTKGPRLGGSSSHQKALLANLATALFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVMKKIRDKDIVHVLFAEIGPFYSDRNGGYTRIIKV
ENRKGDNAPMAVIELVREKTVTSEANRARRADAAQKVAAAAAPQAAVEPE
VTEGPSTDEVEAVDETPIADEAQVEVEGTESVSEAEADEAKADSEDDAK
315445896YP_004078775.1 pseudouridylate synthase I [Mycobacterium gilvum Spyr1]MNEPATDSGGGFVRLRLDIAYDGTDFAGWATQAGQRTVAGVIDDALSTVF
RTPMLTRAAGRTDSGVHATGQVAHVDIPTDALPHAYPRTVRAGEAEFGPL
VRRLGRMLTEDVRVRGIVRAAPGFDARFSALRRHYVYRLTTAPYGVEPSE
ARFVTAWPRPLDVDAMAGAAQNVLGLHDFAAFCRHRDGATTIRELQRLDC
VRDGDRISVHVSADAFCWNMVRSLVGALLAVGEHRRDDTWCVQLLHARHR
SSDFAAAPARGLTLVGVDYPPDDELAARNLVTRDVRTADEL
315445895YP_004078774.1 Cutinase [Mycobacterium gilvum Spyr1]MIRQLRDLRVPYLVVALLFGAASLILPPAASAQACPQAELIFARGRIESP
GAGVIGNALASALRNKTGRDIDLYAVKYPADTEVDIGANDMSQRIQYMAR
NCPDTRLVLGGYSLGAAVTDIVIAVPIAAFGFKNPLPDGVDRHIAAVALF
GNGSQWVGPIANFTNPALRDRIVELCHGDDPICNPTAPENWQDNWPAHLA
SAYVGAGMVNQAADFIVGRL
315445894YP_004078773.1 Cutinase [Mycobacterium gilvum Spyr1]MVPMAALAVMPTTTASAQPCPDVEVVFARGTSEPPGVGRVGQALADQLRN
QLGGRTVGTYGVVYPASYDFFTSGDGAADATNRISVMAAQCPNTRIVLGG
YSQGAAVVDMLAGVPPLGNRIGDVGLARPLPGGLNGNVAAVAVFGNPATK
FGNPVSARGSFAGKALDLCADGDPICSDGRNPFAHTSYERSPLIGQAAGF
AAGRL
315445893YP_004078772.1 Cutinase [Mycobacterium gilvum Spyr1]MKIDLEVVTRGVRALVAAAVAAGVLVVAPAVAAPRSLPAAGAQGCTDIQV
VFARGTDEPPGLGRVGSAFVESLRGRVGGRSVGSYAVAYPATFDFLAAAG
GANDASNHIQWMMANCPSTRLVLGGYSQGAAVIDVIAAVPFPAVGFDRPL
PPNAPDFIAAIALFGNPTTKVGLPITASPVWGTRSIDLCNGADPVCSAGD
DIAAHSNYGPAGFTDQAAAFVAGLV
315445892YP_004078771.1 drug/metabolite transporter permease [Mycobacterium gilvum Spyr1]MAALDSSVTSRTQARADHFRSGLLFALASAFAFGCSGPFAKALMTAGWSP
TAAVTARLAGGALAMAVFATVVRPGWVREARHHARTVVLYGIVPIAGAQL
FYFNAVAHLSVGVALLLEYTAPLLVVGWLWATTRHRPSGMTLAGVVLAVG
GITLVLGIIGPGGVAAAHINLAGVGWGLAAAVCAACYFLMSDKAGAMSDK
EVADGRPPLHPITLAAAGLAFGAVTVAALGFSGLMPLAFTANDAVIAGFT
TPWIVPVIALALIPTAIAYTLGIVGIARLRPRFASMVGLSEVMFAVLAAW
MLLGEGMAAAQVIGGAIVLAGLALARQGDRGELVGETNVGETSVTPTALP
QTTPVARGGPATIDP
315445891YP_004078770.1 hypothetical protein Mspyr1_43800 [Mycobacterium gilvum Spyr1]MLFTYDTELTLRAASVLINTDRVDGEQLADLAALGEYLDHFGWTGRRDHD
AAELESVHQLRDRLGRIWAAADDEERAVGHVNALLSDTRASPWLTRHPEM
PEWHLHLASIHDPLWQRMGAEMAMALADLIRAGELRRLKLCAAPDCEASL
IDLSRNRSGKFCDTGNCGNRQHVAAYRERRSNK
315445890YP_004078769.1 subtilisin-like serine protease [Mycobacterium gilvum Spyr1]MAAVTAIALMHTTPTAAAIGPPPVDTLRLPTADPPAPAQPTVQFTDCVAA
PPAAGSAPGQLAGMDLPTVWALTRGAGQTVAVIDTGTARHRRLPHLVPGG
DYVSHRDGTDDCDGHGTLVAGIIGASPDAADPGGFTGIAPDVSLLSIRQS
SNKFRAVDDPGGSGVGDVETLAAAVRTAADLGATVINISTVACLPVAAGL
DDRTLGAALSYAVEAKNVVVVTAAGNVGGPGQCQDPNPRDVGAAHQVRTV
ASPAWYDDYVLTVGSVGTDGSPSDFSLAGPWVDVAATGEGVVSLAATGDG
LADRSPSDAALTGTSYAVPVVSAVAALVRARFPEMTARQVMQRIEDTARP
SSAEWDPVVGHGVVDALAAVSGPGSHPAALPAAPPVDAPAPAPATAPRQG
ATAVRGALICVALTVCVALVSAVIARSRRHG
315445889YP_004078768.1 secretion protein snm4 [Mycobacterium gilvum Spyr1]MPDTLCRLTVHVVGADESAAVDLVLPAACPLGELMPSLVDTIFGDTAGQE
HWQLTRVTGPPLNPALSLRGNDIGDGDMVMLTASRVPSPRISPTEACTVV
ALAGGNRESGHGATPWCIAGIIVAAVTLVRSGMVTPGGWHLWCAAALSGI
AGTMSVALGRADRRVSTVLNTAAVVFAAATGVLAVPAAAWPAATLLAAAS
ALAMSTLLARMCPGAADLPAFCAVAGAVTAAAALSHLAAPRLTTAGAVLV
VLSLAGLAISPRITIALARLSPSRPAVDDEEAAAAHTLLTAMVAGWSSSA
ALGAVVVAAATIVSGASAGLCAGLCVAVGVVLILRRNSHADGVRRLWLGT
SGFIACAAAVPAVADAAPAQAFWLSVAVAGGCVAGALRAGRPEPSNPALR
HGIQVLEYVALAAVIPLAFWVSGVYGLVRDASLL
315445888YP_004078767.1 DNA segregation ATPase FtsK [Mycobacterium gilvum Spyr1]MVTVPCGTFSACGWNGAGVPCVYSYVDAGRIVLDAPPTPPAPTHTNVLAR
LMPVAMVAAMGGMTALYLTSTDATSRNPMFLFFPAMMAVSLIGTLAYGSR
GAGRSGELAAQRAEYLRYLDTVDGALARAGEDLHRYLHAAHPAPAVLWTL
AGTPRMWERAEGDPEFGMIRIGIGERAGATAVAAPGWVPGDDADPVTTEA
VQRLLAHRETVGDVPVTLSLRSVRTLAICGEPAAARSVARALLCQIATLH
HPDTMSISAAPVTDWDWLKWLPHQRSSQEGRHHVVVADEGVPARDGTTLI
ILTAGSGAPTVTADGVPVAAVCDEMPEAEAAACARRIARHRPRRPSRSLR
RDWPALMGIDDPDALDVDVKWSRDLGSDLLRVPIGVADDGSVVELDIKEA
AAHGMGPHGLCVGATGSGKSEFLRTLVLGMVCAHPPGLLNLVLVDFKGGA
TFLGLEAVHHVSAVITNLADEAPLVSRMRDALSGEITRRQEMLRAAGNLT
NITQYAQARARDDTLAPLPALLVIVDEFSELLTQHPDFSEVFVAIGRLGR
SLGIHLLLATQRLDEGRLRGLETHLSYRVCLKTFSAGESRAVLGVPDAYS
LSSQPGAAYLKTASGVLTRFQTAYVSGGYTPASRPRSQPLTVRPFTSSDH
DVASESTVSQRPLLGAVLTRLAGRGAPAHRVWLPPLTSAPRLADLLHGTP
GRRLQVPIGVVDCPFEQQQMRHVVDLSGPAGNLAVAGAPRSGKSTVLSTV
MTALAATHDAAAVQFYCLDFGGGELTGLQHLPHVGSVASRHEGELCRRIV
AHVESVVRHRESATDETWNGHVFLVVDGWATLRQDFDGLEPAITALAGRG
LAYGVHVMIAASRWADLRPALKDQIGSRIELRLGDPAESEMDRRRARDLA
DRPPGRALTREGREMAIALADQRLPVRRDGPGAAPVELLPAHVDRSAIAA
PVPRRGEVLLGLGERELSAVSLDLTEHSHLMVLGENQCGKTASLRLLCAE
LVAAPQEARLEIVDFRRTLLGAVDSDRLTGYAVTPAAVTSRVAAITGVLA
DRMPGEDVTQRQLRDRSWWHGPEIYVVIDDYDLVAGATGNPLTPLADFLP
HARDLGLHVVVARRSGGAARAMFDPLLARMRDMGCAGLMMSANAEDGVLL
GAVRPGRLPPGRGTLIARGRPDELLQVAWTDPP
315445887YP_004078766.1 hypothetical protein Mspyr1_43750 [Mycobacterium gilvum Spyr1]MTLAVVEAGPHTVRGPGLVPDSAAAALEFIDDPIALVGDEPVDTVELWRD
VLRAASGGAGDVVVVVPTWWPGQRVDVIVAAATCLPPGTVVRHRSAVLCG
TASAVLELSAEYAVLTQPDGDPVVTARGTPGMAAQLQTSHTLLIDTPEGV
QILSADVAADLRRAGIPFVHSTSERMRRAAAQSVAERAPVEAGSSRRRGG
GRAVAVVAGIAVTVTAAAGGWAAQTFSAVPRPQMATRTLIEGRVALQVPA
EWTVERVTGDAGSARVRVAAPGGLPALHVTQSLGAATVPLAEVGESLRAA
LTLETDGVFVDFDAAGSRAGRPAVTYVERRTATLTRWAVIVDGPLRIAIG
CQHEPGNRDSVEQICAEAVGSAHALP
315445886YP_004078765.1 hypothetical protein Mspyr1_43740 [Mycobacterium gilvum Spyr1]MSTPSGAHGSALATDFDLMVSVAGRTEARNDEIRSMLSSFIGAMSSVPPS
VWGGVAAVRFREVVERWNAESVKLHSALQRIAETIRDNERLLRDVAEGHS
QRIASAGTGL
315445885YP_004078764.1 hypothetical protein Mspyr1_43730 [Mycobacterium gilvum Spyr1]MNETLSYDFGEIEFTVRQEIHSTSARFNAALEDLRAQIAPLQATWTREAA
EAYRVEQARWEQSAAALNDILVNLGNAVRDGSDDVAATDRSAANAWGA
315445884YP_004078763.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MAASKPSARRASPPPPTPPSASRLQAVHELFVAGEVDTGYLNSHAVRPVV
AQSWERSRAGGVDPDIGAARSAAAAAAVDRLRETHPLAPALPVIRRLLVE
DAIGSGVVVAVSAADGTLLWVEGDPGACRRAEAMNFVPGADWSERSAGTN
APGTALTLGREMQIHGSEHFSRVVQPWSCTAAPVHDPTTGALLGAIDLTG
GGQVATSQTLALVRATAVAVENHLALLRLAGAGAEPAARKPHLVVLGGDR
PRWVTTDSVGHLQITHLTGRHADILVLLSRHPEGLSADHLAVLLDDKDLD
VVTVRAEMSRLRKVIGAENLGSRPYRLLTSITSDLGEVYEALDAADVETA
LDRYPGPLLTQSVSPAIARLRTQLSATLRAAVLAESAQGRTDLLRRWLEQ
PEGRDDRDGWQALRDSAGLTPVARARARGHLAGLDFELG
315445883YP_004078762.1 lysophospholipase [Mycobacterium gilvum Spyr1]MDIDSYARFLPEAYTASWTRPVSTWWPWRGRTVHIARAPVPDASVRVMIV
HGGGGYSGALWPGASVAAGEGVEVLAPDIPLYGDTVEPDPAGVRYDDWVT
LLCDLVNAERAADPRPLILFGASMGGMLAYEVAARTGQISAVMATCLLDL
SDPQARAAATRFAWMGRPAPTLLRAVEPVLGRVRVPIRWLADMRAMSTDP
RLSRLCASDPRGGGVRVPLGFLADWMNYAHTAPEAYTGAPVTLVAPAADT
WTPPELSIRFLQRISAPTELVMLKNCGHFPIEEPGLGHLRDAFIRVAAQV
GQP
315445882YP_004078761.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MLVDAAAQVFSREGLTATTNRIADRAGLSIGTLYQYFPDKLALLRAVAER
HVRDADRELTAVFAALRTEAPPFDATMRAVLGAVVAVHAGGGRLHALLHR
MVPADARDLETVQALEDRIYDEVAFHLKRCDRGGDDVEMTARTLVHAVDA
QLHRVLSRDGFDVGDATDTLMVTVDRLAPPHG
315445881YP_004078760.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium gilvum Spyr1]MTVYARPGADGSLMSFKPRYDNFIGGQWVAPTAGRYFENPSPVTGQPFTE
VARSDEADIEKALDAAHAAAPAWGKTSAAERAVILNKIADRIEENLESIS
LAESWDNGKPIRETLNADLPLAVDHFRYFAGCIRAQEGSLSEVDADTVAY
HFHEPLGVVGQIIPWNFPILMAVWKLAPALAAGNAVVLKPAEQTPASILY
LMEVIGDLLPAGVVNVVNGFGVEAGKPLASSNRIAKIAFTGETTTGRLIM
QYASQNLIPVTLELGGKSPNIFFNDVLAASDDYQDKALEGFTMFALNQGE
VCTCPSRSLIQADIYDEFLALAAIRTKAVRQGDPLDTETMIGAQASNDQL
EKILSYIEIGKSEGAKVVTGGERAELGGDLNGGYYVAPTIFTGNNTMRIF
QEEIFGPVVAVTSFTDYDDAISLANDTLYGLGAGVWSRNGNTAYRAGRDI
KAGRVWTNCYHQYPAHAAFGGYKQSGIGRENHRMMLDHYQQTKNLLVSYS
DQALGFF
315445880YP_004078759.1 Zn-dependent alcohol dehydrogenase [Mycobacterium gilvum Spyr1]MQAAVVTAFGEPLVVEERDLPAPGPGEALVKLVTSGVCHTDLHAAHGDWP
VKPSPPFIPGHEGYGTVVAVGDGVDDLSVGDMVGNAWLWSSCGRCEYCRT
GWETLCEQQRNGGYSVDGSFGTYMLVDAAYAARIPDGVDPVEVAPILCAG
VTVYKGLKVTDTRPGQWVAISGIGGLGHVAVQYARAMGLRVVAIDVDDSK
LDLATGLGAEVVVNARTADVVAEVHRATGGVHGVLVTAVHRDAFGQAIGL
ARRGGTIVFVGLPPGDFPAPIFDIVLKGLTIRGSIVGTRQDMVEAIDFFA
RGLVHPTVHTTRLDDINDVFDRMERGQIDGRVVIDYR
315445879YP_004078758.1 50S ribosomal protein L13 [Mycobacterium gilvum Spyr1]MSTYTPKAGDTTRSWYVIDATDVVLGRLAVEAAKLLRGKHKPTFTPNVDG
GDFVIIINADKISLSGDKLTKKFAYSHSGYPGGLRKRAIGDLLAKHPTRV
VENAITGMLPHTKLGRQIQKKLKVYAGPEHPHTAQQPVPFEIKQVAQ
315445878YP_004078757.1 30S ribosomal protein S9 [Mycobacterium gilvum Spyr1]MTETEFTDTEGTEVAEAVETQVAETETETAADEYAAPREPVIIDRPIQTV
GRRKEAVVRVRLVPGTGQFHLDGRSLESYFPNKVHQQLIKAPLVLVDRLE
QFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKRAGFLTRDPR
AIERKKYGLKKARKAPQYSKR
315445877YP_004078756.1 hypothetical protein Mspyr1_43650 [Mycobacterium gilvum Spyr1]MSFVKNAAAGAVLGGSLLFTAGLGMAQAQPVDAPDGLVNLTVGDLTLLES
VSADTAATAASALCGAEATDISALATQVDGEGAPQTVCSGLPGGDLVVAQ
NVSSQTPLPAAPFPAEDAAPAEEAPAAESGSAEEGAGDGADAPAVPGAEE
SEG
315445876YP_004078755.1 phosphoglucosamine mutase [Mycobacterium gilvum Spyr1]MARLFGTDGVRGVANRELTPELAMALGSAAARRLGRAGATRRRVAVVGRD
PRASGEMLEAAVIAGIAGEGVDTLRVGILPTPAVAYLTSAYDADFGVMIS
ASHNPMPDNGIKIFGPGGHKLDDATEDRIEELVHQGPGERPTGAGIGRVV
DAEDALERYLRHVGKAATTRLDPLTVVVDCAHGAASVAAPRAYRAAGANV
IPIHADPDGLNINDGCGSTHMESLRSAVVSYGADLGLAHDGDADRCLAVD
AHGRVIDGDAIMVVLALAMQQSGELVSDTLVATVMSNMGLHLAMRSADIE
VRTTGVGDRYVLEELRAGQFSLGGEQSGHIVLPSFGTTGDGIVTGLRLMA
RMAQTGRSLADLAQPMQTLPQVLINVEVADKTTVADAPSVRDAVAQVEAE
LGDTGRILLRPSGTEQVVRVMVEAADEDTARQMAVRVADSVSAES
315445875YP_004078754.1 hypothetical protein Mspyr1_43630 [Mycobacterium gilvum Spyr1]MGTVGAARVDSAAVRAIAREYDAVSSIVDGAVRQHFGDMDFGGASAGRAY
VERGEALRATVAELAVGLRQWSRAATEIAVALRASADRYRDADERAAGRV
G
315445874YP_004078753.1 hypothetical protein Mspyr1_43620 [Mycobacterium gilvum Spyr1]MPDDFDVGARLAQGRPAADTLQRYVAACRQLGYEHRDLTLHPAQVTDWYG
TEDGMDLAALHRCCVALDGVGRAAQEALAVQERQLGELSAAWEGAGGDAA
RMFLARHGDSSAVATAAVRTAAEALVSLREELWRVVGGKVDSTVSAEGRA
AGTQAQWSAAATSVTTGTGDTATAGEIVEHAVKPFVDTVIRDEWLPAMRD
AVAAVTAAYDGATAEIAAERTPTFDVPGDLGPDCPEPRPNCDDEGQSGRA
AVAASPPAAATSAAWSPPAGMPAGTPAATAPSAWSPPAAPAPVPPAPAAP
SPLAPAPLAAPAPEAPLPSPGSLGSGMPGLGGGPSGFGQHFADALSGLLG
GGLGGDALESPDLDLEEPALDEPGVEEPELEEEENEEDAELEEDDEAEEK
PESVVAADPVLPEEPCDPPPEPAATVAAPEPPAPPPPAEPVPAAEPASDE
QTPCEIAAGEVPQVGESAG
315445873YP_004078752.1 hypothetical protein Mspyr1_43610 [Mycobacterium gilvum Spyr1]MLFTLGGIAALIGDHSHVATGTTAYDTDAVPFIWSSPIWFPVLVGGATVI
LAELRLHFPALRDGVSARQAVAGVAAVVGLYVTTALVHDGPVVPVTALIA
AGAVIVWCVLGDGPAAVCGAVIAVVGPAVEIALVHLDVFAYHPDADQLFG
VGPFLVPLYFAFGVVAALLGELTVARRPVDARPVCDTVSRGSGAD
315445872YP_004078751.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MPVDRLLPTDDARDLVELARQIADKVLDPIVDRHEKDETYPEGVFATLGE
AGLLSLPYPEEWGGGGQPYEVYLQVLEELAARWAAVAVAVSVHSLSCHPL
MSFGSDEQRQRWLPDMLGGSTIGAYSLSEPQAGSDAAALTCRATAVDGGY
RITGSKAWITHGGIADFYNLFARTGEGSQGISCFLVPRDTEGLTFGKPEE
KMGLHAVPTTAAHYDDANLDSDRRIGTEGQGLQIAFSALDSGRLGIAAVA
VGLAQAALDEAVAYSQERTTFGRKIIDHQGLAFLLADMAAAVDSARATYL
DAARRRDAGLPYSRHASVAKLVATDAAMKVTTDAVQVLGGAGYTRDYRVE
RYMREAKITQIFEGTNQIQRLVISRHLTRG
315445871YP_004078750.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MTRPAFATRRQTELFDALVTLFLSEGFAHLTLDEIAARLRCSKSTLYTLA
GSKEQLVQAATVHFFRTATATVEADVAAVTGARERIAAYLAAVGAALDPA
SDRFMADLDAFAPARAIYEKNTRIAAGRVQELIAEGVAAGEFRDVHAAFA
ADLVATAMVRIQQRIVLDSTGLDDAAAYRELAAILTGGIQA
315445870YP_004078749.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMRTGIFLSYAGGFLEAVDEVVECEKLGVDIALVAEAYSYDAISQLGFLAA
RTSRIELGTGVVPIYTRTPALMAMTAAGVDYVSDGRFRLGLGTSGPQVIE
GFHGLPFDAPLGRTREVVEICRKVWRRERVSYDGKYYQLPLPAERGTGLG
KPLKLINHPVRENIPITIAALGPKNVELTAEIAEGWQPVFFYPEKADEVW
GDALRAGASRRDPALGPLDVMVSATLAIGDDVDDRLSWGKPQLALYIGGM
GARGKNFYHNLATRYGFGEVADHIQDLYLAGKKAEAIDAVPDELVRQVSL
VGPAGFVKERLAAFAEAGVTTLLVHPMGVDAAERVRFVEQLQGLL
315445869YP_004078748.1 hypothetical protein Mspyr1_43570 [Mycobacterium gilvum Spyr1]MASTKKLFTALTRRGPHKVLRGDLAFAGQPGVLYTPAEGRNLPGVAFAHD
WITSARRYDGTLEHLASWGIVAAAPNTETGLAPSVLNMAYDLGTTLDIIA
GVRLGEGAISVHPGKLGLVGHGFGGSAAVFAAAGLSSAPHAPKAVVAAYP
TVSSPAAEQPAAGLTVPGLILVDPGDPMSLRSNAVELGRAWKPATLRATS
KTKSGGLVEGRTLAKVVGLPGADRGTQKIVRALMTGYLLHLLAGNKTYRD
FSDADAELPRAEVMDPFADDPVDLENKVVALLKP
315445868YP_004078747.1 glutamine--fructose-6-phosphate transaminase [Mycobacterium gilvum MCGIVGYVGQRPACDIVVDALRRMEYRGYDSSGVALVDGHGGLTVRRKAG
RLANLEAALAEAGAESPAGATGLGHTRWATHGRPTDRNAHPHRDSSGKLA
VVHNGIIENFAALRAELEAVGVEFASDTDTEVAVHLVAREYTHGDTAGDF
PASVFAVLPRLEGHFTLVFAHADDPGTIVAARRSTPLVLGVGDGEMFVGS
DVAAFIEHTREAVELGQDQAVVVTADGYRVTDFHGNDDAASARPFHIDWD
LSAAEKGGYEYFMLKEIAEQPAAVSDTLLGHFVDNRIVLDEQRLSDQELR
DIDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLDSH
TLVVAISQSGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVLYT
RAGPEIGVASTKTFLAQVAANYLVGLALAQARGTKYPDEVAREYHDLEAM
PDLISRVLASSEPVVALAKQFATSQTVLFLGRHVGYPVALEGALKLKELA
YMHAEGFAAGELKHGPIALIEDDLPVIVVMPSPKNSATLHSKLLSNIREI
QARGAVTIVIAEEGDETVRPYADHLIEIPAVSTLFQPLLSTIPMQLFSAG
VAQARGYDVDKPRNLAKSVTVE
315445867YP_004078746.1 anti-anti-sigma factor [Mycobacterium gilvum Spyr1]MMMISTDQTRSGKFTVTPRRDGDLLVLHVTGDLDVLTAPTLSTHLDIALA
DAPPVVIVDISDVSFLSSAGIGLLVETHRLTERGGISLRVVADGAATSRP
LRMMRIDEVIDLYATTDEAKAGRPA
315445866YP_004078745.1 hypothetical protein Mspyr1_43540 [Mycobacterium gilvum Spyr1]MALRDELLELEHAGWKSLCDGTGDTFYGDLMTDDAVMVLANGMVMDRQTV
VSALGQSPPWARYDIDDVRVIEIDDATAALVYTGTGWRDGLDEPFVGAMS
SVYHRTADGWALALYQQSQKS
315445865YP_004078744.1 yjeF-like protein- hydroxyethylthiazole kinase-related protein [MycMRYFYSADAIRDAEAPLLASLPDGVLMRRAAYGLATAIAAELGTVSGKSV
CAVVGSGDNGGDALWAATFLRRRGAGACAVLLDPERAHEKGLAAFRRAGG
RIVETVPPTTDLVIDGVVGISGSGPLRPHAAEIFAAVDVAGIPVVAVDLP
SGVDPYTGAADGAHVTPALTVTFGGFKPVHAFGDCGRLELVDIGLDLAPS
DVGALDAGDVAACWPVPGPDDDKYTQGVTGVMAGSATYPGAAILCTGAAV
AATSGMVRYAGTAAGEVVSHWPEVIATSTPASAGRVQAWVVGPGLGTDEV
AAAALVHALETDLPVIVDADGLTILAAHPEIVQGRTAPTVLTPHAGEFAR
LAGSSPGAERVADTRRLADRFGATVLLKGNVTVVAEPDGQVYLNAAGNSW
AATAGSGDVLSGVIGALLAAGLPTGQAAAAAAYVHSRAADLSARDPGPAA
APTSASRILAHLRTALASIL
315445864YP_004078743.1 glutamate decarboxylase [Mycobacterium gilvum Spyr1]MPNVSRHSSLAPAYTGRMSMSPVPALRLPDESMEPEQAYRFIHDELMLDG
SSRLNLATFVTTWMDPEAGQLMSETFDKNMIDKDEYPVTAAIEQRCVCMV
ADLFHAENLRDDDPSTAIGVSTVGSSEAVMLAGLAMKWRWRDKFAGKDGD
GWKGRTPNLVMGSNVQVVWEKFCRYFDVEARYLPMEKGRYVITPEQVLDA
VDEDTIGVVAILGTTFTGELEPVAEICAALDALAAGGGCDVPVHVDAASG
GFVVPFLNPLLVWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRNAEHLPE
DLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTQVMHALA
DTAQWLARELEGMTGSDHKPVFEVITDGSAIPVVAFRLTEGAKFTVFDIS
ALLRSYGWQVPAYTMPEDATDIAVLRIVVREGFSANLARALRDDLREVLG
KLDKVGIGGFSDEEHFAH
315445863YP_004078742.1 alanine racemase [Mycobacterium gilvum Spyr1]MNTPSAVIDLDAIAHNVGVLRDRAGRAAVMAVVKADGYGHGATAVARAAL
AAGATNLGVATLDEALSLRRDGVTAPVLSWLHPPGTDFTPAVQADIEVAL
SSRRQLDDLLRAVARTGRTATVTVKADTGLSRNGVSPADHPGLVSALARA
QTDGAVTVHGLMSHLAHGDVPDHPFNDEQARRLTEMASEARSAGVAYDVV
HLCNSPAALTRPDLAFDMVRPGIAVYGQTPIPERGDMGLRPAMTVKCPVA
LVRSVRAGDGVSYGHTWLAPRDTTLALIPAGYADGVFRALSNRFEVTING
RRYPNVGRVCMDQFVVDLGPGPVDVAEGDDAILFGPGDDGEPTAQDWADL
LGTINYEVVTSPRGRIVRGYVGGAQ
315445862YP_004078741.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMSRGAGWLAGAAGVAAVGSAAGVSMARSLRRRVTDEDPHRDEDFELLDAD
RSCVVTTSDGVPLAVREVGPEDAPLTVVFAHGFCLRMGSFHFQRVRLTEH
WGAQVRMVFFDQRGHGQSGDAPPETYTVEQLGRDLEAVLAVMAPKGPVVL
VGHSMGGMAVLSHARQYPQRYPTRVVGAALISSAAEGVARSPVGEILKNP
ALEAVRFTARYAPKLVHRGRGAARSVIGPILRAASYGDEKISPSVVAFSE
RMMHDTPIATLVEFLHALEVHDETAGLETLRRVPTLVACGDRDLLTPKEY
SQEMADVLAKSELVIVPGAGHLVQLECPEVINDALVRLVERATPSKLTAL
TRRVTQRVRSDD
315445861YP_004078740.1 hypothetical protein Mspyr1_43490 [Mycobacterium gilvum Spyr1]MTDRAGSAELLTAEDTVALGATLGRELRAGDVVVLSGPLGAGKTVLAKGI
AQAMDVEGPVVSPTFVLARVHRARREGAPAMVHVDLYRLLDQSSVDLLAE
LDSLDLDTDLDDAVVVVEWGEGVAERLSDSHLDIRLERSSDTDARTAIWT
WSRP
315445860YP_004078739.1 molecular chaperone- inactive metal-dependent protease like proteinMSRLVLAVDTATPAVTAGIVRVDGDAIEVLAEQVTVDARAHAEQLTPNIV
AALGDAGTDASRLDAVVVGCGPGPFTGLRVGMATAAAFGHALGVPVHGVC
SLDAIAAGTTGDVLVVTDARRREVYWARYRDGRRVDGPAVNSAVDVPGGA
AAVAGSPEHTALFELPRLAPVYPSAAGLVAAVRDWDADPAPLVPLYLRRP
DAKPSQAVKR
315445859YP_004078738.1 ribosomal-protein-alanine acetyltransferase [Mycobacterium gilvum SMSAEYGPLQTTDALRCAELEAQLFDGDDPWPERAFLAELAAKHNHYVGAR
VDDKLVGYAGIARLGRFKPFEYEIHTIGVDPAYQGQGIGRQMLHRLFDFA
DGAPIFLEVRTDNAAAIALYESEGFVKMGVRKRYYRVSGADAYTMKREKR
ERQ
315445858YP_004078737.1 O-sialoglycoprotein endopeptidase [Mycobacterium gilvum Spyr1]MIILAIESSCDETGVGIAELGDDGSVTLLADEVASSVDEHARFGGVVPEI
ASRAHLEALGPTMRRALATAGVDKPDVVAATIGPGLAGALLVGVAAAKAY
AAAWQVPFYAVNHLGGHLAADVFDHGPLPESIGLLVSGGHTHLLHVRSLG
EPIIELGSTVDDAAGEAYDKIARLLGLGYPGGRVLDELAREGDPKAITFP
RGMTGPRDEPYAFSFSGLKTAVARYVESHPEASQADVAAGFQEAVADVLT
AKAVRAAGDLGVSTLLIAGGVAANSRLRELAAQRCEAAGMTLRIPRPRLC
TDNGAMIASFAAHLIAAGAAPSPLDAASDPGLPVVQGQVA
315445857YP_004078736.1 hypothetical protein Mspyr1_43450 [Mycobacterium gilvum Spyr1]MSTADKLAVTELLYRYAELIDAGDFDGVGSLLGRGDFMGVTGAEAISTLF
AATTRRFPDHGNTPRTRHLVLNPIVDVDREVASARSTFCVVQRTDTVALQ
PIVVGRYRDTFARDTDGWHFTSRTVDVEMIGDVSDHLMMDPSRLG
315445856YP_004078735.1 hypothetical protein Mspyr1_43440 [Mycobacterium gilvum Spyr1]MFDASLPDPGRLARLSDGELIDAVTGWARASAAAEARKVAAIAELHQRLC
TDAAATHAFWVCDDCDALAAQLSCALTINHGRALSQIELATAMRHRLPKV
GAKFLAGDIPISTVTSILARTELVTDERALAQLDSKLSERAVAWGSLTKY
SLEKALDVWVDRFDPDAVKRTRSSSRGCYFTVGSGSDNADGTTTVHGRVS
NADAAIMEQRIASMARNVCEDDPRTLDQRRSAAIGAIHAGSMFLACACDN
PDCTAKVDDGRGSSFVVHVIADRESLDAPQDPLLHGDDVKDTESAGDTES
AEHTETTEHTETTEHTETTTEPRRKAALIPAARNAILPPAMLAELIAQGA
TIRFVGDPTGAEDHYRPSTALQRFIRSRDITCRFPGCDRPAAHADIDHTT
AWPCGVTHSANCKCYCRLHHLIKTFWPGFSDAQHPDGTVVVTTPTGHAYS
TKPLSGLIFPGWDTAAESPPPPAQATQPSVGRHLKMPTRRRSRAQNRAAR
IKAERMRNAALRASQVRPVASRQTYRAENSHDEYTFRPAGHEPDYGNDPP
PF
315445855YP_004078734.1 hypothetical protein Mspyr1_43430 [Mycobacterium gilvum Spyr1]MKNLTIATTAAAALSAAFLGLAAPALAAPTGGDAQATISSLEAQGNRVIV
HKLADVDLDDASVVGINRGPAIRGTVQDNANDRTYQNTVTGHVYYINVR
315445854YP_004078733.1 Co-chaperonin GroES [Mycobacterium gilvum Spyr1]MASVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGR
WDEDGEKRIPLDVSEGDVVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
315445853YP_004078732.1 chaperonin GroL [Mycobacterium gilvum Spyr1]MSKQIEFNETARRAMEAGVDKLADAVKVTLGPRGRHVVLAKSWGGPTVTN
DGVTIAREIDLEDPFENLGAQLVKSVATKTNDVAGDGTTTATVLAQALVK
AGLRNVAAGANPIALGAGIAKAADAVSEALLASATPVKDAKSIGQVATVS
SRDELVGELVGEAMTKVGTDGVVTVEESSTLNTELEVTEGVGFDKGFISA
YFVTDFDSQEAVLEDALVLLHREKISSLPDLLPLLEKVAEAGKPLLIVAE
DVEGEALSTLVVNAIRKTLKAVAVKAPFFGDRRKAFLDDLAVVTGGQVVN
PDVGLVLREVGLEVLGTARRVVVDKDSTVIVDGGGTQDAIEGRKGQLRAE
IEVSDSDWDREKLEERLAKLAGGVAVIKVGAATETDLKKRKEAVEDAVAA
AKAAVEEGIVIGGGAALVHAGSALDSLRSELKGDELLGVEVFASALSSPL
YWIATNAGLDGAVVVNKVSELPAGQGFNAATLEYGDLIGDGVIDPVKVTR
SAVVNAASVARMVLTTETAVVEKPAEAEDDGHGHGHGHHHH
315445852YP_004078731.1 hypothetical protein Mspyr1_43400 [Mycobacterium gilvum Spyr1]MAKTAEKNTITEVPSDLAERAADLSDDVLTSLESGQRNAIDAVRKFVGTV
EESLPGHDGDGPSRRETIVDAALDMADQLVKTQYEFIRSIVSSAGDALKK
QGDEKSPPQ
315445851YP_004078730.1 lipocalin [Mycobacterium gilvum Spyr1]MGRSSEVTSVSSLNLDRYLGLWYEIGRLPLRWEHPESTDITANYTREDDG
SLRVDNRCIDENGKPSRAIGRATPVDDHPGRLQVSFLPELLRWIPFTKGD
YWVLKIDDAYSVALVGTPDRRNLWLLAREPSIDPATQEAYLAEATRQGFD
LGQWITPKQSGARVTDDQLNR
315445850YP_004078729.1 hypothetical protein Mspyr1_43380 [Mycobacterium gilvum Spyr1]MAQPRLPHAAAGLVAVTAAVSFGPPAGAEPVNPIPGNGIFLVGQDIAPGL
YRTDGTASVFGVWINDVPTQDSMCLWFTYSTPDTNKDNVVATNMSIGPMY
ANINATVKAFESRNCAPWARVT
315445849YP_004078728.1 hypothetical protein Mspyr1_43370 [Mycobacterium gilvum Spyr1]MVTPDRLYREPRRSKPRSARAHNGEMTDAPEDTDNEDTARQRWLSAVAED
SRTDQRHLAAAEVLAHRAELPEEHLAAADDLVVMGLAWRNEIDGEFSYTP
IDPAGKPA
315445848YP_004078727.1 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase [Mycobacterium MTLAQTATSQETSDRRIRRFSEIPSPHDVLTEFPLGARRAERVARDREEI
ADILAGRDDRLLVVVGPCSVHDPAAALDYASRLVKVADDLGDRLKVVMRV
YFEKPRTTTGWKGLINDPGMDGSFDVARGLRTARQLLLDIIDIGLPVGCE
FLEPTSPQYIADAVAWGAIGARTTESQVHRQLASGLSMPVGFKNGTDGNI
QVAVDGVKAAAAPHVFFGMTDMGRGALVSTTGNQDCHVILRGGTDGPNCD
AASVTVTAEKLVTAGLPGRVVIDCSHANSGKDHIRQVQVAKDVAQLVRDG
LPISGVMLESFLVAGAQAPEAQPLTYGQSVTDKCMDWGATDLVLRELANH
G
315445847YP_004078726.1 hypothetical protein Mspyr1_43350 [Mycobacterium gilvum Spyr1]MNKIARPLALAGSGLAALGIVTACAGSSGPAREGPATQTAPGGSAAMDAA
GPAPEFGPPQAPPTVEKRDVVRTAAMTVMVADPSKAADEAAVIAERAQGR
VDSRTEDAGSGSGRASTTVTLRVPVAELDATVRELKTLGTVETASTTAED
VTAQRVDLDARIEALQVSVDRLLAIMRDARDPEALIAAEEALSQRQADLD
SLRAQRDALGDRISYSTVDVAFFAEQVGGPAPKKYEGFFGQVQRGWDGLV
AVVSGAVLLFGFLLPWLGVLAVVGVVIYGLIRWSRARTAPPPPAPDLTPP
DEPAPPPSAEPASPRR
315445846YP_004078725.1 hypothetical protein Mspyr1_43340 [Mycobacterium gilvum Spyr1]MTSSPDRVAALDHIVERNQVWPRMAAKYGVENPVPPWKTSLDGFCDALDH
ASCTAAVPTFKERRDEEDALAATLYADLPYPENQLVALAHSLLARGVIDE
ETLARRMAAVRARLEA
315445845YP_004078724.1 nitrile hydratase subunit alpha [Mycobacterium gilvum Spyr1]MSHDHEHDHDHDHDHDRTVKPMVDEITDFEVLEIALRELCIEKGIFTAEE
HRRFTEYAEQIGPTPAATLVARAWLDPDFAELARTEPMTASKEVGVDWME
PTGFGTPSDFTAFEILADTPTLHNVIVCALCSCYPRPILGNSPEWYRTPN
YRRRMVRWPRQVLSEFGLSLPEGVDVRVQDSNQKHRYMVMPMRPAGTDGW
SEEQLAEIITRDCLIGVALPKPGVTTNVIVDTRPAVHP
315445844YP_004078723.1 nitrile hydratase subunit beta [Mycobacterium gilvum Spyr1]MSTAAERAAQLDLVARLKSAFPELPDAPTPDLLDHARITAYLKPVHDVGG
EPDAPMKYENKQYEQWEEMTYVICEVLAWRGIWLSEERRRIGNVDVGRAE
YLGLPYYGRWLLSVARVLVEKHHIGLTELSERMAEVAARYPDGLAGRKLE
AQPKSVGDGADVRRNAHHLHAVGKGDPQVYAGRAGEPRFAVGDAVVVREL
PVLFYTRTPEYVRGAVGEIDTVAYESPAAEDETWDRPDATPEWFYIVKFM
MADLWHGYTGPSTDILRTEIPQRWLEAAH
315445843YP_004078722.1 transcription factor WhiB [Mycobacterium gilvum Spyr1]MPQPQQLPGPNADIWDWQMQGVCRGVDSAMFFHPDGERGRARAQREMRAK
EMCRRCPVIAQCRSHALAVGEPYGIWGGLSESERELLLKRGIRRTA
315445842YP_004078721.1 hypothetical protein Mspyr1_43300 [Mycobacterium gilvum Spyr1]MDTTPAVSANDLSTAAFGGNPGLWPLPPASGAHDLWVRAVAAGGQGRYAS
GFADLDRLERLPRSATTSSLALSTRASFLRQLGWHTVARGWDGRAAAVAA
GSAEPGAADAGADALIGLAADALGVGRFAASARALEGAAELIGAAATSRP
AVRMGWVSAELAMFRGDGTTAVAHARRAVDLAAGFGSVRHRVKSHVVLAA
ALCSSGDLDAARQEGDLALADATRFGLVPLQWAVACLLADIGSQAYPAAR
IRAVRDASAEAVTRWGGVWRPR
315445841YP_004078720.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium gilvum SMTISGERLDAVVAEAVAGDRGALREVLETIRPLVVRYCRARVGTAERSGL
SADDVAQEVCLAAITALPRYRDQGRPFLAFVYGIAAHKVADAHRAAGRNR
ADPMDVVPERLSGEAGPEQMAIDSESSARMATLLKVLPEKQREILILRVV
VGMSAEETAEAVGSTAGAVRVAQHRALSRLKAEITSTGQGRDYA
315445840YP_004078719.1 hypothetical protein Mspyr1_43280 [Mycobacterium gilvum Spyr1]MPDFGRRDPGGGDPSLTDINRTDQFLDALAAQQQPFVTDRDDVELAQLLA
GWRDDIRETPMGHVVTPLQAEAALDRVTRPAAPRRRFSLAVVGSAAAAVL
AIGGFGAVVAGSGPGDALYGLRTMLFGEQVQMRDDAVILAAQTEMQQVQQ
LIEQGDWQQAQAKLEAVTTTVATVDDVAQKEELIAQWQELTVKVEAQDPV
ATVPPGAPLPTFPELPAAVLDQATTSSETTAGTTSDTTAPSSETTAPSSE
TTGPSSETTTAPSETTGPAPTTTAPTSAPTTTAPAPSTTPTTSVGQTRSS
AAPSTPPSSAPTSTTVVLQSTTTSAAAPTTSAAPTTAAPTTAAPTTAVPT
TPSAVETTPAVEEETPPSPVAPVTTTTPVLPLPGE
315445839YP_004078718.1 hypothetical protein Mspyr1_43270 [Mycobacterium gilvum Spyr1]MRDHLPPGLPPDPFADDPSDPSAALDALEPGQPLDPQERTAVEADLADLA
VYEALLAHKGIRGLVVCCDECQQDHYHDWDMLRANLLQLLVDGTVRPHEP
AYDPEPDAYVTWDYCRGYADASLNEAASESDGYR
315445838YP_004078717.1 inosine-5'-monophosphate dehydrogenase [Mycobacterium gilvum Spyr1]MSIAESSIPIAVPVPTGGDDPTKIAMLGLTFDDVLLLPAASDVIPATADT
SSQLTRRIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQA
GQVETVKRSEAGMVTDPVTCSPENTLAEVDAMCARFRISGLPVVDDKGSL
VGIITNRDMRFEVDQSKPVAEVMTKAPLITAQEGVSAEAALGLLRRNKIE
KLPIVDGHGKLTGLITVKDFVKTEQFPLSTKDSDGRLLVGAAVGVGEDAW
TRAMTLADAGADVLIVDTAHAHNRGVLDMVHRLKRAVGERVDVVGGNVAT
RAAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACAP
HGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAESPGDLIFVNGK
QFKSYRGMGSLGAMQGRGATGNLRGSYSKDRYFQDDVLSEDKLVPEGIEG
RVPFRGPLSTVIHQLTGGLRAAMGYTGSASIEALQQAQFVQITAAGLKES
HPHDITMTVEAPNYTTR
315445837YP_004078716.1 IMP dehydrogenase family protein [Mycobacterium gilvum Spyr1]MRDMVEIGMGRTARRTYELGDINIVPSRRTRSSKDVSTAWQLDAYRFEIP
VLAHPTDALVSVEFAIELGRLGGLGVLNGEGLIGRHADVEDKIARVVEVA
EKDPDPAAATRLLQQLHAAPLDPELLGAAVSRIREAGVTTAVRVSPQNAQ
ALTPTLVAAGIDLLVIQGTIISAERVAKDHDGEGEPLNLKTFISELDVPV
VAGGVLDHRTALHLMRTGAAGVIVGYGSTSGVTTSDEVLGISVPMATAIA
DAAAARREYLDETGGRYVHVLADGDIHTSGDLAKAIACGADAVVLGTPLA
ISAEALGGGWFWPAAAAHPSLPRGSLLQVVDEERPSLAQVLNGPSDDPFG
SLNLVGGLARSMAKAGYCDLKEFQKVGLTVGC
315445836YP_004078715.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MADGITAREAKRLQTRERLLGAAIAEFKRAGMAEADVSTIVGAAGVAHGT
FFFHFPTKEHVLLELERREEDRIAKRFATFTKTHHDLSAVLREAADLVLG
LERRLGVVLFKDFLALHFSPTRPPAEHGGDHPVVVLVAAQIEHARQRGET
AADVTPMNSAIYFLLGLYALLVTTDESTGRSVLVTDYLTRTLRSLQ
315445835YP_004078714.1 choline dehydrogenase-like flavoprotein [Mycobacterium gilvum Spyr1MRPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRYADDEFAKTSWN
LRKFLWAPQFGMYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPF
FNDPQWRDITDWRAELMSHYDQAQRMLGVVTNPTFTDADRIMKEVADDMG
VGDTFVPTPVGVFFGPDGEKTPGKTVADPYFGGAGPARTGCIECGSCMTG
CRYGAKNTLVKNYLGLAEKAGAQVHPLTMVTGFEQRPDGLWEVHTARTGS
KVRRRRKTFTAEHVILAAGTYGTQKLLFKMRDRGKLPKLSDKLGVLTRTN
SESIVGAGRLTVGDDLNLTHGVAITSSIHPTADTHVEPVRYGKGSNAMGL
LQTLMTDGTGPEGTDVPRWRQLLDTARNDRKGTLRLLNPRRWSERTMIAL
VMQHLDNSITTYTRKTKFGFRMLDSKQGHGEPNPSWIPAGNEVTRRIAEK
IDGVAGGTWGELFNIPLTAHFLGGAAIADSPERGVIDPYQRVWNYPTLSV
MDGAAVSANLGVNPSLSITAQAERAAALWPNKGEEDLRPEQGQPYRRLSP
IEPKHPVVPADAPAALRRIPIEPVTSAG
315445834YP_004078713.1 signal transduction histidine kinase [Mycobacterium gilvum Spyr1]MTRAAGVGLLMRSTINLGVSLIALADPLSTALPAGRWLLAVLAVWSLYRL
ATRSHATALLAVDYGLVLAVCLAVPLLVPVTDFHTFNTAPQAIAGTAVIS
FSVAVRVAACVPMAVGIAAAYAAGAASVIGWENVLSVMALYYFAVQCGTA
SIIRFMLLRVAGAIDQARRERAEAEVAERVTDAVRDYEREQLALLHDTAA
STLMMVGQGVSLPPERMAAQARRDLHLLRAGSWEAPPPRVELVAALRDCT
AHLSTPVEFDGRERLWVAGATANPVIAAAREAMNNVDRHARAELLRITVT
ETCVRLADDGIGFDLGHPRTGHGVDDSIIGRMARAGRDAHITSSPGAGTV
VEMSWAPSAPSAITPPAVDPDRLIDRTRTRYGLALTAYSLVNLAITVPTS
DAVLGILATLTSLAAIPGIMWQRWLFAWPAMLAALIVAIGQPAMLPQDHL
LGYPHWAQGAIGWCVLPLMLALPTRTGAALVMAYWACNSLVLVIRDPSPL
ILVNIGYGTASILGIQLFALVFNGLMRDAATAVESENAARQRLLTRDRVS
QALRAEYQRRYATIVAGVVPLLEALTRGEKIDTAMQLRARAECRRLRALF
DQASTFDHPLMQRIRPLIDAAEGRRVDVAIDVSGTLPDLDDEQISALATP
VTEVLNRASTSARIVVTGADGQVEISVVIDIADTADTPPADVDGAEVIVS
GRELWCLIVSGVQKG
315445833YP_004078712.1 response regulator containing a CheY-like receiver domain and an HTMSREDDTRRPVRIAIIDDHDVVHAGIQAWCAEADPPIDLADSFQRPDEYF
AKYPDAADDVDVVLLDLQIEGNRPDFDALSKLAASGRRVIVYSHITADEV
ILTCLELGAVTYLVKSEGKRHLIEAVHSAHTSTPYVGPRMGKAMLNDSTM
GRIKLTDREKQVLIAWFQTESKDLVAERLFIAPTTVRTHLQRARAKYAGV
GRPASTKSALLARAIEDGILSLKDLY
315445832YP_004078711.1 GMP synthase [Mycobacterium gilvum Spyr1]MESAHPRPVLIVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIKARDP
RAVVLSGGPSSVYADGAPQLDPALFDLDIPVFGICYGFQAMAQALGGTVA
RTGTSEYGRTELKVAGGELHSDLPEVQPVWMSHGDAVTEAPSGFEVVATS
VGAPVAAFENRARRLAGVQYHPEVMHSPHGQQVLSRFLHEFAGIDAAWTP
ANIAEALVEQVRNQIGDGRAICGLSGGVDSAVAAALVQRAIGDRLTCVFV
DHGLLRAGERAQVQRDFVAATGANLVTVDVADRFLEALSGVTNPEGKRKI
IGREFIRAFEGAVRDTVERSDGSDVPVEFLVQGTLYPDVVESGGGSGTAN
IKSHHNVGGLPDDLKFALVEPLRLLFKDEVRAVGRELGLPEEIVARQPFP
GPGLGIRIIGEVTSDRLDTLRRADVIAREELTAAGLDHQIWQCPVVLLAD
VRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNE
VPEVNRVVLDITSKPPGTIEWE
315445831YP_004078710.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MSGPIQTILRRLRRGSRDVIENAVSQLFDAAVQPHDNAESGEYRIEELAR
LAGTTTRNIRVYRDRGLLHPPLRVGRVALFNDTHVTRLRLITSMLDRGYN
LAHVDEMLSAWEQGKDLGDMLGLESAIAGSWAVEKPQRMLTAQARRLIDD
PAGFERLVGLGIIRLEDDHATIVRPTLVEAFTEIRRHGVALDKLIDVHEQ
VTPLLDQIGAILVQAGLDEVLDKINPGAAMPDDVEVAELITTLVRFRTHA
VSAVGATLAFSIEAQVESVVAELLGDLISKSAEAAGE
315445830YP_004078709.1 hypothetical protein Mspyr1_43170 [Mycobacterium gilvum Spyr1]MAIDMDAMLAKIKDRQWALADIDWTAPGADRITDEQRPKLKAFMADLCWI
ENIGARGFAALAKKAPTPTIAEIYRYFHAEEQRHANAELALMKRWGMLDE
ASGELPEPNVNIRMAMDWLDTYADDMSLSILGTVIPMLEVALDGALLKFL
LEEVDDPVCHQVFEKINNDESRHIAVDFEVLNMIGHADARRLAIEFVGSV
ATPGLIIGAIMYIPLLNRIRNEIVGMGLEPERLYNAVKRFQSLGERGEFS
HRVPTYQVLKRHAAAVVNPDHPYHLLANSLVWVSERYPRRLLRPIPSWFK
ELTHEPAA
315445829YP_004078708.1 hypothetical protein Mspyr1_43160 [Mycobacterium gilvum Spyr1]MATPQSVGRCSVTRAEQVEQLRKQMAAVSGKVGGSRRAVAPVPQPTPVSE
TPDSLLPMPDSLAELLPDSLPRGTVAVVSGARSLQLSMVAAVTAQGGHVA
IIGQPDVGLLAAAEMGADLSRVAVIPEPGADPVEVAAVLMDGMDLVVLGL
GGRTVPATRARSVVARARQRGCTLLVTDGDWQGASARLDAHVSGYEIAGG
QGGVPTPGCGRIGRVRLAMRARGRSVGPSARVVGG
315445828YP_004078707.1 hypothetical protein Mspyr1_43150 [Mycobacterium gilvum Spyr1]MAGRVLALWCMDWPAVAASAAAELPPTTPVAVTLANRVIACSAAARAAGV
RRGLRRRESQARCPELHVAAADPARDARHFENVTLAVDELVPRAEVLRPG
LLALSVRGAARYFGSEVAAAERLVDAVAAVGAECQVGIADQLPTAVFAAR
MGRIIDPGGDGPFLAELSIRQLSGEPSLASASREELVDLLWRMGIRTIGQ
FAELSRSDVASRFGADGVTAHRIARGEPARGPSGREPEAELDAVMNCDPP
IDRVDAAAFAGRSLAGVLHRSLEAAGVGCTRLAIHAVTANGQELERVWRC
AEPLTEDATADRVRWQLDGWLNRRNPDRRAGAKRPGDGYGRPGAPITVLR
LRPVEVVSAEALQLPLWGGVGEQDRLRARRALVRVQGLLGPEAVKVPVLS
GGRGPAERITLTPFGDELVPQANPDQPWPGRLPEPSPTVLLDDPVELFDA
EGNPVRVTGRGLFSAEPSRLHAPGRSGQLSWWAGPWPVDERWWDPSSKSG
RTARAQVLIDETQALLLCYRQRRWYLEGVYE
315445827YP_004078706.1 inosine-uridine nucleoside N-ribohydrolase [Mycobacterium gilvum SpMSGASHPVFLDVDTGVDDAMALAYLLASPEADLVGIASTAGNVGVDDVCR
NNLALLELCGTTGIPVSRGSATPLVAPLRTAEDTHGPRGLGYARLPEPTT
TLTDHDAAQAWVRAAHDHPGELIGIATGPLTNLALALRAEPALPRLLKRL
VIMGGAFDYRGNTTPVAEWNVSVDPESAAETFSVWSRSGTEHLPIVLGLN
LTEHAEMTPELLRRLAEAAGSTSTQMSVSDVRGTASTASNPLIRVLEDAM
RFYFEFHHDQGEGYLAHVHDPLAAAVALDTTLVRYRSAPVDVELTGTLTR
GMTIADWSGHWGREPNALIGVEVDPAVFFDRFIARVGAFAAALDHS
315445826YP_004078705.1 non-ribosomal peptide synthase- dehydrogenase domain-containing proMSGMRYVVTGGTGFIGSRLIGRLLARPDVTAVHVLVRRGSLGRFERLARD
WDDRVHALVGDLTDPDLGLTDATVAELGPVDHVVHCAAIYDMTAPENRQR
AANVEGTRAVIALSRRLGATLHHVSSIAVAGTHPGVFTEDDVDVGQELPT
PYHRTKFEAEQLVRAADGLRFRIYRPAVVVGDSRTGEIDKIDGPYYFFGV
LSALAALPRFTPMMLPDVGRTNLVPVDFVVDALDALMHADGRDGQTFHLT
APKNTGLRGIYRGVARAAGLPPLVGVLPRAAAAPLLQASGHAKAIRNMAA
TQLGIPGEVLDVVELAPTFTSEHTDEALRDSGISVPEFASYAPGLWRYWA
EHLDPNRARQDDPAGPLVGRHVVITGASSGIGRASAVAVAARGATVFALA
RNAEALDDLIAEIRESGGDAHAFTCDVTDPSAVEHTVKDILGRFGHVDYL
VNNAGRSIRRSVTASTDRFHDYERVMAVNYFGAVRMVLALLPHWRERRFG
HVVNVSSAGVQANNPRYSAYIPSKAALDAFSEVVGAETLSDHITFTNIHM
PLVKTPMIAPSGRLNPAPAISPEHAAAMVVRALVDKPARIDTPIGTVADL
GMYLTPKLARRVLHQLYLGFPDSAAAQGIAENDRAHSATRTLERKPRPPR
RPVPSVRIPSAVKQAVRLVPGVHW
315445825YP_004078704.1 acyl dehydratase [Mycobacterium gilvum Spyr1]MPIDPGALGASTPPAIFRWTDRDTLLYALGVGAGTDDLAFTTENSHDVTQ
QVLPTYAVIACSPFAAITKIGSFDFSRLLHGSQRIRVFSPLPAAGALSVV
SEVADIQDKGEGKNAVVMLKGTGRDPDTGAVVAETLTTLVLRGEGGFGGQ
PGSRPTAPPVPDREPDARVSLPTREDQALIYRLSGDRNPLHSDPWFAQLA
GFRRPILHGLCTYGVAGRALVSELGGGDATRIIAIAARFVAPVLPGDTLT
TSIWRVESGRGVFRTEAANADGSDSRSVLEDGEVEFVDNQR
315445824YP_004078703.1 diguanylate cyclase domain-containing protein [Mycobacterium gilvumMFEGLRRLSANSLAPAVWRFDQYYWFTAILTARGFQTATGRLVAACIAAF
GLLPLGVIAGVFGPQSLVAQILAGIVVIASLAMAMLWLREHWPTRAQSLA
CVAAGALGIGISSLLVADPFVGFLGTAAFVPLTIFIVCFHAARVLALSWT
VGALVLAVLVVRMGSTDLAVALTGLVIAVLINVFVAISCRTVIRLLKPDA
HHRDIEQLTGLLHRDAFYNSVATLLASRSRSDDQYLVFVAVNIDSFSLLL
GLSGSGGGNRARVTVGQALRETVRHNAIVAHVSDDDFVIADTFTTSDASP
LVERIRGAIAATPQRLTASIGVVVTPLPPLAAEPPDEVLDKLIAISQQAI
EQARMAGGNQVRYVLRPDLGEGDDNGDDWPEQNRPA
315445823YP_004078702.1 DNA polymerase III subunit alpha [Mycobacterium gilvum Spyr1]MGWHTGPPSWGEMRRVLEGKPRRAGWPIDAQVGDGGDSPAWSSKRGQYRA
PESRGPATGRSMPYAELHAHSAYSFLDGASTPEELVEEASRLGLRALALT
DHDGLYGVVRFAEAAKELDVDTVFGAELSLGGGTRTDVPDPPGPHLLVLA
RGPEGYRRLSRQLAAAHLAGGEKGVLRYDFDALTEAAGGHWQILTGCRKG
HVRQALLRGGDSAAEAALADLVDRFGRERVTVELTHHGHPLDDERNAALA
ALAPRFGLTVIATTAAHFAEPSRGRLAMAMGAIRARNSIDEAAGYLAPLG
GSHLRSGEEMARVFAHCPEVVTAAADLGEQCAFGLALIAPQLPPFEVPAG
HTENSWLRHLVMQGARERYGPPERASRAYAQIEHELRVIEQLNFPGYFLV
VHDITRFCRENAILSQGRGSAANSAVCYALKVTNVDPIANGLLFERFLSP
ARDGPPDIDIDIESDLREKAIQYVYERYGREYAAQVANVITYRGRSAVRD
MARALGFSQGQQDAWSKQISQWGNLADATHVEDIPEPVIDLAMQISHLPR
HMGIHSGGMVICDRPIADVCPVEWARMENRSVLQWDKDDCAAIGLVKFDL
LGLGMLSALHYAIDLVAEHKGLEVDLAKLDLSEPAVYEMLQRADSVGVFQ
VESRAQMATLPRLKPRVFYDLVVEVALIRPGPIQGGSVHPYIKRRNGQEP
VTYEHPSMERALRKTLGVPLFQEQLMQLAVDCAGFSAAEADQLRRAMGSK
RSTEKMRRLRGRFFEGMAELHGISGDVARRIYEKLEAFANFGFPESHSLS
FASLVFYSSWFKLHHPAAFCAALLRAQPMGFYSPQTLVADARRHGVDVHG
PDVNASLAHATLENHGLDVRLGLGSIRHIGDELAQRLVEDRKLNGPFVSL
TDLTRRVQLTVPQTEALATAGALGCFGITRREGLWAAGAAATERPDRLPG
VGSSSQVPSLPGMTELELTAADVWATGVSPDRYPTEFLREDLDAMGVVPA
DRLLSVRDGTRVLVAGAVTHRQRPATAQGVTFLNLEDETGMVNVLCSQGI
WARHRKLAQTASALVVRGIVQNATGAVTVVADRMGPINMKVASKSRDFR
315445822YP_004078701.1 nitroreductase [Mycobacterium gilvum Spyr1]MTLNLSADEVLTTTRSVRKRLDFDRPVPREVLNECLEIALQAPTGSNAQG
WQFVFVDDPEKKKALADIYRIAADPYLEAEKPTFGDVRDERTPLVVDSAK
YLAEHLHEAPVMLIPCLEGRPDGAPAGMSAGFWGSLLPAVWSFMLALRSR
GLGSAWTTLHLIGDGEKQAAEVLGIPFDKYSQGGLFPIAYTKGTDFKKAK
RLPAEQLTHWNTW
315445821YP_004078700.1 rRNA methylase SpoU family [Mycobacterium gilvum Spyr1]MFNVLFYSPRIAPNTGNAIRMVAGTGCALHLVEPLGFDLSEPKLRRAGLD
YHDLASVTVHADLGAAWSALMPARVFAFTAHAATSFAGVGYEPGDVLMFG
PEPTGLDELTLADPHITEQVRIPMLSGRRSLNLSNAAAVAVYEAWRQHGF
AGAV
315445820YP_004078699.1 methyltransferase family protein [Mycobacterium gilvum Spyr1]MAETSLWMQKVAADPGHSRWYIERFRAMARAGDDLFGEARFVDAMVPRGA
RILDAGCGPGRLGGYLAAAGHHVVGVDVDPVLIEAAEQDHPGATWLVGDL
AELDLPARGIAEPFDVIVSAGNVMTFLAPSTRGEVLRRLRTHLAAEGRAV
IGFGADRDYDFAEFLDDAAGAGLVPDLLLSTWDLRPWREDSGFLVAVLRR
QSRDVS
315445819YP_004078698.1 hypothetical protein Mspyr1_43060 [Mycobacterium gilvum Spyr1]MVRNGVEVAVLADASEIGDSPLMRAMSSEVVDLDTLDGLISIASYETSLD
315445818YP_004078697.1 signal transduction histidine kinase [Mycobacterium gilvum Spyr1]MARSLRPDQRPSRWAPPNWPVRVKVLALVTVPLVLACVFGGLRISASTVE
ARELAHAADRAQMVPAVVDYMAALQNAMVTAGGGGNPAAALGEFDFRKAE
LSRVLEGADVDDSVRLATNTLLEYGQNLLDRIGAAEMDLRTQVMTFGPLL
ITAQTALTGSVGSDEDSVRTEADVLSRAVGARGQMAMQDMLVTRGGELPE
PLLRSAMVTLAGTEPATVTAMGTFLGGASDRADALRSQMVRRMSLLSDPA
VVLVGNPELLMSQKITADIAQSLINRIADEIPARVSRQADDARTAAIRDS
VLVGAAILVALILVLWVARSLVRPLRTLRDSALRVAHDDLGREVERVRDD
GKEFAVDPIPVHTTEEVGQVAHAVDELHQQALVLAGAQARLQLQVTDMFE
TLSRRNRSLVEQQLSLIDGLERDEEDPDRLQSLFQLDHLAARMRRNGANL
LVLAGARISHDRAEPVAVAAIVNAAASEVEEYPRIVTGDLPDSEVAASAA
GDLVHLLAELLDNGLRYSPPHTQVRVSAVPTGNNGLVIEVSDTGLGMTEA
DLRVANMRLESGGEVNPYTARHMGLFVVSRLAAQHGLVARLRSTVAGQPD
SGTTAGVYIPARLLVRRAAPPVQARDVRPAAPAPAPTPAPAPPPPPAPVV
PPASVLPQRRPEPPPPVETPRPGHADIDHDDTIYQKMLSEWLVDPHELSH
SSDLNWKSVWDNGWSAAEAADSAPVRHRTPEGLPVRRPGARLIPGHADTE
NGHPLPVRDPDAVRASLGGHFGGVHAGRRHAREAAGDDR
315445817YP_004078696.1 hypothetical protein Mspyr1_43040 [Mycobacterium gilvum Spyr1]MNPQPPQPDSSLDWLVARFAQDVAGVTHAILVSADGLLMAASGHIPQERA
DQLAAVASGLASLSTGAAQLVDGGHVLQSVIEMEHGYLLLMRVGDGSHLA
TLTARNGDIGQIGYEMAILVERVGAVVQAPRRPRQHQ
315445816YP_004078695.1 hypothetical protein Mspyr1_43030 [Mycobacterium gilvum Spyr1]MGAHERKDPAPSLVRPYTLTSGRTESGVTLPLEAPVGLAKSAPPPGWPAG
DVRSRIVALCDARPSVAEIAAHLSVPLGVARVLVGDLVLQGYLQVHATLG
EAATPDERRALIGRTLRGLRAL
315445815YP_004078694.1 GTPase [Mycobacterium gilvum Spyr1]MVSGHSDSRGRASTKIVISGGFGAGKTTFVGAVSEIVPLRTEALVTTAST
GLDGLAATPDKTTTTVAMDFGRISLDDDLVLYLFGTPGRRRFWFMWDDLI
RGAIGAIILVDVRRLEDSFAAVDFFEARKLPFLIAVNDFDGAPRHPLPAV
REALALAEHVPVISVDARSRESAKSALIAVAEYALSRLAPAG
315445814YP_004078693.1 low-complexity protein [Mycobacterium gilvum Spyr1]MDSTHPREADREFDGHDFCDADLSGLRTERVVYTECDFTGADLSDSDHTG
SAFRNCTFRRTSLWHSTFRHCSFLGSTFTECRLRPLTLVEVDFTLAVLAG
VDLRKTDLSDCRLRETSLVGTDLREAVLAHADLTGARVQDAKFDGADLRG
ARVDPTFWTTARLRAAKVDLPQALAFAAAHGLDIGG
315445813YP_004078692.1 hemoglobin-like flavoprotein [Mycobacterium gilvum Spyr1]MAPNVTAAPAELEAAHAEMIAATLPLVGAHIDEITTEFYRRMFAAHPELL
RNLFNRGNQAQGAQQRALAASIATFATHLIDPDLPHPAELLSRIGHKHAS
LGVTADQYPIVHEHLFAAIVEVLGADTVTADVAAAWDRVYWIMADTLIAL
ERDLYKAAGVTDGDVYRRATVVSRVDDPSGVVLITVRPEGRPFTGSIPAQ
YVSVGVTLPDGARQLRQYTLVNAPGTADLTFAVKPVASVAESPAGEVSSW
ISANLCVGDIVDVTVPFGDLPAPDGAAPLVLISAGIGITPMIGILEYLAA
SAPEASVQVLHADRSDRVHPLRERQHELAEALPNARLDVWYEDGVTAGAP
GAHAGLMNLSAIDLPADAHVYLCGNNGFVQAVRGQLTDRGFISERVHCEL
FSPNDWLLG
315445812YP_004078691.1 hypothetical protein Mspyr1_42990 [Mycobacterium gilvum Spyr1]MSDNDESRRAAAIEAALDEVQQWGVDRFRLEGVAHRAKLSPDYVRQIWGS
ETELIAEALLSYSQAMMELPDTGSLHGDLTGLALALADYLNEPVGRRISR
MLVIDSKSQAVDRDTRARFWTVRRAIVEDIFRRAAERGELRDDVRHIVAL
QLLTSPLHTFALYSEDPIPPEYCRLIADLVTRAIRAD
315445811YP_004078690.1 ABC-type multidrug transporter- ATPase component [Mycobacterium gilMSRPGSPALTVRYDGSTHTFAAGNDVVVGRDLRADVRIAHPLISRAHLVL
RFDQGRWIAIDNGSLNGMYVNGRRVPAADISDGGQLHIGNPDGPLLTFEV
GRHQGSAGTPPSTTAVPVPGRTSATWPAQHSGPTGRPPVQRPPTGPYPGA
GAYPPGGPRPVPAPPPPAAQSRPAHVQQPISAPAMDPVTVMGPAAAPRSS
GSDGNIATSMLRILRPGRPADVPAGSIKIGRSSDNDIVIPDVLASRHHAT
LVPTPAGTEIRDNRSINGTFVNGSRVDSAILADGDTVTIGNVDLSFRDGT
LVRRTETAAATATGGLDVHGVTWTIENNKTLLDNISMSARPGTLTAVIGP
SGAGKSTFARLVAGYTHPTTGQVSFEGHDVHAEYASLRSRIGMVPQDDVV
HGQLTVRQALMYAAELRLPPDTTKADREQVVNEVLEELEMTKHLDTRVDK
LSGGQRKRASVALELLTGPSLLILDEPTSGLDPALDRQVMTMLRQLADAG
RVVLVVTHSLTYLDVCDQVLLLAPGGKTAFYGPPSQIGSAMGTTNWADIF
SSVAGDPEAAAARYLSQNGPPPPQPPALTPSELGNPTRTSLRRQLSTIAR
RQIRLVISDRGYFAFLMLLPFIMGILSLSVPGDVGFGVPKTALEGGEAPN
EPGQILVMLNVGAIFMGTALTIRALIGERAIFRREQAVGLSTSAYLLAKV
VVFTAFAIVQAAIVTTIAIIGKGWGPGAVDSGAVVGDRSIELFLDIAVTC
VASAMVGLALSALAKSAEQIMPLLVVAIMSQLVFSGGMIPVTDRLVLDQM
SWFTPARWGFAASASTVDLIRLVPGPLTPQDRHWEHTPGTWLFDMGMLAL
ISVGYLALVRWRIRLKSAG
315445810YP_004078689.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MPRPARYTVDVLLDAAAELLAAEGPAAVTMSAVARSTGAPSGSVYHRFPT
RAALCGELWVRTEERFQEELLEALSGDGDPQNRCVAGALRNMQWCRENPV
EAHVLLAGPDQLDMGEWPDTVAGRRKRLQRKLRKVLAEIAGDHGRIDGRV
DGRVAAAVMDVPAAIVRRHLRARQSIPAAADDIVADCARALICPN
315445809YP_004078688.1 NADH:flavin oxidoreductase [Mycobacterium gilvum Spyr1]MTVPHDVFSPAKLGPLTLRNRIIKAATFEASTPNALVTEDLITYHRLPAA
GGVGMTTVAYCAVAPGGRTDGWQLWMRPEAVPGLRRLTDAVHAEGAAISA
QIGHAGPVANARTNKATALAPVRFFNPLSMRFARKATADDIREVTEAHAN
AARLAIDSGFDAVEIHLGHNYLASSFLSPLINRRTDEFGGSLANRAKVAR
GAVLAVKEAVGDRIAVTAKLNMSDGVRGGISIEESLQTAKWLEEDGGLDA
IELTAGSSLLNPMFLFRGGAPIKEFARNFKPPLSWGMRMTGKKFMREYPY
EEAYLMRDAKKFRDELTMPIILLGGITNRETMDRAMAEGFDFVAMGRALL
AEPDLLNRIRADSSVKSICDHCNLCMPTIYNHTYCVRTGSPSPVSSGR
315445808YP_004078687.1 5-10-methylene-tetrahydrofolate dehydrogenase [Mycobacterium gilvumMMRVGAITLDGKATRDEIFVDLRERVARLTAAGRTPGLATVLVGDDPGSH
AYVRGKHADCAKVGINSIRRDLPADISQAVLDETIDELNANPECTGYIVQ
LPLPKHLNENAALERIDPSKDADGLHPTNLGRLVLNEPAPLPCTPRGIVH
LLRRFEVEIAGAHVAVLGRGVTVGRPLGLLLTRRSENATVTLCHTATRHL
PEITREADIIVAAAGVPHMVTADMVRPGAAVVDVGVSRDDAGKLVGDVHP
GVWDVAGHVSPNPGGVGPLTRAFLLTNVVERAEANL
315445807YP_004078686.1 hypothetical protein Mspyr1_42940 [Mycobacterium gilvum Spyr1]MIAFARKILGGQWPILVVALFLVAAFALVAAGYWRRGALVMAIGVAVAAA
LRTALPEDRVGLLAVRSRTVDIVTTASVSAAMLYIAWTIDPLGTS
315445806YP_004078685.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTAESDRRSLSFGAEAAAYERGRPSYPPEAIDWLLADSGSRRLEVLDLGA
GTGKLTTRLVERGLDVVAVDPIPEMLDLLRTSLPDTPALLGTAEEIPLPD
DSVDAVLVAQAWHWFDETRAVKEIARVLRPGGSLGLVWNNRDERLGWVKD
LGDIIGHEGDPWSQSVELPAPFTGVERHHVEWTSYLTPQALIDLVASRSY
CITSPERVRARTLDRVRELLTTHPALANSSGLALPYVTVCVRATLA
315445805YP_004078684.1 homoserine O-acetyltransferase [Mycobacterium gilvum Spyr1]MTIVDILSERVALPPEGEIGIVDIGTLTLESGEVIEDAFIAVQRWGELSP
DRDNVVMVLHALTGDSHITGPAGPDHPTPGWWDGVAGPGAPIDTDTWCAI
STNVLGGCRGSIGPSSTAPDGKAWGSRFPVITVRDQVAADVAALARLGIT
EVAAVIGGSMGGARALEWAVTYPDSVRSALVLAVGARATADQIGTQSTQV
AAIKADPNWAGGDYHDTGRSPDAGLEIARRFAHLTYRGEAELDDRFGNDA
QTGEDPTTGGRYAVQSYLEYQGRKLLARFDAGTYVLLTDALSSHDVGRGR
GGIAAALAGCPVPTVVGGITSDRLYPLRLQAELAELLPGCDALDVVESAY
GHDGFLVETDAVGKLIRRTLDLAGK
315445804YP_004078683.1 O-acetylhomoserine sulfhydrolase [Mycobacterium gilvum Spyr1]MTDPDLTAGWAFETKQVHAGQTPDSATNARALPIYQTTSYIFDSTDHAAA
LFGLAEPGNIYTRIMNPTQDVVEQRIAALEGGVAALFLSSGQAAETLAIL
NIAGAGDHIVSSPRLYGGTYNLFHYTLPKLGIEVSFVEDPDDLESWRAAS
RPNTKAFFAETISNPKIDVLDIPGVSGVAHDIGVPLIVDNTIATPYLIQP
LSHGADIVVHSATKYLGGHGTAIAGVIVDGGTFDWTASGRFPGFTEPDPS
YHGVVFAELGPPAYALKARVQLLRDLGSAAAPFNAFLIAQGLETLSLRIE
RHVQNAQRVAEFLEAHPDVVSVNYAGLPSSPWYGLGKKLAPKGTGAVLAF
ELSGGIDAGKAFVNALSLHSHVANIGDVRSLVIHPASTTHQQLSPEEQLA
SGVTPGLVRLAVGIEGIDDILADLELGFAAAKPSAAATDPNAVASF
315445803YP_004078682.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMAPREPIHRGTGEPIVLLHPFLCSQNVWRTVADQLADTERFEVFAPTMVG
HHGGPKSPTWLLHTEVLVDDIEHRMDQLGWDTAHIVGNSLGGWVAFELER
RGRARTLTAIAPAGGWPHHSLSKYETVLKFIMGGPALIAARLLGPRILNV
PGARRLATLPVSGPADGPSQSDLAALVEDATHCSAYLQLLVKTLRMPGLL
ELASLGAPTQLVLCEKDRVFPTPRGNRYFLTHLPDEARVVRLDGVGHIPM
LEAPGAITELIADFVDDHSTPSGKAIG
315445802YP_004078681.1 exodeoxyribonuclease III [Mycobacterium gilvum Spyr1]MTRPVTVSTINVNGIRAAIKQRSPENLGMLPWFKETAADVVCLQETRADD
AQLAEALAPVLADGWHLASAEPSMKGRNGVAVLSRDPIDEFRIGCGAEEF
ATHGRYLEADTAGVTVASVYFPTGEAETDRQREKERFMAAVAARMAALLQ
RSVVDGHESVLCGDWNIAHTENDIKNWKGNVKKAGFLPQERQWLTEVLGT
GWVDVVRQAHPDVAGPYAWWSWRGKAFDNDAGWRIDYHLATPGLAARATS
VLTERPAAYALRWSDHCPVTVHYA
315445801YP_004078680.1 hypothetical protein Mspyr1_42880 [Mycobacterium gilvum Spyr1]MRPLSVSLAMLVVASFFGAGSAHAAPQPAGRAVVVVSGGNATSPFTTPEQ
ACASGLAAGNTDTALRQDLLDHGYRVFTSPAMAGRGPVVDQDGFGAFGDC
PITLPEIMTVDSTGSIDTAGEHLARFFTHLHDVYGVSELDVVGHSMGGLY
SRAAFRVLQSLGSPIRIRSLTTIGTPWQGTYLSDYAHGLTPKSDCLGDRF
CEAAMDDLKAEVDRLVAGSGREVNQAYLMGPGGWNEYQAGVLDDIPVTLI
AGNRFTAPSEPANPSVWPNDGLVATSSALAVDVSERVLPRRRCFTFDDTH
SIFVSDAAGLPWETGLTWDPRVHDVVRGAIDGTLDERLGCSSSR
315445800YP_004078679.1 tryptophanyl-tRNA synthetase [Mycobacterium gilvum Spyr1]MSNTTRPVVFSGAQPTSDSLHLGNALGAVSQWVSLQDGYDAYFCVVDLHA
ITVAQDPATLRRRTLVTAAQYLALGIDPSRATVFVQSHVPSHAELAWVLG
CFTGFGQASRMTQFKDKSQKQGAEATTVGLFTYPVLMAADVLLYDTELVP
VGEDQRQHLELARDVAQRINARFPDTFVVPEAMIPKATAKIFDLQDPTAK
MSKSAESDAGLISLLDDPAKTAKKIRSAVTDSEREIRFDREAKPGVSNLL
TIQSAVTGTDIDKLVEGYAGRGYGDLKKETAEAVVEFVTPIKSTVDDLLG
DPAELEAVLARGAERAREVSGQTLRRVYDRLGFLASR
315445799YP_004078678.1 ribonuclease [Mycobacterium gilvum Spyr1]MTTQSATADPEDKPGFLDRQRARRPWFDHVMRAQERYKDSKGDFYAAGIT
YFTIFALFPLLMLGFSVAGFVLANQPELLQDVEERIRSTFSGDLGQQLVT
LMDSAIESRGAVGLIGLATAAWAGLGWMANLREALSQMWGLFRGETPGFV
KTKLSDLVALLTTFVAIIVTLALSALGNSSLVENILTRIGFPDSPVLTVV
LRASSITVSVLVSWLLFTWIIARLPRERVGFRSSVRAGLIAALAFEVFKL
VASIYLRSVLTGPAGATFGPVLGLMVFAYITSRLILFSTCWAATTPENMR
ENEIPAPPPAVINNRVIARPGLQIWQGLTAAAVGAIGALSLSRRRR
315445798YP_004078677.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium gilvum Spyr1]MATLRTTLLRASALVTASMLALAPAAAAQPAPAADPCPYRVTTPPAVDAS
EVPKPGDPTPGPLPVPAKPMGGDALSGCGVITAPGTPPVPGDVSAEAWLV
ADLDSGDVIAARDPHGRHRPASIIKVLTAMQALRDLPLMKTVPGTPEDAA
QEGTKVGVGEGGVYTVNDLLHGLLMYSGNDAAHALAMQMGGMDTALNKIN
VLAQKLGARDTRVATPSGLDGPGMSTSVYDMGLFYRYAWHNPVFADIVAT
RATQFPGREGAGYPIENDNKLLANYPGALGGKTGYTDDAGQTFVGAAERD
GRRLVAVLMRGTRQPIAPWEQAARLLDYGFATAPGTKVGTLIEPDPSLGV
DRADPAVAALTKTNANANAVLPDVDAMPVRIGVGVIGAVIVLTLIMGARA
LNSRPAR
315445797YP_004078676.1 phosphohydrolase [Mycobacterium gilvum Spyr1]MEELPKLLKGCPLFLVVLGSVLALMHFYVWKRTVKDTSQGRARRWLSAAL
VVLMLMLVAALVVPRTVGVPESRWIAWPGYLWFGVLVYLFLVLLALEPVR
LVLRRWTRPAPPPTPTDAETADPEMAPAVDRRVFLARTAAVTAGAAAVGL
TGFGAARALGPPDVLRVPVRLSRLAPAFDGFRIAVVSDIHLGPLLGRAHT
ERIVRMINEAQPDLVAVVGDLVDGTVEELGAAAEPLQDLVAPEGAFFVTG
NHEYFVDDTPAWLRELERFGLDVLSNENTLLTRGGAGLHLAGVNDIAGES
RSDPPDFDRALAGAGARGPTVLLAHQPIEVEKAADRGVDLQLSGHTHGGQ
MWPFHYAVELAQPTLAGLSRVGDTQLYVTRGAGFWGPPLRIGAPPDISVL
TLRSGD
315445796YP_004078675.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MTGSYDAGPTDVAILEETIGANFARIARTHPGRDALVDVAGGRRWTYAEL
DAEIDTVARGLMAIGVERGDRVGIWAPNCPEWVIVQYATAKIGAILVNIN
PAYRTHELRYVLEQSGVATLISATQFKTSDYVAMVDEVRPDVPALQRVLF
IGTADWDTLRAAGSGVDDADLRRRSGALSNRDPINIQYTSGTTGFPKGAT
LSHRNILNNGFFVTEQIRLQPGDRLCIPVPFYHCFGMVMGNLGCTTHGAT
IVIPAPAFDPGLTLRAIETERCTAVYGVPTMFIAMQNHPDFAERDLSTLR
TGIMAGAVCPVEVMKRCVEEMHLTEMSIAYGMTETSPVSCQTLIDDDLER
RTSTIGRVHPHVEIKIVDPETGEIVERGTPGEFCTRGYSVMLGYWREDEK
TAQAIDADGWMHTGDLAVMRPDGYCNIVGRIKDVVIRGGENIYPREIEEF
LYTHPDIEDAHVIGVPDDRYGEEVCAWIRMRPGRTALDAAAVREFATDKL
AHYKIPRYVHVVDEFPMTVTGKIRKVEMREVSARLLGL
315445795YP_004078674.1 acyl-CoA synthetase/AMP-acid ligase [Mycobacterium gilvum Spyr1]MATNTDLFRSARDHLVDVMADYDKALDTFEWPRIAGSFNWATDWFDAIAA
DPASADRPALWIVEEDGREQKVTFAQMAHRSDQVATWLQGLGVGKGDRVI
LMLGNQVELWESMLAVAKLGAVIMPTTGALGSEDLADRIRRGGAGYVIAN
AADAPKFDGVDGDYVRIAVGGGADGWHTYADSAHADAHTHDPQTTAGDPL
LVYFTSGTTSKPKLVEHSQISYPVGHMTTMAWLGVRPGDVHLAISAPGWA
KHAWSCFFAPWIAEATIFVYNYGRFQAPALLDQIRRAGVNTFCAPPTVWR
MLIQSDLGERPEGLRELLGAGEPLNPEVISAVEQAWGLTIRDGFGQTETT
LQIGNTPGQPVKAGSMGRPMPGVPVVLVDPLTGELADEGEICLDLSGTPL
NLMTGYLGDDERNAQVMRDGYYHTGDVASRDADGYITYIGRTDDVFKSSD
YKVSPFELESVLIEHPAVVEAAVVPQPDDTRLAVPKAYIALADGWSADES
TAKAILEHSRDHLAPYLKVRRLEFADLPKTISGKIRRVELRRREEDAHRS
GAPIESEYRYEDLVN
315445794YP_004078673.1 response regulator containing a CheY-like receiver domain and an HTMSAASPLLRPRDGDALRAELRRVAALGGVPVLFGGEIHEDTLLISEYYGL
RTAGLRGLAVRSSSGLGGASMVAGRPLAVADYRNASSITHDYDGPVLSEG
IRSVLAVPVLVDGQARAMLYGAYRTGAPFGGRAADLVVESARRLSEEFRI
RDEVDRRLRMRDAQSAGGQVSDEQIREVHAELRLLAVTAPPPLQDRLRAL
ADTLSGTGTEPGAGPGAATLAPRELDVLAQVALGCTNAEAAQRLSLKPET
VKSYLRSAATKLGTRTRYESVSKARRLHLIP
315445793YP_004078672.1 hypothetical protein Mspyr1_42800 [Mycobacterium gilvum Spyr1]MKNFTIATTTAAALAAGFFALAAPAAAAPAGGDATDTIAAFEAQGNRVIV
HRLSDTPLAQADVVSINPGADIRSTVQDHANDRTYQNTITGKVYYVNIR
315445792YP_004078671.1 gluconolactonase [Mycobacterium gilvum Spyr1]MAGTSVDTMPRFKRPIDPVRWQAPPVDPLPEFGSAALTLTPIPGGEPEDV
VVDARGYLWTGALDGSIVRLRPDGTAPEVVANTGGRPLGLAFARDGRLLV
CDSPRGLLALDVDTGAIETLVISIDGRPLLFCSNVTETSDGTVYFTESTS
AFTIDQYLGAILEARGRGALHRLDPDGRVTTVVDGLYFANGVTPTADGSA
LVFAETQGRRLSKYWLTGPNAGSVTPLAVNLPAMPDNLSTGAEGRIWCAM
VTPANPVADRLAAGPPVLRKLVWRLPARLQPKPEAVAWAVAFDPDSGDAV
AGFRTTHPEFRMATGLVESGGRLWLGSIGGPYLASVDLAATAP
315445791YP_004078670.1 adenosylmethionine-8-amino-7-oxononanoate aminotransferase [MycobacMTIISETEQATASELGAKANRHLWGHFARHGAGITPPIITRGEGVHIFDD
KGKRYIDGLSGLFVVQVGHGRKELAEAAAKQAEQLAFFPLWSYATPTAVE
LAERLAGYAPGDLNRVFFTTGGGEAVESAWKLAKQYFKLTGKPGKHKVVS
RSIAYHGTPQGALSITGIPAFKAPFEPLVPGGFRVPNTNFYRAPAEYAHD
EKAFGRYCADRIAEAIEFEGPETVAAVFLEPVQNAGGCFPPPPGYFERVR
EICDEYDVLLVSDEVICAYGRIGSMFACEDFGYVPDIITCAKGLTSGYSP
IGAMIASDRLFEPFNDGSTVFGHGYTFGGHPVSSAVALANLDIFEREGLN
ERVKQNAPAFRATLEQLLELPIVGDVRGEGYFYGIELVKDKATKETFNDE
ESERLLRGFLTPALWDAGLYCRADDRGDPVVQLAPPLISGQAEFDAIYDI
LRSVLTEASARM
315445790YP_004078669.1 AsnC family transcriptional regulator [Mycobacterium gilvum Spyr1]MANPGLPHAVGPVSFRVNESRPGAAFQLDELSKAIIEKLQQDGRRSYAGI
GKAVGLSEAAVRQRVQRMVDAGVMQIVAVTDPMQLGFARQAMIGIKCTGD
TTKVAQKLAELPSVDYVVLTAGSFDAIVEVVCEDDDSLLELLNTQIRALP
GVIATETLVYLKLVKQQYNWGTR
315445789YP_004078668.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium gilvum Spyr1]MTVASSWIDGAPVKTGGAQHTVINPATGESVAEFALAQPGDVDRAVASAR
AALPGWKGATPAERSAVLAKLAKMADDATADLVAEEVSQTGKPVRLATEF
DVPGSVDNIDFFAGAARHLEGKASAEYSGDHTSSIRREAVGVVATITPWN
YPLQMAVWKVIPALAAGCSVVIKPAEITPLTTLTLARLASEAGLPDGVLN
VVTGSGADVGAALAGHADVDMVTFTGSTPVGRRVMLAAAAHGHRTQLELG
GKAPFVVFDDADLDAAIQGAVAGALINTGQDCTAATRAIVAESLYDDFVA
GVAEVMSGVVVGDPADPDTDLGPLISQAHRTKVAGMVSRAAGEGGRIVTG
GVAPDGPGSFYRPTLIADVAESSEVWRDEIFGPVLTVRSFTDDDDAIRQA
NDTKYGLAASAWTRDVYRAQRASREIHAGCVWINDHIPIISEMPHGGFGA
SGFGKDMSQYSLEEYLSIKHVMSDITSAVDKDWHRTIFTKR
315445788YP_004078667.1 response regulator containing a CheY-like receiver domain and an HTMLDHWPLIGRANELDEAVSLLRGGAYRGIALTGKAGVGKSRLAREVVQAL
SGAGWTVRRASATATSRSIPLGAFAQWAEDFEGAPLALARKAIASLTSGA
ASDRLLVFVDDAHLLDDLSALVVHQLVQTEQATAIVTIRTGERAPDAVSA
LWKDGLLQRRELQPLSHRQTDRLLAAVLGAEPDRHCSDRLWRLTHGNVLF
MRQVVEQETRAMRMVTRDGAARWLGNLAVSSSLAELVDAQIGAIPDSVRD
VVDFVSVAEPIEWHTLRLLADQSAVEEAEQRELIRTTDDAVYIGHPMYGE
VRRDRCGPSRLRRLRGQVAQAMKDSSGTANNVRRGLLWLESDLPPDPDVL
LAAANAASSLLDFDTAERLLTAAADAGADATARVQLAYNLFMLQKGQVAS
EVIDSIDGAETSRSAFINDVIMRAANLLWPLRSPEESSRVIDEALVDATG
AGRHQLLVFRAGQLSLAARPVDVLEVVADIDYSELDAFGTTVGLCAETLA
FAELGQPEKAVSKAIEGLRVAEITDQNRFLRQPLVEFHTFALTAAGMIGE
AVDVAEDYVAGLHGEPASAQAVASEILGMAELAAGNLDGALRHLPAQLVS
DDPDLAVNNSYWLASSFYRFHLLRAQALARSGAVDAALEALETARAHRHP
SYVYIESTEPLTEAWVAAARQQLVEARRLARTAAEKAREHDQWAREVWCL
QTAAQFDDTHAAVRLAELATFVKGPRVAVAARYAAAVSADDAGGLHQASV
DFEAMGDLLAAADAAAQASTSYHRAGEADRAMAAAARARRLAAVCGGATS
PALAAAVFAPQFTRREREIAILVARGLSNRDIAQALSLSVRTVESHIYNA
SNKAGLTSRSALADAIRDLVN
315445787YP_004078666.1 transposase [Mycobacterium gilvum Spyr1]MAHVRTVKTASGATAVQIVWSNRRGSRSIEHLGSAHDEAGVAALKAAGVQ
RIAGGQDQLDLGLGTRADAEPLPITSSRAQHLWSALSDVYELLGFDEVAE
GDEAFRQMVLARIIEPTSKADSLRVIDEAGIAPVSYPTLNRRLPMFAKPA
FRQGLSSACAAHAQLGPASLVLFDVSTLYFETDAGDGFREPGFSKERRLE
PQITLGLLTDASGMPLMVQAFEGNKAETATMLPVITAFKKAHQLADVTVV
ADAGMISEANQIALQASGLTYVLGSKIPQLPSVVTEWQKEHPGREIPDGL
ILTQRWPSSTSEKARGVPDRMIHYQYRADRARRTSRGIDEQIAKAQRAVD
GKAPVKRNRYIQLSGATKTVNRTLEAKTRALAGWKGYTTNLVEQPPSFII
DAYHRLWRIEKAFRMSKHDLAARPIYHRTRESIDAHLSIVFAAMAISHHI
EAQTGWSIKKFVRTARRYRTITIAAGNHTLTAADPIPNDLAETLAKIRSD
AAH
315445786YP_004078665.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MKSIAAASRVKVSADGHGVVSHAGMGLLRELADRTGLSAQVTGALADTYR
GPWTYAPGEVFADLAAAVADGADCIDGVGQLCGDREHAFGAKASTTTMWR
LVDERIDAAHLPAVRAARASARAAAWAAGAAPEPGGWLHIDIDATLVIDH
SDNKHGATPTWKKSFGHHPLLAFLDRPEIAGGEALAGLLRSGNAGSNTAS
DHIIVLAQALAALPAPWRPDPSRGGGPDRPQVLVRCDTAGATHRFADACR
EQGVGFSFGYPVDARVQDAVDTLNLAQGWYPAIDTDGGLRDGAWVAEATT
LVNLNSWPPGTRLILRKERPHPGAQLRFTDTDGMRVTAFITDTPTGVVAG
QVAGLELRHRQHARVEDRIRELKNTGLRNLPCHGFWANAAWLEIVLAAAD
LVTWARLIGFTSDPTLARAEIATFRYRVLHVAARITRGARQLRLRIDATW
RWATSIATAWQTIRTAFG
315445785YP_004078664.1 transposase [Mycobacterium gilvum Spyr1]MARKNYPDEFKRDAVALYRDTEGASIAQIAAELGVSEATLSAWCKSAGVP
IRHRRGVVVAEPVLGAESPEQELARLRSEVKALRATEARLSTERDILRSA
AKYFAGETNW
315445784YP_004078663.1 transposase [Mycobacterium gilvum Spyr1]MSRFQFVADHLHAFEVKWLCAVVEVARSSFYAWLAGADGRAARRAADEAL
AERIRAVHDEDNTYGAPRITAELNDGAPEGQRVNHKRVARVMRGAGIAGY
RRRRRVKTTVADPANQKVPDLLKRDFTAAQVNTRYVGDITYLPLATGANL
YLATVIDCCSRRVAGWAIADHMRTELVIDALKAAAALRGSLAGAIFHADH
GSQYTSRDFANLCRDLGVVQSMGAVGSSADNALAESFNAALKREILQDRA
CWPDAAICRREVFRWLARYNTTRRHSYCRHSSPATYERNLTPATLPEAA
315445783YP_004078662.1 zinc metalloprotease [Mycobacterium gilvum Spyr1]MIASDPEGEAIEFGIAEPVDAAYAELSIDPITGEFHFLPSDLARVRAAID
PAARTITFTLSASDGLNARTINLLAPITPKHPAGDGILDLADLDTLAQYG
ALQVSENDSGLIGAIIGTFTDDKVENADDARSVLRKVAELLGVYEEISGA
IDVQVVDFGEGSDATSERFYRLTQTFNDVPVLGAEIVLTTAADGTVTGVF
SGWDPAVYGVDSTPSQTIDDAQEITTVATDVLLSRLGRSLPAEEAEAFVS
SLAFHTNLVIYPAADAQPVLVWQVDVSAPIVLDTEMTNPETPDPVLTIAR
YYIYANGADAGSLLTEHTLFDNAWSSQTVTADGLTHGGLFNPPVSYTITI
ETDGGAARMVDAGRRITIYKGTKGHIRGVTRSPVGSGPDWAYDHDTVFTL
DNDVVTKGFFGWDPSAVSAMGNMKKVVEFYNSLGWNFSRIPNSRGVQVGL
VGELGTAGAHWDPVLLNFAFGSDTEAALDVVAHEFTHAVQYSISPATAGF
RGSQGEALAEAYGDILGSLIEGKSGADRWLVGEDAQGDPARDMRNPDSSN
LEQYRNALKFDRAAYLMMSHPDTSAVSTAAWAKIFYTSMWRLPSDPTFQN
ARNAVIASASVQGLTPQQQNVIADAFTAVGITETPRVKIILRWGANPNDL
DSHLTGPSSGSGPRFHIYYGARNYFQDGSYTGALPPCSGHGICGYAASGS
VAGVRFLS
315445782YP_004078661.1 hypothetical protein Mspyr1_42670 [Mycobacterium gilvum Spyr1]MGYAKHVGRVGALALALGIGTAVATPAWAEAPSGSESTSSASESPQKPST
RRGAAAEPAGSTNSADDAGTSDSDGDTTPAGGNGDNDNGAEDDGVEDEID
LEDAVEVDPETEDAGDGSALVGEGVEPSDTQDSATTPVAAEPDSSPAAVQ
SDEKKSSAPEASVDETAASTSPDQDPEPAGTEIADTPAPLSYALAVTEPP
VEPAPAPLVRQPRGPIGVILGGPAAMLDIAAKALHMLFNPGPSVPGDPPL
LLGVLAFVRREIQRTFFNSSPTAVTDSATTSEGLPTRISVLDNDTDPNIA
DVLTVTDFTQAANGVVELNADGSFTYTPTTGYSGTDTFTYTISDEASGWH
GHVAGLHNGHTSTATVSITVTPAPVNEAPAAADDSATTAEDTPAVIDVKT
NDTDPNGDDISIASVGTAQHGTVVVLDGTITYTPATNFHGTDTFEYTITD
GELTDTATVTVTVTPVNDAPVAVNDAVTVAGNTTNNVIAVLGNDTDPDTA
DSLTVTVLSTPSTGGTATINADNTIAYTPATGFSGTETFVYTVSDGTATA
AGTVTVTVTPVPVVPVNQAPVAANDSYTMAPGATSAIINVVANDTDPDGD
TLTVTASPAHSTAPPPSPAPPSPTPPPPATPAPKPSPTPSATEPSPTRQY
SPLTSGPRTLPPCSPIPR
315445781YP_004078660.1 transposase [Mycobacterium gilvum Spyr1]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
315445780YP_004078659.1 transposase [Mycobacterium gilvum Spyr1]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICWDNALAESFFAALKNERV
HHMVYPTRKKARADIARYIELFYNRRRLHSALGYRTPHEVRIEYMNSQLA
A
315445779YP_004078658.1 amino acid transporter [Mycobacterium gilvum Spyr1]MAITEDPATPAVGGKGLQAGALGLVGNVVIGLGAVAPAYSLAATLGYVVL
AVGDKAPSMFVLAFIPMLLVAFAYKELSQDTPDCGTTFTWATKAFGPWIG
WIGGWGLAVSAIIVLANVSEIAAIYLYNFLGLTALAESVPATVALGCFFI
IAMTLVSARGIVVSERVQNVLIAIQFGVLITVSVIALVRVFSGTAGAQAV
MPEFSWLWPSGLDVSSIAAAVILCIFIYWGWDACLAVGEETKDPGKTPGI
AALITTVILVCTYVLVAYALQSFAGFGYVGIGLNNANNTDDVLTVLGEPV
AGAIAASALLLTVSVSALSSTQTTILPTARGTLSMAVYEAIPRRFASVHP
RYMTPAFGTIVMGISALCFYLVLKTLSENALLDSVASLGLAVAFYYGITA
FACVWYFRRTLFSSARNLFFRGVFPLLGGLSMLAAFGISAKDMIQPDYGY
TAFGPIGGVFVLGVGMLVLGIPLMLACFAFGTKRFFRGETLNARTEVKVP
DTF
315445778YP_004078657.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium gilvum SMTASARVGDFEQMRPHLLSVAYRLTGTVADAEDIVQDAWLRWNAHRGDAV
HDLKAWLTTVVSRLALDKLRSAAHRRETYVGEWLPEPVVTGFDGDDPLAA
LVAGEDARFAAMVVLENLTPDQRVSFVLHDGFGVPFSDIADVLGSSTESA
RQLASRARRTVSAAPPPAADHAEVVGKLLAAMASGDLEAVVSLLHPDVTF
TGDANRRAPTAARVIHGPDKVARFLLGLGAKYGPQRLLAGSELGLVNGEL
GVYSRGVDATDDGPRISPRIQALSVRDGLVVAIYDVANPDKFSASPLK
315445777YP_004078656.1 hypothetical protein Mspyr1_42610 [Mycobacterium gilvum Spyr1]MTTTRIDPVSPQRASLMTRLMWRYAKRRFGEVPEPFAIYAHHPGVMMAGA
LHEGMLERASTTLPANVRELAVYWTARQIGCSWCVDFGAMLMRLDGLDLV
RLKDIDDYATSPSFSDDERAAIAYAAAMTTDPHTVTDEQVADLRERFGDK
GVMELTYQVGVENMRARMNAALGITEQGFSSGDACRVPWAQ
315445776YP_004078655.1 permease [Mycobacterium gilvum Spyr1]MQEKTTTQPGRGTIYAGHLRSTATVAVQLVAVAAMLWGLAWVVGKAWVIV
LPVVLALIACTVLWPPVRWLRNKGVPPAAAVLVVLLLAVGVLAGVVAAVA
PAIVEQSQELAEQASAGIVQVRDWLGGPPLNISEAQLNSGVAAITDRLNS
SSAQIASGVFTGVGAATSALVTLFAAIVVTFFFLKDGPGFIPWLRRTVGQ
PAAPHLAEVLDRVWTTLGGFIRTQALVSFVDAVLIGIGLVVLGVPLAYAL
AIITFIGGFIPIVGAFVAGGLAVLIALVSNGPVDALIVLGIIVAVQQLEG
NVLQPWLQSKSMKLHAVIVLLAVTLGASTFGVIGAFLAVPVAAAAAVMIR
YYGEQVGRAAGEDPPPEAAEDENTEDENTEDDGAAVVKT
315445775YP_004078654.1 hypothetical protein Mspyr1_42590 [Mycobacterium gilvum Spyr1]MDVGVASADDEAFLLDLLNTTPVVEGVPTDVLADKATAAEWMSSHGVGAT
DKARRVLIDARSALQAVVRGKATPDVLQRFLEGVHLTPTATDGGVDWTLA
GTDGAARAVLAWDGLRITSPGRLRPCANTECQLFLIDRSKPNNARWCSMA
ICGNRMKARRHYQRSRG
315445774YP_004078653.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMTVVHHRVDTVDGHQVFYREAGDPDAPVIVLLHGFPTSSFMFRNLIPELA
DRYRVIAPDYLGFGYSDAPTVEDFDYTFDALTDSVAGLLTQLGIRRYAIY
VQDYGAPVGWRLALRDPAAITAIITQNGNGYNDGFVAEGWQPAWDYQREQ
TPETEAALRGILTFETTRMQYTAGVPDPSVVSPDTWHHDFALLSRPGNDR
IQLKLFLDYSTNPKIYPALHDYLRASGVPLLAVWGDKDPFFGPDGARAFA
KDAVDAEIHLIDGGHFLLESELTRVANLIRDFLERRL
315445773YP_004078652.1 succinate dehydrogenase subunit B [Mycobacterium gilvum Spyr1]MSAPVLDKQDTPPVPEGAVMVTLKIARFNPESPDDAGWQSFRVPCLPSDR
LLNLLHYVKWYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDML
PKNPNKQLTITIEPIRGLPVEKDLVVDMEPFFDAFRAVKPYLITSGNQPT
RERIQSQTDRARYDDTTKCILCACCTTSCPVYWSEGSYFGPAAIVNAHRF
IFDSRDEAAAERLDILNDIDGVWRCRTTFNCTEACPRGIQVTKAIQEVKR
ALMFAR
315445772YP_004078651.1 nitrate/sulfonate/bicarbonate ABC transporter substrate-binding proMIVEHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGG
MCAALANVEEDNWEWHTFDTVKGGDYLADQDAVEIMAKEAIDAVLDLEKM
GMPFNRTPEGRIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLYQN
CVKHDVEFFNEFYALDITMTETPSGPVATGVVAYELATGDIHVFHAKAIV
FATGGSGRMYKTTSNAHTLTGDGLGIIFRKGLPLEDMEFHQFHPTGLAGL
GILISEAVRGEGGRLLNGDGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPNKDYVYIDVRHLGEDVLEAKLPDITEFARTYLGVDPVKELVPVY
PTCHYVMGGIPTTVNGQVLSDNTTVVPGLYAAGECACVSVHGANRLGTNS
LLDINVFGRRAGIAAANYALGHDFVELPESPAEMVVGWVGDILSEHGNER
VADIRGALQQSMDNNAAVFRTEETLKQALTDIHALKERYSRITVQDKGKR
YNSDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNRDDTNYMR
HTMAYKEGSDLLSDIRLDYKPVVMTRYEPMERKY
315445771YP_004078650.1 succinate dehydrogenase subunit D [Mycobacterium gilvum Spyr1]MTQASRPASGRAENAYDHISDRGGPAPVMQRSFDRPAGLDNPRAPRRSGG
MPNFEKYTWLFMRFSGIVLVFLALGHLFIMLMWESGVYRIDFNYVAQRWS
SPFWQTWDLLLLWLAQLHGGNGMRTIIADYTRKDSTKFWLNTLLALSMAF
TLVLGTYVLLTFDASIS
315445770YP_004078649.1 succinate dehydrogenase subunit C [Mycobacterium gilvum Spyr1]MSTATSADTDLPEPRSKPTRRRTFYRGDPGMWSWLLHRISGATIFFFLFV
HVLDTALVRVSPQAYNEVIETYKTPIVGLMEIGLVAAVLYHALNGIRIIL
IDFWSEGPRHQRKMLWIIAGIFLVLFTAGLGVIGMHMAERFL
315445769YP_004078648.1 cytidine deaminase [Mycobacterium gilvum Spyr1]MTSHIDWNLLRRKAIDVSQHAYAPYSGFRVGAAALVDDHRMVAGCNVENV
SYGLGLCAECAVVCALHSSGGGRLVALTCVGPDGEVLMPCGRCRQVLFEH
GGGDLLIDHPLGPKPLGELLPDAFGPADLDRRPYPVEETP
315445768YP_004078647.1 thymidine phosphorylase [Mycobacterium gilvum Spyr1]MSFDAAGPISHLDAPSVIRTKRDGGALSDEAIDWVIDAYTRGEVAEAQMS
ALLMAIFLRGMTGHEIARWTAAMIASGERLDFSDLRRDGKPLALVDKHST
GGVGDKITIPLVPVVMACGGAVPQAAGRGLGHTGGTLDKLESIPGFTAEI
TKSQIRQQLCDLGAAIFAAGELAPADRKIYALRDVTATTESLPLIASSVM
SKKIAEGTKALVLDSKVGSGAFLDSEAESRELARTMVELGVEHGVQTRAL
LTDMQTPLGRTVGNAVEVVESLEVLAGGGPDDVVELTLALAREMCDVAGL
DGVDPAQTLRDGTAMDRFRDLVAAQGGDVDSLDAAMLPLGQHTETISAPR
SGTMGDIDAMAVGLAVWRLGAGRSVPGEQVQFGAGMRIHRKPGEAVAAGE
PLFTLYTETPHRLAAAASELDGAWSVGDHAPPTRPLIIDRISM
315445767YP_004078646.1 adenosine deaminase [Mycobacterium gilvum Spyr1]MTTPLTLENIRRAPKALLHDHLDGGLRPSTVLELAEQYGYDDLPAHDADE
LAEFFRTAAHSGSLVRYLEPFAHTVGVMQNHDALHRVARECVEDLADDNV
VYAEIRFAPELHIDGGLSLDAVVEAVLAGFADGEKAAAAAGRTITVRCLV
TAMRHAARSREIAALAIRFRDQGVVGFDIAGAEAGYPPSRHLDAFEYMRS
NNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDMDAEGGPKL
GRLAALLRDKRIPFEMCPSSNVQTGAVASIAEHPFDRLARLRFRVTVNTD
NRLMSDTTMSLEMLRLVEAFGYGWSDLERFTINAMKSAFISFPERLAIID
EVIKPRYAVLVG
315445766YP_004078645.1 hypothetical protein Mspyr1_42500 [Mycobacterium gilvum Spyr1]MAADIVPIGLTLTKGDVYTLWAPRWRADGDEWEAFLGKDEDLYVLESVAD
LAAFVRTNNDNDLVDHPAWTKLTESNAHRLAPTESNTHDLVVLEELLAQK
PTEAGVSALYGALAVVSSMGSVCELPAVTKFFNGNPVLGTVGGGVEAFAG
RAGKKRWAEIERIIAKGWDKVIEALDEIITIPEVDSAAVAKAQAELDADA
PEPDEELVIDDVVDTPEESDDLAAEAETKVLGSDKDFWERVGIDPIRIMM
TGGTYFTLRCYFDDRPIFLGRNGRISVFPSERALARYLADEHDHDLSDLA
TYDDIRTAATDGSLRVDVTDDNVYVLTDIVDDLAEGPDALDHDQIELAVE
LLRDIGDYSEEATVDTKLAPDTALGRVIFHVLEPGKVARPNAPFADAVTQ
WESLERFVESRLRSET
315445765YP_004078644.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMIRLGLHGLGIGAGAQRTVIDAVAASAERSGFETLWFGDQVVMADEDGPH
HPYRDDGEIPASAQTDWLDPLIALSFAAAATNRIELATGVLVLPERNPVV
TAKQAASLDRMTGGRLTLGVGIGISPQEYDALGVPFASRGARLAEYVGAM
RTLWRDDDASFAGRYVAFDGVRANPKPQGRSIPVVLGGNSDSALRRVAEW
GDGWYGFDLADVEEAAFRASKLRSMCREFGRDPTELKLSVALHDPVPADA
VRLADAGIDELVLVAGPPADPIAAEAWIADLAGQWMRVRT
315445764YP_004078643.1 cell wall-associated hydrolase [Mycobacterium gilvum Spyr1]MPSATVEALAAPIRRVQGLVGPGWSGDPAADPSGALAGVRQMLSDVAGSA
GHAWRTVDDRWSGAGADAAASFASATTAAIDDAADRAGRLGVAAEDAAAA
VGHAHRRLQQIVDEFESKARALEQRLDDPGVARELLTAARDALGEAIAVV
EELQTELDRQARIVDSAAPAGSPPTTPAEWQSASGTGGGPGGGFAPGSGG
FGNSGATGEMAAFTRPDGTDTPDAAEFGEGVAVRLPDGTVVVAPNAVAAN
AVRHALTQLGVPYQWGGTTPGVGLDCSGLTQWAYREAGLDIPRLAQEQDI
GGAVSGGSLLPGDLAVWDGHVAMVVGDGLMVEAGDPVQLSPIRTANAGQG
FQGFWRPTV
315445763YP_004078642.1 hypothetical protein Mspyr1_42470 [Mycobacterium gilvum Spyr1]MLAHLSVETGLVHDYGVACATHAADLDAAAARLRGVGVGAAAAFGPVGAP
FLASLTRAAAAQSASLGRLSTSVDAGRAAATSCAQAYDLSDGDAASRLAG
SI
315445762YP_004078641.1 uracil phosphoribosyltransferase [Mycobacterium gilvum Spyr1]MDVRVVDHPLAAARLTTLRDERTDNAGFRAALRDLTLMLVYEATRELATH
TISVRTPVAETAGTKLATPPLLVPVLRAGLGMVDQAHELIPEARVGFVGV
ARNEETHQPTPYLESLPDDLSRQPVIVLDPMLATGGSMVHTLELLYSRDA
VDVTVICVVAAPEGLALVEKTAPELRLYTAAIDSGLNDIAYIVPGLGDAG
DRQFGPR
315445761YP_004078640.1 ectoine hydroxylase [Mycobacterium gilvum Spyr1]MSAPATLVPEDRYPTRLPEPRDPIRREEPTVWGDTFSGPLAESDLQSMSD
RGYLVRPGTMPEAWLPTLTAELGRMAGEVAPDDPRFIRERDGGIRSVFEP
HILSDVLAEVLTMDTVLPVARQLLGSDVYVHQARINMMPGFTGGGFYWHS
DFETWHAEDGMPAMRAVSCSIALTENFPFNGSLMVMPGSHRTFYPCVGAT
PRNNHASSLVRQEIGVPSRQTLTDAAAQHGIDQVTGPAGTALWFDCNIMH
GSGSNITPYPRSNIFVVFNSVQNQLVSPYRAETPRPEYLAARTFRPFNEP
VLT
315445760YP_004078639.1 ectoine synthase [Mycobacterium gilvum Spyr1]MIVRTTDEITGTHRDVAAANWRSKRIVLADDAVGFSFHETTIDADSVSEF
HYRHHVEAVWIVEGTGTLTNHETGEEHPLRPGTMYLLNGHERHRVTCDTT
MRMLCVFNPPVTGQEIHDETGAYPPAVQAS
315445759YP_004078638.1 diaminobutyrate acetyltransferase [Mycobacterium gilvum Spyr1]MTATVVTPPTTDPVRENALPDVYDRVESEVRSYCRNWPATMASARGSWMT
DTSGRQYLDFFAGAGALNYGHNNPVLKAPLIDYLSQDSIVHSLDMATAAK
TEFLETFERLILRPRSLDYKVQFPGPTGANAVESALKLARKVTGRESIIN
FTNAFHGMTLGALSVTGNSMKRAGAGIPLVHATPMPYDNYFGGITEDFHW
FERVLDDSGGGLNHPAAVIVETVQGEGGLNVARMEWLRALAELCQRRDIL
LIVDDVQMGCGRTGAFFSFEEAGIVPDIVTLSKSISGYGLPMALTLFRRD
LDVWAPGEHNGTFRGHNPAFVTATKALETYWKSATFAENTAAKGQHVRDR
LESIAAAHEGISARGRGMAQGLKCEEKDLAAAICATAFERGVLMETSGPS
DEVIKLLPPLTTSTEDLDAGLDILAEAVATTVS
315445758YP_004078637.1 diaminobutyrate acetyltransferase [Mycobacterium gilvum Spyr1]MSSSLSETGVAAPPEWTLASKDSVVHRNSWGPFLRRPESTDALAMHKLVA
DTEVLDLNSTYTYLLMATDFADTTIVADRDGDLCGLITGYHPPTRPDVLF
VWQVAVARSAQGTGLAGTMLDSLVGRVHRARCGHPVTVEATVAPSNSASR
ALFGGFARRHGVPLVERPHFTAAQLDAAGAHDDEPILRIGPIVTSRDS
315445757YP_004078636.1 phosphomannomutase [Mycobacterium gilvum Spyr1]MTALHTAVEEWLAHDPDPESAAELAACDDDELAERFAHTLTFGTAGLRGP
LRAGPNGMNLAVVIRATWAVARVLTDRSPASSQVVVGYDARHRSAEFGRA
AAEVFAAQGFTVQLMSGPVPTPAVAFAVRHLGAAAGVQITASHNPPTDNG
YKVYVTGGLQIVSPTDREIEAAIAAAPPADEIPRAPVEVPAADELRAYLE
RAASVRHAAGAARIALTPMHGVGGEFALDALALAGFADVHVVEEQFAPDP
DFPTVAFPNPEEPGASDALLALAAGVDAEIAIALDPDADRCAIGVPTPTG
WRMLSGDETGWLLGDYVLSHADPTHAVVASTVVSSRMLASIAAAHGARHV
ETLTGFKWLARADEGLDATLVYAYEEAIGHCVDPGAVRDKDGISAAVLAC
DLVVSLREQGRTLLDALDDLARRHGVHTTTAVTRRVRSPQDAAAMMSRLR
AAPPEEIAGFAVTVTDLMPRTDALIFSGGDSATSVRVVMRPSGTEPKLKS
YIEIRCTGEVATGRSHAADVQDAVAAAIATWR
315445756YP_004078635.1 MarR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSIEQPAATELRESLMAVARQLRRHRPDNGLTLSQMQLLGEISRAGVTTP
AELGVRMHVRVQSLTDSLNELESRGLIGRRPDETDRRRQLVEMTPEGTAL
LDDDRAERDAWLHHTMRDTLTDLEFDLLMLVAPILRKLADSDTR
315445755YP_004078634.1 hypothetical protein Mspyr1_42390 [Mycobacterium gilvum Spyr1]MTGAVTVPLTRVGVPSAALFAALAVGIVFALTVGGPARVPRRLGIAAQGV
LGVYIGTMVHRDALSALKGDWVIVLAVAVGTLLLSVLAGALLGMRRDVTP
LTGSLALVAGGASGLVAIARELGGDDRVVAVVQYLRVALVTASMPVVVTL
IYHADRSRATTQIAETPAAPWYLSVAIMAALVVVGAVGGRLIRLPGAGLL
GPLALTVALEVSGLSFGLSVPMLLVQAGYMLIGWQAGLAFTRASLRSVGR
LLPTALALIVFIGVATAGLGVLLARVAGLTPLEGYLATSPGGVYAVLATA
VETGSNVTFVIAAQVVRILLMLFTAPLLARAVVWASRKLSPDQSPAMTAD
SREPIRVAD
315445754YP_004078633.1 purine nucleotide phosphorylase [Mycobacterium gilvum Spyr1]MDDPGVLAQQAADELRRRTGVDTHDVAVVLGSGWAPAATSLGEPDAAIPM
ADLPGFTPPSAQGHGGQVLSVRAGPHRVLVLLGRIHAYEGHNLRHVVHPV
RTACAAGARTVVLTNAAGGVREDMTVGQPVLISDHLNLTARSPLVGAQFV
DMVDAYSPALRALARDIDPSLTEGVYAGLPGPHYETPAEIRMLRTLGADL
VGMSTVHETIAARACGAAVLGVSLVTNLAAGMTGQPLSHEEVLAAGRQSA
TRMGSLLSAVIAGL
315445753YP_004078632.1 amidohydrolase [Mycobacterium gilvum Spyr1]MSSAAASTSVEDAVNRRRSDLIELSHSIHAEPELAFAEHRSCAKTQALAA
ERGFEVSEVAGLDTAFRAVYGSGPLVIGVCAEYDALPGIGHACGHNIIAA
SAVGTALALAEVADELGLTVVLLGTPAEELGGGKALMLDAGAFDDIAAAV
MLHPGPLDIAAARSLALSEVTIGYTGRESHAAVAPHLGVNAGDAVTVTQV
AIGLLRQQLAPGQMVHGIVTDGGQASNVIPAHTELRYTMRATNSESLHEL
ESRMAGCFASGAVATGCEHVVSETAPAYAELAPDPWLAERVRAEMLRRGR
TPVPAELEAEFPLGSTDMGNVTQVMPGIHPIVGIDAGGASIHQPAFTAAA
VNASADAAVVDGAIMLARTVVALAESDVERDRVLDLWQKRAS
315445752YP_004078631.1 amidohydrolase [Mycobacterium gilvum Spyr1]MSVLRHAAARWLSEHYDDLVGWRRHIHRHPELGRQEFATTQFVASLLADA
GLNPKVLPGGTGLTCDFGPEDGPRVALRADMDALPMSERTGLPFSSEVAG
VAHACGHDGHTSVLLGAALALASAPELPIGVRLIFQAAEELMPGGAIDAI
AAGALTGVSRIFALHCDPHLAVGQVAVKAGPITSAADHIEVTLHSPGGHT
SRPHLTGDLVYGMGTLITGVPGILSRRIDPRNSTVMVWGAVHAGVAANAI
PQTGTMAGTIRTASRETWLTLEDIVTDAVASLLAPLGIEYVVQYRRGVPP
VVNEEASTRILTHAIEAIGPDVLADTQQSGGGEDFSWYLEEVPGAMARLG
VWSGQGPQLDLHQPTFDLDERALGVGVRLLVNLVEQSAVVP
315445751YP_004078630.1 transporter [Mycobacterium gilvum Spyr1]MCRRATGSAITTFGRNNFGFNNFGLNAVEDRTVHGDKPHFYGIARVIRAA
SIPIILIWVAIAAFLNVSVPQLEEVGKLRSVSMSPDDAPAVISMQRIGEV
FEEYESNSSVMIVLEGQEPLGDDTRAYYSELIADLEADTKHVEHIQDLWS
DPLTAAGAQSADGMSTYFQVYLAGNQGEALANESVRAVQELVAESQPPDG
VAAYVTGASALAAEQEEAGHSSMRFVEALTFLVITIMLVLFFRSIVTTLL
ILVMVGLSLMTVRGAVAFLGFHDIIGLSTFATSLLVTLAIAIAVDYAIFL
IGRYQEAKGTGATSEEAYYTMFGGTAHVIVGSGLTIAGATFCLSFTRLPY
FQSLGVPLALGMLVLIAVAMTFGPAVVTVASKFGLLAPKRDMRVRGWRKV
GAATVRWPGAILVASVAVSLIGLLALPGYQTSYNDRKYLPADIQSNIGYA
AAERHFSPARLNPEVLMVETDHDLRNPADFIVIEKIAKALFAVEGIGRVQ
TITRPDGKPIESTSIPYIMSRQNTTQQLNEKYMLDRMDDMRAQADSLQTT
INVMERMQALMTQMSAITTSMVGKTRTMTADITQLRDHIADLDDFVRPIR
NYFYWEPNCYNIPVCHSMRSLFDLIDGTNLLTENTQELLPDLERMAAIMP
ELIALMPSQIESMKSQRDNMLTQYQTQNSQLEAGAEMSVDSGAMGDAFND
AWNADTFYLPPEAFENKDFQSGIEQFISPNGHAVRFIIAHEDDPLSPAGI
EKIDGLKTAAKEAIKGTPLEGARVYLGGTAATFKDMADGTRYDLLIAGIA
AIGLIFIIMLILTRAVIAAAVIVGTVVLSLGASFGLSVLVWQHFVGIELH
WMVLPMAVIILLAVGADYNLLVVSRLKEEIQAGVGTGLIRTMGGSGSVVT
AAGMVFALTMMTMAVSDLTIIGQVGTTIGMGLIFDTLVIRSFMTPSIAAL
LGRWFWWPQKIRTRPVPVPWGAGASGGGDGDGDGDDGGGGAPRARASAQ
315445750YP_004078629.1 hypothetical protein Mspyr1_42340 [Mycobacterium gilvum Spyr1]MDDELLALFDAQRGVALSGQILSLVPRRRFEQWLNTGVLERIWQGVYCLG
EADDALRLAGLDLSSGRRVAVCLGTAAAIFGFDTEQPRDLHVLNPPGCAL
RDADGLVVHRRDGAPLVTVEGRRATSPAWTAIEVARSLRRPRALATLDAA
LRSGTCTRPDLWRAAIEQKGRRGIVAVRNLLPLADARAESPGESAARLAM
LDADLPVPHLQYEFVDGNGDLRRLDFAWPEAGVAAEYDGVDWHSGPDAMQ
RDRRRYSALLAVGMVVIPIVAEDLRDGGWEMASRIRDQLLRARAA
315445749YP_004078628.1 AIG2-like family protein [Mycobacterium gilvum Spyr1]MPIYAAYGSNMDPDQMLERAPHSPMAGTGWLHGWRLTFGGADIAWEGALA
TIVEDPTSKVFVVLYDVTKEDEENLDRWEGSELGFHKKIRCRVHRTSSDT
TTDPVLAWLYVLDAWEGGIPSARYLGVMADAAEIAGAPPEYVHDLRTRPA
GNVGPGS
315445748YP_004078627.1 pyruvate/2-oxoglutarate dehydrogenase complex- dihydrolipoamide dehMVTRIVIIGGGPAGYEAALVAAGLGRELTQVTVVDSDGLGGACVLYDCVP
SKTFIASTGVRTELRRAQGMGYDIGIDDAPISLPKINNRVKTLAASQSAD
ISSQLLNQRVTIIGGRGELVDDVAGMAHHRVKVTTHDGKVGVLKADVVLI
ATGASPRVLPNAVPDGERILTWRHVYDLEELPEHLIIVGSGVTGAEFCNA
YTELGVTVTVVASRDQILPHEDSDAAAALEQVFNERGVTLIKNARAESVT
RTDTGVRVTIADGRVVEGSHALMTVGSVPNTSGLGLERVGVELNPGGYIP
VDRVSRTPAPGVYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVAPIRLR
TVASATFTRPEIAAVGIPQSAIDDGSVPARTLMLPLSTNARAKMSLLRHG
FVKIFCRPATGVVIGGVVVAPIASELILPIALAVQNRISVTDLAQTLSVY
PSLSGSIVEAARRLMAHDDLD
315445747YP_004078626.1 glycerol-3-phosphate dehydrogenase [Mycobacterium gilvum Spyr1]MSDPIPAPGNGETFLGPDERARAWQRLGSEQFDVIVIGGGIVGAGAALDA
ATRGLKVALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERE
LSLTTLAPHLVKPLPFLFPLTNRVWERPYIAAGIFLYDQLGGAKSVPPQK
HLTRAGALRLSPGLKRSSLIGGIRYYDTVVDDARHTMTVARTAAHYGAVV
RTSTQVVALLREGDRVTGVQVRDSEDGRVTDVRGHVVVNATGVWTDEIQA
LSKQRGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWI
IGTTDTDWNLDLAHPAATKADIDYILGHVNKVLATPLTHDDIDGVYAGLR
PLLAGESEETSKLSREHAVAVPSPGLVAIAGGKYTTYRVMAEDAIDAAAE
FIPTRVAPSITEKVPLMGADGYFALINQTQSVGTYYDLHPYRVRHLLDRY
GSLIGEVLKLAEDNPDLLNPITEAPVYLKVEAAYAAAAEGALHLEDILAR
RMRISIEYPHRGVDCAREVAEVVAPILGWSPEDVDREVSTYLARVEAEVQ
SQTQPDDASADALRAAAPEARAEILEPVPLN
315445746YP_004078625.1 23S RNA-specific pseudouridylate synthase [Mycobacterium gilvum SpyMRRPPPLPVRDGLGPARVRVQGGLLVEEFQRRWGTGAKVVDGEVFCADGT
VADDSTVLPPGAHVYLYRDLPDEVPVPFDMPVLHRDDDIVVVDKPHFLAT
MPRGSHVVQTALVRLRRELDLPELSPAHRLDRLTAGVLLFTARREVRGAY
QTLFVRGEAAKTYVAHSSHAIDREFPLTVRNRLVKHRGSLQAVEEPGEPN
AETVVEYLGEGMYRLTPRTGRTHQLRVHMAGLGIPITGDPLYPDVVDVPP
GDFGAPLRLLAQALEFTDPISGELRRFTSGRTLAGE
315445745YP_004078624.1 hypothetical protein Mspyr1_42290 [Mycobacterium gilvum Spyr1]MGCHNHHSCLRISGVALRGSVIVASAAMFVAGALGVAPAGHAAVCGSVGG
VHVDVSGCADPLYELNDALAPPPPPPPPPPPPPGAPPPPPPPPPPPPPPV
YIPPPLPNVNVCADVGRRINVSGCI
315445744YP_004078623.1 hypothetical protein Mspyr1_42280 [Mycobacterium gilvum Spyr1]MDRASFDRLFDMTDRTVVVTGGTRGIGLALAEGYALAGARVVVASRKADA
CEQAAHHLRELGAQAIGVPTHLGQVDDLGALVERTVAEFGGLDVLVNNAA
NPLAQPFGHMTVDALSKSFEVNLQGPVMLTQEALPHLKASDHAAVLNMVS
VGAFIFAPMLSIYASMKAAMMSFTRSMAAEFVHDGIRVNALAPGPVDTDM
MRKNPQEAIDGMVGGTLLGRLASADEMVGAALLLTSDAGSYITGQVIIAD
GGGTPR
315445743YP_004078622.1 enoyl-CoA hydratase [Mycobacterium gilvum Spyr1]MSSVLEVARPTPEIAVLTLNRPDKLNALSYELVEALHAELDALARDNACR
AVVLTGAGRGFCSGLDLSAPNPEETGGGTEFPRSGMRWQERIADLTAKIH
RLRQPVIAAVQGVAYGGGLGIAAACDIRVAAPTARFCTQFIKLGLGGCDI
GVSYTLPRIVGAGVAFDMILTARTVAADEALRLGLVSRVSDTPVDEALAI
AETLCNYGKFGVESTKQVLWANLEASSLEARCTWRTAARSWRPPVARCAS
WRRRSCARADPLARFAELAFQQTKCEKGPAGMHVRRR
315445742YP_004078621.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MNSRTPSSRRGHSSRSRSKDGNSRETLSREERKEATRRAIVDAALHLLAE
RGFSALSLREVTREAGIVPAAFYRHFDSMEALGLVLIDESFRSLREMLRG
ARAGKLDPNRVIESSVDILIDGVQQRREHWRFIGRERSTGVTVLRYAIRT
EIRLITSELAIDLARFPALNTWSSEDLNILASVFVNSMIAIAEQLEDVTD
TASVDEIRRTAVKQLRMITVGVAGWRSG
315445741YP_004078620.1 flavodoxin reductase family protein [Mycobacterium gilvum Spyr1]MFTEVLTKRSRRFALLDLLTGPHGVDRYTELVDPTWTRGNARAKVVGVRR
STPRSVTLTLAPNRAFDGFRAGQHINVSVEIDGRRRTRPYSPANAEGEAN
IELTIGRHDGGLVSTYLFDHARRGMVVGLDSVGGDFVLPARPAENILFVS
GGSGITPVMSMLRTLRARRHAGQVTFVHYARSADEACYRAELAVIAREMP
NVTVLHGYTRVATDSDLDGRFGAGQLPAGVTHADAVYACGPPALVDAVRE
LHPHAESESFVPPVFTADESGGGTVSFTTAGVDVVDDGRPLLNQAEDAGL
APESGCRMGICFSCTRRKTSGVVRNVVTGAVSSTEEEDVQICVSAAVGDV
DIDL
315445740YP_004078619.1 fatty acid desaturase [Mycobacterium gilvum Spyr1]MTELLETTPQRTISKTVAGKTITMTPDQLDAFGKELDALKESVIADLGER
DATYIRRMIKAQRGLEIGGRALLFGGIFPPFWLAGTTMLGLSKIIDNMEI
GHNVMHGQYDWMGDPAISSKGFEWDTACPADQWRHSHNYMHHTYTNIVGL
DRDIGYGILRMSSDQKWRPYYLGNPVYAFLLMVLFQYGVALHEMESEKIA
AGEITLTDKREILREIWAKTKRQTLKDYVAFPLLAGPFAPWVFAGNLTAN
LMRNVWSYMIIFCGHFPEDVQEFSIEETKAETRGQWYFRQVLGSANLTGG
KLFHILSGNLSFQIEHHLFPDIPAFRHAEIAPKVREICERYGVPYNTGPL
PRQFASVVRKIVKFALPF
315445739YP_004078618.1 hypothetical protein Mspyr1_42230 [Mycobacterium gilvum Spyr1]MRAALAAMSVVAAGAVGGMGVAWAQPPVPSAGELTSELQQVLNTGTPTEV
RAAKLAGGDAAVPTADNIANRLNTYGGMINWRVENPVLNGDQLDAQIAVT
IPIWGTKTHNIYWVEQDGAWKLSNPSACVIARDVAGVDCTV
315445738YP_004078617.1 hypothetical protein Mspyr1_42220 [Mycobacterium gilvum Spyr1]MGDIIIGTEAVANGTVTRHQLQRWYRPIFTNIHAPRGPAPTLGDRAVGAW
LYSKRHGIVTGLAAAALHGSRWIDADVDIELIYKCPRPPSGIVARNDRID
PDEWQSIDGLPVATAARTAFDLGRYRPEHDALARLDALMAVRPYSVEDVL
LLTKRYKGARGVARLKALLPFVDGGAQSPRESWWRKLVLDSGFPPPRTQI
PVVDENGYHVRTLDFGWEGPNVAVEYDGDQHQSDRAQYLKDRRVMPALRR
LGWHVTTVVKEDDPVAVIQTLSAAMRARGWRGSIQIPRYAYTTRFRAEIA
SRQEKCE
315445737YP_004078616.1 formamidopyrimidine-DNA glycosylase [Mycobacterium gilvum Spyr1]MPEGDTVYRTAAKLRDALEGRELIRCDIRVPRYAAVDLSGQVVDEVLSRG
KHLFIRVGQASIHSHLKMDGAWVIGRVRVPTYKIRIVLETANSRASGVDL
GVLEVLDRATDMEAVEHLGPDLLGEDWSAEVAAANLVADPERPLAETLLD
QRVMAGVGNVFANELSFVFGLRPGTPVGELTDPLRVANRAQQMLWLNRLR
VNRTTTGNTRPGQDVWVYGRAGLPCRRCGTPIETDKNTERVTYWCPTCQR
315445736YP_004078615.1 ATP dependent helicase- Lhr family [Mycobacterium gilvum Spyr1]MPAKTDPLSRFSTLTREWFAGTFVEPTPAQAQAWNAISAGENTLVIAPTG
SGKTLAAFLWAIDGLAREPRAERGTRVLYVSPLKALAVDVERNLRTPLTG
ISRIAERNGEEPPAISVGVRSGDTTPSKRRELITKPPDILITTPESLFLM
LTSAARESLADIETVIVDEVHAVAATKRGAHLAVSLERLDAMLPKPAQRI
GLSATVRPPEEVARFLSGASPTTIVAPPAAKTFDLTVQVPVPDMANLENN
SIWPDVEERIVDLIEAHNSSIVFTNSRRLAERLTARINEIHAERTGIELG
AHNPGVAGGAPAHLMGSGQTYGAEPVLARAHHGSVSKEARADVEDALKSG
RLKAVVATSSLELGIDMGAVDLVIQVETPPSVASGLQRVGRAGHQVGEIS
QGVLFPKHRTDLIGCAVSVQRMLAGQIETMRVPANPLDVLAQHTVAASAL
EPINADAWFDTVRRSAPFATLPRSAFEATLDLLSGKYPSTEFAELRPRIV
YDRDNGMLTSRPGAQRLAVTSGGAIPDRGMFTVFLASSAESEKPSRVGEL
DEEMVYESRPGDVISLGATSWRITEITHDRVLVIPAPGEPARLPFWRGDG
VGRPVELGAAIGAFNGELARLDRPAFESRCRDVGFDDFATDNLWQLISEQ
REATSSVPSDTTLVVERFRDELGDWRVILHSPYGLRVHGPLALAVGKRLY
ERFGIDEKPTASDDGIIVRLPDTDDTAPGADIFVFDADEIEPLVTTEVSG
SALFASRFRECAARALLLPRRHPGKRSPLWHQRQRAAQLLDVARNYPDFP
IVLEAVRECLQDVYDVPALTALMDRIAQRRVRILEVETPTPSPFAASLLF
GYVGAFMYEGDSPLAERRAAALALDPTLLAELLGRVELRELLDPDVIANT
TRQLQHLTPERAARDAEGVADLLRLLGPLTVDEIAERCVQPDIGGWLEGL
LTSKRVVTLSFAGQTWWAAIEDIGRLRDGVGVAVPVGVPIAFLEPIVDPL
GELLSRYARTRGPFNTMEAATRFGLGVRVAADVLGRLTADGKLVRGEFTD
LPADSGGAEQWCDAEVLRILRRRSLAALRAQIEPVSTGAFGRFLPAWQMV
GADSASGVDGLASVIDQLAGVPIPASAVEPLILGQRVRDYQPGMLDELLA
SGEVLWSGAGSLSAADGWVSFHPADTAPLSLAPPGDLDLTDVHHQILAAL
AGGGAYFFRQLTLDGVSSESLKEALWQLIWAGYVGGDTFAPVRALLAGTK
GPGSRRAAAPSHRHRRPPRLSRYSLSTSSLSAHRDSDPTVAGRWSALPTA
EVDTTVRAHYQADQLLARHGVLTKGAVASENFRGNIPGGFAAMYKVLTTM
EDAGRCQRGYFVESLGGAQFATASTVDRLRSHADSIDDQQQKLRAVALAA
TDPANPYGAALPWPSRGADGDTAHRPGRKAGALVVLIDGELTWFVERGGR
SLLSFTDDAETANAAAAALAELVTRHRVPALLVERIDGVPVLESRESVMV
EALILAGFSRTPRGLRLR
315445735YP_004078614.1 ATP-dependent transcriptional regulator [Mycobacterium gilvum Spyr1MVAGDWRPHVPAVTMGRPRIADRVIPRPELVKRLGSAVGGDLVVLTAPAG
YGKTTAAALWDAEDDRQFAWARIDHLDDDPGHLLLHIATAVVRLGAGDEH
LLNYLRGPGREPEQLLPAVVRLLEEFGPIVVILDDVHKLSAPQSVSTLHA
LVDAAPLTTTVALLGRFLLPLDIARRRLAGNLVEVDQDALRLTAEETVAA
LESVRGPSDDATVATVIDLCEGWAAGVILTAMALRDGTAPEALAGRNNLV
VEYVVEEVIDRVDDDTRSFLLESAMLDRFTAEHLDAVLGRVDAAWMLEQL
ATSGNPFLISLDSQGDSFRYHHLFGDVLRARLRASEPARFRELASCAADL
LEREGDIDGALVHALEAGDRARAAALVGREAVRLGFDGRAGVLARRLGML
DARTFAEQPDAAVARAWLGVTTADAELIQRSLMLALHSDHGGPLADGTPS
VSVAVALISSLVGVGGVAEVIRHADTVRAAGDNLVNPWWGAATVMKGAAE
AMRGQGGRARLLLESALPVIEDLPGFHAAALAHLALLDLAAGDDEAAVER
CDAARTLADKYDLSDVVPMIVVYSTSAVMSARVGDVPAALHAVQITQTLL
ERLGNLSARTALLGHGLLAWTAAALQDRALLSRHLTAAERVRHREPDAVA
LVQRVERVKAMAVGGTRPLTAAELRLLPHLATHLSLQRIAEELVIGRETA
KSQATSIYRKLGVSSRGQAVSEAIRIGLLAD
315445734YP_004078613.1 hypothetical protein Mspyr1_42180 [Mycobacterium gilvum Spyr1]MSRRQARTYNQNHVARPHNGRRRISIYWTWSYPWEAQRDTASMSNRFSTL
TEVRNVVYPTYETPEFEADNFLQGIAGTLELFHRSTLTFQDLVGELTGHP
VAVFQRVDQAGYRQPIDDRILADTDTLMVFGLDHLDSGLDADRDEVDAIR
EWLRREDTCLLLAPHHDVGFTDDLAQRQVEFEHHGDRLVPRQQRFSRYTR
SLMRALGVPVHNIWGLRPALQPGTRDPLPLNRFQDYDEIDLLDSVSTLSF
HQHLPHYELTAPEGATLRVLARQAVDLTRPHPFTAAGDSEFTAVIWMPPD
GDRAGDILLIDSTHFTTLFGGTESLQNLWRNLTRMGCDR
315445733YP_004078612.1 dyp-type peroxidase family protein [Mycobacterium gilvum Spyr1]MTLDLDDIQHILLTRTPAITGRYEFLTFDRADGGRAWLTELLDRVQSASD
AVATMDASQRWITLAFTWTGLRALGVPDDALATFPDEFREGMAARADILG
DTGPNAPQNWVDGLAGDDVHAIAILFARDDDEHRRCVGEHDKLVARCDGV
RTVSYLDLNASPPFNYAHDHFGFRDRLSQPVIKGSGEEPTPGSGAPLEPG
EFILGYPDEFTATPEIPQPDELARNGSYMAYRRLQEHVGAFRSYLADHAG
TPDEQELLAAKFMGRWRSGAPLVLSPDVDDPELGADPLRNNNFNYKEMDP
FGYACPLGSHARRLNPRDTAHNMNRRRMIRRGATYGPALPDGAPEDGTDR
GIAAFIICASLVRQFEFAQNVWINDTAFHELGNEHDPICGTQDGTLDFTV
PKRPIRTVHKGIPAFTTLRGGAYFFLPGINALRYLAGGLR
315445732YP_004078611.1 hypothetical protein Mspyr1_42160 [Mycobacterium gilvum Spyr1]MADHTWTTPAAVAIPREGYFELERGRYGPLFPRTPACHGFSIIAKVKEGR
EEAVRAYGKQIEEAVAASPDVLEPLRLHYLRWILFDVGSGLHFQYQGIFD
TDFDKYTEDAVRLFSTTGITTVFTNLEGFPEDWQTNPDAFITFVREHQVP
SFLEYGEYPYVTALEIKKALRLKAAFSEMLDQMQ
315445731YP_004078610.1 hypothetical protein Mspyr1_42150 [Mycobacterium gilvum Spyr1]MHTIAVVMTPVVSLATAVAVAAPAAADCTTAGATTICSQGDVRGTNSGTG
PVGSSGPYVPYPCDVNYYNCDEWWGVDFDVDLDPGRPGIGGPGGPGGPGI
GGPGGPGRPGGGGGGRGGGGRR
315445730YP_004078609.1 hypothetical protein Mspyr1_42140 [Mycobacterium gilvum Spyr1]MSLRRLARAAAVLGCIGVLAAAPAAAQPPPNCTSADLTGTMTGVMAATTA
YLYTHPQVNEFFSSLQGRSPEERRAALEEFLAANPQVQAELQGIRQPMKD
FRNRCG
315445729YP_004078608.1 hypothetical protein Mspyr1_42130 [Mycobacterium gilvum Spyr1]MRRMLAAALGTGAALIAVTVPAQAQPAPPNCTAADLAGVATGVSAATSAY
LFTRPAVNEFFTSLFAMDAEQRKAAVTAYMDANPQVASELRGIRQPLADL
RHRCGFRHHPHHE
315445728YP_004078607.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAEARRRLSPDDRRNELLALGAEVFGQRPYDEVRIDEIAERAGVSRALMY
HYFPDKRAFFAAVVRAESERLFDATNTPAQPGQTLFTQVRAGVLAYLRYD
ELHPHGAWAAYMGMSRSDPVLRGIDDHDNDRQANRIIDRVTAGVEPLDSK
VERDLRAAVYGWLAFTFEMCRQRLMDASLDADYIGDLCAHALMDALARVP
GIPADLAEAVAPDRR
315445727YP_004078606.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MPVVGDVFGFSADILTRPPSDPGLGPVFEFRFLGARYVVAASAAAVAEVN
DERRFCKHVGPDIDALRIMGGDGLFTAYNDEPNWQRAHDLLMPAFSQQAM
RGYHSAMLDAADGLVARWDGKARTGASVDVPADATRVTLETIGQCAAGHS
FGCFDTEDPHPFVEHMVAGLKGSDWVGVLRETFLPNYFARRAERRVRRHA
VQMHRIADEIVSERLRDGLGHHDDLLELMLTSELDPANIRYQLINFLVAG
HETTSGALSFALYFLSRHPEVADRARAEVAEVWGDDERPEFELIAKLRYV
RRVLDEALRLQPTVPGYYREAREDTVLAGVHPMRQGDWVLAMTMALHRDP
QWGGDPDAFDPDRFAPDRVRARPAGLYKPFGTGPRSCIGRQFALHEAVLL
LAVLLRRYDLVPEPGYQLQVAQRLTLMPKDFRLTLRRRRSE
315445726YP_004078605.1 short-chain alcohol dehydrogenase [Mycobacterium gilvum Spyr1]MELAGRTAIVTGAASGIGAALATELARRGVSVVIGDLDDDGAHATASAIR
ADGGAAAALRADATSVADIEALITLASREFTPVDIYVANAGVIGKPGLGT
ESDWDVILDVNLRAHVRAARLLVPHWQSVGSGYFVSVASAAGLLTQLGAA
GYAVSKHAAVGFAEWLAVTYGDDGIGVSCVCPLGVETPLLQGIRGIDDPD
AKLGASSIEQSAGVISAADVATVTVEAIREERFLVLPHAELLEMYRRKCG
DYDRWISGMRRYQRTLRSL
315445725YP_004078604.1 delta-1-piperideine-6-carboxylate dehydrogenase [Mycobacterium gilvMSTAVTALPTAEELRTRVRDALTAVGARTDLGEPNAHGLPASTPITGDVL
FTVPASSAADVDAAVGEAADAFSTWRTTPAPVRGALVARLGQLLVEHKSA
LASLVTIEAGKITSEALGEVQEMIDICEFAVGLSRQLYGRTIASERPGHR
LMENWHPLGVVGVITAFNFPVAVWAWNTAIALVCGDTVVWKPSELTPLTA
VACQALLERACADVGAPAAVGRLVLGEREVGEKLVDDPRVSLVSATGSVR
MGREVGPRVAARFGRVLLELGGNNAAVVTPAADLDLAVRGIVFSAAGTAG
QRCTTLRRLIVHSSIADELVSRIVKAYEQLPVGDPFRGGTLVGPLIHTRA
YRDMVGALQQAQAEGGEVSGGERVDVGDEGAFYVTPAVVRMPEQSTVVHQ
ETFAPILYVLTYDTLDEAIALNNAVPQGLSSSIFTLDMREAERFLAADGS
DCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDSWKAYMRRATNTVNY
SSDLPLAQGVEFG
315445724YP_004078603.1 hypothetical protein Mspyr1_42080 [Mycobacterium gilvum Spyr1]MAEFVESCELRAQFAAGLSRMYGAEVPAYHTLVEVSSLINTAFPGALRLG
SLERVTAERHGAIRVGSAAELAQVADLFSAFGMYPVGFYDLRDAASPIPV
VSTAFRPIGQEELARNPFRVFTSMLTVADGRFFSADLSTRVQRFLDSRQL
FDPALIAAAQRIAAAGGCPARDASGFVAAAVSAFALSREPIDRAWYDELS
AVSAVAADIAGVTSTHINHLTPRVLDIDALQQAMTERGITMIDRIQGPPR
VDGPQVLLRQTSFRALAEPRRFRSPSGEVTDGTLRVRFGEVEQRGVALTR
AGRERYDAAMSAPDPAAVWQRHFPATDAEMAASGLAYYIGGDPSRPVVYE
DFLPASAAGIFRSNLDTASAAVQGGDTTEYCQDWMAGRIGHHIHDPYDLY
EKVAHS
315445723YP_004078602.1 AsnC family transcriptional regulator [Mycobacterium gilvum Spyr1]MTVPDDPQPPAPLDEIDRVLARELVADGRATLAHLAATAGLSVSAVQSRV
RRLESRGIVTGYTARIDPEALGSKLSAFVAITPLDPSQPDDAPARLEHIP
EIEACYSVAGEDNYMLIVHVESARALEGLLQKIRTAADVKTRSTIILHKF
YSERRYVPE
315445722YP_004078601.1 L-lysine 6-transaminase [Mycobacterium gilvum Spyr1]MIVPADVRTVLSRSILADGLDLVLDLERSHGSYLVDARTGRGYLDMFTFF
ASSALGMNHPALADDPDFRAELAAAAVNKPSNSDVYSVPMARFVDTFSRV
LGDPALPHLFFVDGGALAVENALKVAFDWKSRLNEAQGRSPDLGTKVLHL
RGAFHGRSGYTMSLTNTDPNKVARFPKFDWPRIDAPSVRSGANIEALEAE
SLRQARAAFEAHPHDIACFIAEPIQGEGGDRHLRPEFFAAMRELCDEFDA
LLIFDEVQTGCGITGTAWAYQQLGVLPDVVAFGKKTQVCGVMAGTRVDEV
PDNVFRTSSRINSTWGGNLVDMVRARRILEVIERDGLFDNAAQRGLHLRD
GLAGLAVEFPGLVRDVRGRGLMCAFSMPSARQRDELLARLWECGVIMLGC
GTDSVRFRPALTVNDDEIDAALTAVAAVLRTMAVPQAG
315445721YP_004078600.1 Holliday junction resolvase-like endonuclease [Mycobacterium gilvumMTTLRWRLYAALAIAAGATAHLSGAGGLWTVLAGLLAPVLVVAAPSFVRS
VVAGAATPGPRENPVDADMSGTEFEDYVARIARTCGVPVIMTSMTGDWGV
DLIVGHRPHRLAVQCKRLSRPVGAGAVQEVVAGAPMQDCTQTMVVTNHEF
TPAARKLAELHGCTLVGGADLPRLRSTIRRLTRPAEPPSSSAPRPPP
315445720YP_004078599.1 hypothetical protein Mspyr1_42040 [Mycobacterium gilvum Spyr1]MADLSRNTELRRSTGVGDPGVRDAIRTGVGISVAALVFLFVADMWNGTCT
GSLAQAIGCAPSQQAALTLGAPAILLAGGIWSMARGFRVRAGHSAMAWQV
AGWTLFTLAVACAVLSLPSLPGR
315445719YP_004078598.1 hypothetical protein Mspyr1_42030 [Mycobacterium gilvum Spyr1]MRGPSDPVDHVRTTRPHAGESMKDNKIMPGLVVIGLSLVIFVAMLSAFAT
SHHDVGVMLGAIAAAGFVLGGGWLFIEHQRVRRLEERWYAEHPGAWRQRP
NS
315445718YP_004078597.1 hypothetical protein Mspyr1_42020 [Mycobacterium gilvum Spyr1]MRRPFVGSEALASGALTRSALRWNYRRVFPDVYIPVDVQPTLYDLTVAAW
LWSGRRGVIAGAAASALHGARWVAPTVPIEMIWQNGRPPPGLVVRNERID
GDETCVRGGMLVTTPERTAFDLARHLRRDQAVARLDALANATEVKAVDVL
ALAERHPAARGIRRAVAALSLMDGGAQSPRETWLRLLLVDEWLDPLRTQV
EVGDGRTTVHLDLGYDEPRIGLEYEGSHHSEDRRTYVHDIGRTEFIERHG
WVAIKVVKEHSPELIRFRVREAFARRGVTPRLRSGSRNRQRPRP
315445717YP_004078596.1 CsbD-like protein [Mycobacterium gilvum Spyr1]MTEKNSGPQEGIKGVVEDVKGKAKETIGTVAGRDDMVQEGKAQQDKADAQ
REVAEKEAEAESARAGAKAAEKRQEANQ
315445716YP_004078595.1 hypothetical protein Mspyr1_42000 [Mycobacterium gilvum Spyr1]MDQNAKPLRRILVIAATVLAIMILIGVAIYAGAFLLLAPMMQ
315445715YP_004078594.1 hypothetical protein Mspyr1_41990 [Mycobacterium gilvum Spyr1]MADVASHSNGQRLSPQSVELRVAAALENLAVLRTLVAAIGTFEDLDFDAV
ADLRLAVDEACTRLIRSALPDSTLLVVVDPQPDALVVHASTTCDSTDILA
PGSFSWHVLSSLTDEVTTFSDGQAAADGEVFGISMTTRRASSLQ
315445714YP_004078593.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium gilvum SMTRSSSQGSSRSNSEYSDVADMFRELAELEEGSAAFQRQRDRIVERCLPL
ADHIARRFDGRGEPRDDLVQVARVGLVNAVIRFDVNAGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGAATAELSQRLGRAPTPSELAAE
LEMDRDEVVEGLVAGSSYNTLSIDSGGGSGNEDAPAIADTLGDVDLTLDQ
IENREALRPLLAALPERERTVLVLRFFESMTQTQIAERVGISQMHVSRLL
AKSLTRLRDQLE
315445713YP_004078592.1 STAS domain-containing protein [Mycobacterium gilvum Spyr1]MPHVPDPPPAPVPDSLICHTARFDTTWTDPATAIVAGKGEVDAANGIRFV
DYALRHAEQTQWLVIDLSGLSFFSTAGFSALHTLNVQCVGEDIRWALVPG
TAVHRVLRICDPDSALPICPDVPAALVAVQEDPPRSFELITKTR
315445712YP_004078591.1 MobA-like protein [Mycobacterium gilvum Spyr1]MRQRHSTIGVVLAAGAGTRFGMPKVLADAGEWLRLSVAALSDGGCDDVVV
VLGAAVVDVPSPARAVVADDWDAGLSASVRAGIQAASEADFVVVTTVDTP
DVGAAAVQRVLSAAQKSASGLARALYGGRPGHPVVIARRHLPQLLDSLSG
DDGAGPFLKARADVVAVECGDLSSGRDIDTR
315445711YP_004078590.1 hypothetical protein Mspyr1_41950 [Mycobacterium gilvum Spyr1]MTRFSRFLATPLLSAAIFGATLGMAGTATAMGVNESNMAPDTHSRTYYQL
LTESRYGF
315445710YP_004078589.1 hypothetical protein Mspyr1_41940 [Mycobacterium gilvum Spyr1]MEPVEINAGAWYLRALRADDRVDDRPGLADLGEHDAGYVNRRAAHWDSGT
LYSWAICEPTTGELLAEVTLDPATGAIATRSRPGHEQAAGTGADAVGRFA
AAMLG
315445709YP_004078588.1 acetyl/propionyl-CoA carboxylase subunit alpha [Mycobacterium gilvuMASHASSKISKVLVANRGEIAVRVIRAAKDAGLQSVAVYAEPDADAPHVR
LADEAFALGGQTSAESYLVFEKLLDAAAKSGANAIHPGYGFLSENADFAQ
AVLDAGLIWIGPSPQSIRDLGDKVTARHIAARANAPLVPGTPDPVKDADE
VVAFAKEYGVPVAIKAAFGGGGRGMKVARTIEEIPELFDSATREAVAAFG
RGECFVERYLDKPRHVEAQVIADTHGNVVVAGTRDCSLQRRFQKLVEEAP
APFLTDAQRKEIHESAKRICKEAGYYGAGTVEYLVGQDGLISFLEVNTRL
QVEHPVTEETSGIDLVLQQFKIANGEALDITEDPTPRGHAFEFRINGEDA
GRGFLPAPGPVTKFEPPTGPGVRMDSGVESGSVIGGQFDSMLAKLIVVGA
TREEALARSRRALAEFNVEGLATVIPFHRAVTADPAFIGDGETFTVHTRW
IETEWNNTVEPFTGGDPIDEEDTIPRQTVVVEVGGRRLEVSLPGDLAVGG
GAPAHGAIRKKPKPRKRGGGGGAAASGDAVTAPMQGTVVKVAVEEGQTVA
AGDLVVVLEAMKMENPVTAHKDGVVTGLSVEPGAAITQGTVIAELKDAE
315445708YP_004078587.1 diguanylate cyclase domain-containing protein [Mycobacterium gilvumMPRQLSVVAGLRHWWRQADHYDWFADYLSARGLVGLARVITAVTAAGLAL
VAATVMLSPGGPTGTLDVTLGWAAVALAFGCAIVRWSIWPSKRQSVVLIL
ALNLAIALFCQVQTDQLIGVVGATAFATTGISIACLHSAKYMLYNVVVAT
YIGVLQAVRAMGETDGHLILAALGLVLIINISVPFSVQSLVHALGGDVVQ
SDRDPLTGLLHRRALFRQINALLLSHREHADFLAVTMIDLDKFKVLNDTY
GHSAGDDALVAVGEALLTAANGRALVGRVGGEEFMVAELCETAHDTGLSE
RLRAAIAALPQHITGSVGTAVASINDVPTDDFQDLVVTLFRRSDRAMYEA
KRAGGNQIRHTVIDLPAIPVSGADNLPAGNRPARRTSD
315445707YP_004078586.1 hypothetical protein Mspyr1_41910 [Mycobacterium gilvum Spyr1]MSKTTEGWVRVRKVAAWSAVIAAPTALLVFTAGTASADRIAPDRTVNSGQ
GTVSKDATFGEVRGADDYLHAQGEIRDSMIAVPGRIDGTRARGFRPSWSG
GPSMGTW
315445706YP_004078585.1 SufE protein probably involved in Fe-S center assembly [MycobacteriMSMPAALAEVVSDFKEVEGQDKLALLLEFADELPPLPAELEEAAMEPVPE
CQSPLFLHVDAGDRGHVRLFFSAPAEAPTTRGFAAILATGLDGQSAADIL
AVPDDFYTDLGLAKLISPLRLRGMSAMLTRIKKRLT
315445705YP_004078584.1 rhodanese-related sulfurtransferase [Mycobacterium gilvum Spyr1]MPLPADPSPALQSYAHPERLVTADWLSGNLGRPGLAIVESDEDVLLYDTG
HIPGAVKIDWHTDLNDPNVRDYITGEQFADLMNRKGISRDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLDGGRSLWISDGRDTTLDVPTKQTTGYPV
VERNDAPIRAFKEDVLTVLGTEPLIDVRSPQEYTGERTHMPDYPEEGALR
GGHIPTAVSIPWAKAALDNGKFRSRAELDELYGFLSERDNPETVVYCRIG
ERSSHTWFVLTHLLGMPGVRNYDGSWTEWGNAVRVPVAVGEEPGEAPGSA
R
315445704YP_004078583.1 acyltransferase [Mycobacterium gilvum Spyr1]MVTRVDQWREASARRRRRAERANHRLDVQGLRAVAVLGVFAHFLTGWPRG
GFVGIDIFFVIAGFFVTESLLRTAADTGSPSLRTFYVGRVRRILPAATAV
LILTVAATALVMPDDLRDVGVDALFAFFFVANWHFAASGVDAASAAESAS
PLLHYWPLAVEEQFFIVWPVLILGITAIAVRKAWTDERWRAHLAVAVGVV
VIASLAWAAVQTASSPSWAYFDTFARVWELGVGALLALAVGTLSRIPDPI
RPILSWTGLTLIGAAFVLVDGGSGFPVPWALLPVAGAALVIAAGVGRQPE
LQGFLRNRVSTYLGDISFALYLVHWPVIVLLAAVMDHSVFYYASVVTLAF
GLALAVHHFVENPARDATVQGLRQAREDRRHGLHHTELSTKIAGVAALIL
ITFSVISYAMSPEAIDDPAPIAPTAPSP
315445703YP_004078582.1 hypothetical protein Mspyr1_41870 [Mycobacterium gilvum Spyr1]MRTKLVSATALACALLGGALGTATQAGAHADDALIQYKEPDAMWVMPDLK
GKVLFAAEQEVEADVENMPLTFNVVAPNHAPVYNLENWVVCGESPKAGAA
LSQTTKKITLLVERPGAEHCGA
315445702YP_004078581.1 hypothetical protein Mspyr1_41860 [Mycobacterium gilvum Spyr1]MERKGFKKIAAGTASFGMLLTGVLVAAPTAGAQTSTWTMPALRGEVLERA
VNSVEGAAGSAPIRFNIYDSVNNQVVYNYTNWVVCGQSPRAEATVKVGAK
PQTVTFALKRRQSGC
315445701YP_004078580.1 MAF protein [Mycobacterium gilvum Spyr1]MIRFVLGSASQGRLGVLRQAGIDPEVVVSDVDEDALLASLDPELPPEAVV
AKLANAKALSVAAALPQALLADCVVLGCDSMLYLDGRLSGKPGSADAARR
QWESMAGTTGHLLTGHALLRLRDGVITHTEGDTGSTAVHFGTPSGAELTR
YVDSGEPLHVAGGFTLDGLGGWFIDRIDGDPSNVIGVSLPLVQRLISRTG
LSISEFWTR
315445700YP_004078579.1 hypothetical protein Mspyr1_41840 [Mycobacterium gilvum Spyr1]MNHDADIVEVSDPRDMTIDDPPAPDPHFQVVKGDPSAEEIAALVAVLASA
GGGAAADPGPQELNLWGHPVDKLRYDTTSWQRTTLWERMHMRK
315445699YP_004078578.1 acetyl-CoA carboxylase- carboxyl transferase subunit alpha [MycobacMTSVTEPEASHEIDIHTTAGKLADLRKRAEEAQHPVGEAAIEKVHAKGKL
TARERILALLDEGSFVELDALAKHRSKNFGLEKNRPTGDGVVTGYGTIDG
RDVCVFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGINDGAGARI
QEGVVSLGLYSKIFHNNIKASGVIPQISLIMGAAAGGHVYSPALTDFVIM
VDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTVHYVASDEQD
ALDYVRDLLSYLPPNNYAEPPRYPAPLSGPIEDSLTDEDLELDTLIPDSP
NQPYDMHEVITRILDDDEFLEVQAGYAGNIVVGFGRVDGRPVGIVANQPT
QFAGCLDINASEKAARFIRTCDCYNIPIVLLVDVPGFLPGTGQEYNGIIR
RGAKLLYAYGEATVAKVTVITRKAYGGAYCVMGSKDMGADVVVAWPTAQI
AVMGASGAVGFVYRGQLKEAAANGEDVDALRLKLQQEYEDTLVNPYIAAE
RGYVDAVIPPSHTRGYVATALKLLERKVVQTPPKKHGNIPL
315445698YP_004078577.1 hypothetical protein Mspyr1_41820 [Mycobacterium gilvum Spyr1]MNAIATKFKVTAAAAAIAASAAVAPVAANAAPAVELPAAPAIGHLAEQPA
GLFGVFVVQFTGAVTRTSTYWTRLTILNYQSKLEARPDSIFAPFYQARIE
RLNAQLARYGEVEMTSCVGGRSTSIVAGSYGGVTRGTC
315445697YP_004078576.1 hypothetical protein Mspyr1_41810 [Mycobacterium gilvum Spyr1]MVFLILGLGVWVAVGAFQAKSNLEAARSHAQDAKEALLDGNTEAASQSAD
EALVSARDARDATHSLAWNIASGLPWLGSPFKTGQQVTEVVLGLASDVLR
PAADVGLTIAPDRLYRDGRVDVELLRSQEAQLSELAASATRLNGDAAAIT
DPRYVSLLSDARNQLQSQISSVASIIENTALAARLAPSMMGVDGPRTYFM
GFQTPAEARGTGGLLGGYGILRFDNGAPTVDTLAPNTGLEEAVAPVDFGF
EYDQQYGFNQPFFDFRNSNISPHFPYAAQIWKGMWFEQTGQEVDGVIAID
PIALSYILGAVGPVSTPAGEVISKENVVELTLSTAYKRFSTDQVARKQYL
QDIANAVVRKMTGPVGSPRQLLDALGRGVSERRIAVWSSNPEDQKLLEET
PLAHVLPDDSAPYAGVVINNLGGNKLDYYLKTQIEYAADECRGETRASTV
TVKLTNAVPNEPLPDYVAGSAGLSPELGFTVPAGTNITSVRLFATKGSEL
SSAILNGERVPAIKYTERGHPVFEVQVIITPGQTADISFQMSEPTAPGAP
RVPIQPLVDSTKPVISVPECRDRH
315445696YP_004078575.1 capsular exopolysaccharide biosynthesis protein [Mycobacterium gilvMNFQDFVKLLRSRWVTVGVTLAATVLGAVAVSLLTTPQYQASTRLFVSTA
AGSSLADTYQGNRFSQDRVVSYAELLTGETLAQRTIDKLGLNMSASALRA
NVSASAKPNTVLIDVLVLDESPVRARDVANALSEEFVSLVRELEAPADGS
DPDSRVVVEQRASIPQQPVVPKTFRNVVTGLVLGLVLGIGLAVLRDVVDN
TVKTKEKLEEITGTGMVGSIPLDRARRNQPAISYEQDNSPIAEAFRKLRT
NLQFLAVDNPPRVIVVTSSMPHEGKSTTAINIALALAEAEHSVVLVDGDM
RRAMLHKYLDLVGTVGFSTVLSGAAPIAEALQKTRFPGLTVLAAGAIPPN
PSELLGSQAARKLLNELRGQFDYVIVDSTPLLAVTDAAILAAGADGVLIM
ARFGQTKREHLTHAVASLESVGAPLLGAVFTMTPSRGGSSYSYSYSYGYY
GEDVGKRPSRTTPPPVEVLARRSTKITSDGGVSASMQPPEGAARPGKRRK
REAPE
315445695YP_004078574.1 transposase [Mycobacterium gilvum Spyr1]MPRKYDDEFKTRAVRLVTDHAEEYDSRTACISAAAKRLGVSYESLRRWVN
QAEVDTGVRDGVPTDTVRELRELKRKNRELEETIEILKAATSFFVRESDP
RHH
315445694YP_004078573.1 transposase [Mycobacterium gilvum Spyr1]MLTEHGCQIAPRTFYAWLTRPPSARTLWDTVITEVLAGFYEPDEHGRRKP
ESLYGATKMWAHLQRQGIAVARCTVERLMRANGWRGVTRRRKVRTTIADP
AAARAADLVKRQFRVPAPNVLLVADFTYVRMSNGAFVYTAFAIDAFAGRI
VGWTCSASKEDRFVRQAIRHAAQLRISEGNPLLGNTIHHSDAGSQYTSLR
FGETLALSGLVASIGTVGDAFDNALAETTIGLYKTEAVRDDSPFRRGPLH
RLADVELLTAEWVHWYNTDRLMHRLGRIPPTEYETIHYATNTAQPEAAHQ
315445693YP_004078572.1 site-specific recombinase XerD [Mycobacterium gilvum Spyr1]MTIQHQLRLQAGTDVAWVLSGPGCGKYALVNEYLRYLADRNYSPRTLRAY
GYDLLAFCRWLGSVDVELSSVTTETVLDFMRHCRQTPIAGRPTNVVSMTG
TRLDRYSSTTINHRLAALTGLFTFRELRDPGLRTPIPSGREARRVSAEER
NGLLGHLVRPKRRSALRLREPRRLPRALNRRETAELLSSLRTWRDRALAG
LMLLSGLRSGELLTLDVTDVDIGARWVKVMGKGAKERRVPLDVEVAGLIQ
TYLLVERPESDSNRLFLVAKGPHRGQPLTAAGLRTIFRYHRIKSGVLAGH
PHALRHTFGTAMAEAGVDLAVMQALLGHAHIDTTARYIHLAPTHVKAEYD
AARTRLRSHT
315445692YP_004078571.1 site-specific recombinase XerD [Mycobacterium gilvum Spyr1]MLPEHDYAPTPETPAQIYAAYLVHLQRRDRGNTAYAQAARSFLRRWPRVQ
SWADIPLDEQLAANCSTRPFVTFLMVSRRLQPGYDYLVHRKLSSLWHELT
DSCLQPDLDQFISAALELGFTERVASAIGSQIIARLLIQTGRPLTGLRES
DLQELLHACHVRQERTGRGAKHYRSTTHSARQILFHLGILDTQARPAVTA
LTLEQRMVDVPVALRPAFVAYLNRKYATCVPKTVSSLATRLAHFGRYLAA
ADPSLTSLNQLDRRRHIEPFITSLTTATNSVTGEPITVADRIRRIHAVGN
FLAEITEWGWDDAPPRRLIFRTDLPRPPRCLPRYLPVDSDRKLTAALAKS
PYRLAADALLVQRACGLRIGELLDLELDCIHEIPGQGSWLKVPLGKLNSE
RMIPVNDEVLTLVDRITTTRSSGRPMIHPRTGAPADFLFTHHGKRLSQNA
VREELNRAAQAASLGHITPHQLRHTYATALINAGVSLQALMALLGHVSTQ
MSLRYAHLFDHTVRTEYERALDLAKSHIGALPKTAVGLPITDITGTGWKD
TPAIKSRLAGGYCLRAPAQGSCPYANICEHCPSFHTDSTHLAVLAAQRID
AQDLAADAEKRGWIDEAERHHNLVSRLDALITGSASA
315445691YP_004078570.1 hypothetical protein Mspyr1_41730 [Mycobacterium gilvum Spyr1]MNEPALLRVERVCAELATSGQPITFTTVAEHAQISRATLYRDHQLRAIVD
EHRTRQTDARTLTGLATEVAHLRTAVEALAAEVKRHEEQIRKLTKPPRR
315445690YP_004078569.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MKNIATAARVIVSADGHGVVSHAGMAMLRELADRTGLSAQVTAALADTYR
GPWVYAPGEVFADLAAAVADGADCIDAVSQLCGDREHAFGAKASTTTMWR
LIDQRIDAAHLPAVRAARAAARVAAWEAGAAPISGDWLHIDIDATLVIDH
SDNKHGATPTWKKTFGHHPLLAFLDRPEIAGGEALAGLLRTGNAGSNTAS
DHIIVLAQALAALPPGWRPDPNRDQDVPRPQVLVRCDTAGATHRFAAACR
TAGVGFSFGYPVDARVQDAVDTLNLGACWYPAIEGAGGLRDGAWVAEATD
LVSLDSWPPGTRLILRKERPHPGAQLRFTDADGMRVTAFITDTPPGVVPG
QVAGLELRHRQHARVEDRIRELKATGLRNLPCHGFWANAAWLEIALAAAD
LVTWCRLIGFRTHPGLARAEIATFRYRVLHVAARITRSARQVRLRIDATW
RWAAQIATAWQKIRTAFG
315445689YP_004078568.1 methyltransferase family protein [Mycobacterium gilvum Spyr1]MLPKEPVESYHDLVRHDVSSVIPENVGRILDFGGGIGATSVALKRKGRAT
YVVVADQVGGQLSEVDRAYRGNLEDEDFISKVVNESGPFDCILLLDILEH
LYDPWRTVRQLHDALVPNGTIIASIPNVNYHGLLMPLFLRGRYVLQDSGI
LDRTHIRWFARHGAVELMSSPGLAVEHVSPNIFTKRERRLNQLSFGKLGR
FVALQYVIRARRVD
315445688YP_004078567.1 transposase [Mycobacterium gilvum Spyr1]MLTVVHDAIEANESTGGAGRSLLDEIVRDGARQMLAAALKAEVAAYVAQF
ADQLDEKGHRLVVRNGYHQAREVLTAAGAVEVKAPRVNDKRVDPDTGERK
RFSSAILPAWARKSPQMSEVLPLLYLHGLSTSDFTPALEQFLGSGAGLSA
TTITRLTSQWQDEARAFAARDLSGTDYVYLWVDGIHLKVRLDQEKLCLLV
MLGVRADGRKELVAITDGYRESTESWADLLRDCKRRGMTAPVLAVGDGAL
GFWKAVREVFPATKEQRCWFHKQANVLAALPKSAHASALSALKEIYNAED
IDKAQFAVKAFTVDFGAKYPKAVAKITDDLDTLLEFYHYPAEHWIHLRTT
NPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRAVNAPHLV
ALVRAGAVFHKGKLLERPTEITPPTPPSDGDQQAGTEVA
315445687YP_004078566.1 hypothetical protein Mspyr1_41650 [Mycobacterium gilvum Spyr1]MNEPALLRVERVCAELATSGQPITFTTVAEHAQISRATLYRDHQLRAIVD
EHRTRQTDARTLTGLATEVAHLRTAVEALAAEVKRHEEQIRKLTKPPRR
315445686YP_004078565.1 site-specific recombinase XerD [Mycobacterium gilvum Spyr1]MLPEHDYAPTPETPAQIYAAYLVHLQRRDRGNTAYAQAARSFLRRWPRVQ
SWADIPLDEQLAANCSTRPFVTFLMVSRRLQPGYDYLVHRKLSSLWHELT
DSCLQPDLDQFISAALELGFTERVASAIGSQIIARLLIQTGRPLTGLRES
DLQELLHACHVRQERTGRGAKHYRSTTHSARQILFHLGILDTQARPAVTA
LTLEQRMVDVPVALRPAFVAYLNRKYATCVPKTVSSLATRLAHFGRYLAA
ADPSLTSLNQLDRRRHIEPFITSLTTATNSVTGEPITVADRIRRIHAVGN
FLAEITEWGWDDAPPRRLIFRTDLPRPPRCLPRYLPVDSDRKLTAALAKS
PYRLAADALLVQRACGLRIGELLDLELDCIHEIPGQGSWLKVPLGKLNSE
RMIPVNDEVLTLVDRITTTRSSGRPMIHPRTGAPADFLFTHHGKRLSQNA
VREELNRAAQAASLGHITPHQLRHTYATALINAGVSLQALMALLGHVSTQ
MSLRYAHLFDHTVRTEYERALDLAKSHIGALPKTAVGLPITDITGTGWKD
TPAIKSRLAGGYCLRAPAQGSCPYANICEHCPSFHTDSTHLAVLAAQRID
AQDLAADAEKRGWIDEAERHHNLVSRLDALITGSASA
315445685YP_004078564.1 site-specific recombinase XerD [Mycobacterium gilvum Spyr1]MTIQHQLRLQAGTDVAWVLSGPGCGKYALVNEYLRYLADRNYSPRTLRAY
GYDLLAFCRWLGSVDVELSSVTTETVLDFMRHCRQTPIAGRPTNVVSMTG
TRLDRYSSTTINHRLAALTGLFTFRELRDPGLRTPIPSGREARRVSAEER
NGLLGHLVRPKRRSALRLREPRRLPRALNRRETAELLSSLRTWRDRALAG
LMLLSGLRSGELLTLDVTDVDIGARWVKVMGKGAKERRVPLDVEVAGLIQ
TYLLVERPESDSNRLFLVAKGPHRGQPLTAAGLRTIFRYHRIKSGVLAGH
PHALRHTFGTAMAEAGVDLAVMQALLGHAHIDTTARYIHLAPTHVKAEYD
AARTRLRSHT
315445684YP_004078563.1 transposase [Mycobacterium gilvum Spyr1]MPKEQSPGKPTTRRYTPEEKASAVRMVRALRAELGTDHGTVQRVARQLGY
GIESVRSWVRQADIDDGHTPGMSTTESARVKDLEQEIRELKRANEILKRA
ASFFGAELDRQHKK
315445683YP_004078562.1 methyltransferase family protein [Mycobacterium gilvum Spyr1]MGVTYQDVIAYTRAKYGGTSFKRTMTLGHQDLYLHKSELKALSSHHFAVT
GGAPDCLANYRWGDYADNYLRECLGVTDLTVIDASEYEGADTIHDMNQPI
PDTLRDQFDVVIDCGSLEHIFNVPVALKNLAAMVKVGGTIFITTPANNLM
GHGFYQFSPELMFRVFSEENGFELRRVALVEAAFPSVELTRNNKVYRVTD
PQDVHKRVGLQSKRPTMMMVEALKVNDVEMFATPPFQSDYVSAWTATEPV
KSRSPMRQLAKGALDALPRGVRGQLVGLKQKRTFSLKNDRYFRREPQDRE
IL
315445682YP_004078561.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MFVRKVRTASGAVAVQVMRKDGRRDVLVEHIGSAHTDAELGVLLERARQV
ASGDQDVLDFEVPARAQRVADVADWRHGTLTLPAGVPKGVVVAPGRTAAT
SSRLLYDVIGGIYDWIGFDVVADAVFRDLVIARIVEPTSKMDSLRVLADL
GAEPMSYKTIQRHLAKVNTGNYRDAIATKCFTHAVDRGALSLLLYDVTTL
YFEAENEDDLRKVGYSKERRVDPQIVVGLLVDRTGFPLEIGCFEGNTAET
TTLVPIITAFAQRHDLGDTPIVVAADAGMLSATNLAALDEAGLGFIVGSR
SVKAPIDLASHFHWNGDVFTDGQIIDTVTPRHAKSIVNDTNKRAEPVWNA
DTHAGAWRAIWAYSAKRARRDQKTLHAQEERAKAIVSGERAAKSTRFVKT
TAGGRALDEASLARAQSLVGLKGYVTNLGVEVMAASEVIAKYHDLWHVER
SFRMSKTDLEARPMFHRTREAIEAHLTIVFTALAVAHCIQERSGLAIANV
IKQLRPLRSATIVINGASQAFPPEVPAPQREILAALGIKVAY
315445681YP_004078560.1 transposase [Mycobacterium gilvum Spyr1]MATGKDEDLQLDQVVSTREMAEALRASGAVDDLLAQIDTGEVALTGEGGL
LPGLIKLALERGLAAELTDHLGYEKGEPAGRGLPNARNGSSAKTVQTEAG
PVPLDVPRDREGSFTPRLVPKGQRRIGGLDDMIVSLYAGGMTLRDIQFHL
QSTIGTEVSHETISKIVDEISEAVLSWQHRPLDALYPVIYLDAIVVKVKD
GGHTRNKAAHIAVGVDMAGIKHVLGIWVQQNEGASFWASVCADLANRGVR
DVLIVCCDGLTGFPEAIAATWSQAAIQTCVVHLIRNALRFVSYSDRKTVA
AALKPIYTAPNAEAARAELDAFTASEMGKKNPTVTRVFDRAWEQFTPFLA
FPPELRRVIYTTNSIESLNYQLRKVTKTRGQFPNDAAVVKLLWLAICNIE
DKRAAERAKERGQKRCRTAPGRLVEGQVVTNWKKALEQLALVYPDRVEPY
L
315445680YP_004078559.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MFVRKVRTASGAVAVQVMRKDGRRDVLVEHIGSAHTDAELGVLLERARQV
ASGDQDVLDFEVPARAQRVADVADWRHGTLTLPAGVPKGVVVAPGRTAAT
SSRLLYDVIGGIYDWIGFDVVADAVFRDLVIARIVEPTSKMDSLRVLADL
GAEPMSYKTIQRHLAKVNTGNYRDAIATKCFTHAVDRGALSLLLYDVTTL
YFEAENEDDLRKVGYSKERRVDPQIVVGLLVDRTGFPLEIGCFEGNTAET
TTLVPIITAFAQRHDLGDTPIVVAADAGMLSATNLAALDEAGLGFIVGSR
SVKAPIDLASHFHWNGDVFTDGQIIDTVTPRHAKSIVNDTNKRAEPVWNA
DTHAGAWRAIWAYSAKRARRDQKTLHAQEERAKAIVSGERAAKSTRFVKT
TAGGRALDEASLARAQSLVGLKGYVTNLGVEVMAASEVIAKYHDLWHVER
SFRMSKTDLEARPMFHRTREAIEAHLTIVFTALAVAHCIQERSGLAIANV
IKQLRPLRSATIVINGASQAFPPEVPAPQREILAALGIKVAY
315445679YP_004078558.1 O-antigen polymerase [Mycobacterium gilvum Spyr1]MDASNVQPHASSHTSAPPSGPFLEGASPTFAGHVRQPAVALAVFLSCFLL
SAFVVDSPTVSAVLIGVVGCVVVYLTGPQRMAGLALFAAFASLPAGIPVG
KILGPTIVYVHEVLVLLAIACLILIVRPRFSTFALPLVFVLTISVATTIG
LVSGRDLNRVVGEAKLLLVMTAGYVLAFLIVRAGLVMQAVRVMAIVLWFS
ATMILLSSLTGIILAGRNESLTAATGTGAVRILTATQTPALAILTALIAY
SIIGRVQRLTWLKLGAPALAIIFFGFSRNSLLALAVAAIAASLFSLNWRS
VKRLLIMLFYGVVLAVVASVLLLGVQGASSSGWLIEQSTAFTNRVFGGVS
GSALATDESAQYRLRETTYLIEAISEAPFLGHGFGYAYQPPIVAEPDSFE
VIDGPFYAHNFYLWLFAKAGLLGMLGFLWLAVTPVIRAAQTPTIEAKVSA
VVASSLLVICVVNPLPLGPSNSLALGLALGSALAAIRPRGVLSPTTSS
315445678YP_004078557.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MGRVKSYIRPRSGDAQALWVSTSLTTRGGIATFVRNMQDTDFWVDWNIRH
IATHCDGSALDRVRIFALGYFKFVFQILAWYPDLVHVHSSSYGSFARKCI
LSWTAIILRVPVIIHVHGSEFHNFFDNAQPPIKWVIRRTLTRASTVIALG
ATWAERLQRIAPNAKIALVPNAIRLEGAVAQDSSGPVHVVFLGRVSDRKG
TFLLLESWAKLVATASTPTPKLTIAGDGEVDRARELASALGIRNGVDIRG
WMSPTEAQELLATAHVLVLPSLNEGQPMAILEAMARGICVVASNSGGIPE
MLGMDGGVLVDPINADSLTDALRHVTCNAAARAEIGALARQRISRHFNVD
QLARRLDDLYHDVLKV
315445677YP_004078556.1 Heparinase II/III-like protein [Mycobacterium gilvum Spyr1]MASRHHSLKQSAVTTFGAKFGWYGRRLLTMEPKEILWRLHRMSAPRNSTL
VDTDAVMGCSSRAQWEEALQAFRTDTETPALLDSRKADLIAQTAPDSVAR
LIDAAQLACKPTFQFFSYPPITLRHPLDWNYDPISDVHWPAVSSGRINHR
VGLGDVKWIWELNRLQHLPILAQAWLFTGEDHFSRTAFSHLDSWIAQNPP
GSGIAWRGAFEAGIRAISIAVALQGFRHSEELTADRFRKIINVLVQSASI
CCSDRSRYSSANNHLIGEMAGLAVISIVLPQLATSSVWEREAISALCAEA
SNQILPDGAGAEQAVGYQVFIVELINIVAVLLFIRDGAAPKPLVEAVRRS
TRFLAAIVGAGDSAPRYGDDDEGFAVRLGPAPVRTIRDHLGITGASGWGI
TEFHAASDSLDAQWFRAVANEARDRSVRTEQVVTDSEPLAQLYANEGGLV
VMRRGGHRITMDVGPLGYLSIAAHGHADSLAITLSDCDGDLIGDPGTGSY
YGHPEWRAAMRATAAHATVSVDGRDQSVAGGPFLWVRHAKTRVRAVDLAR
GVVDAEHYGYRQLHGRVTHRRWLTVAPDDNAYLIVDLVTGAGVHEVKNSW
PLHPSVSIQHLNDGHVLQRSGVPVIKLLHAATAPIACADSRGDEEMQLGW
WSNRLESRIPTWWLGTVSTTSLPVAMATLMVPANGIAATDLKIALQNTRV
FIQWSRGNQQHSAIIDTRHSAAISWSDTENREA
315445676YP_004078555.1 hypothetical protein Mspyr1_41490 [Mycobacterium gilvum Spyr1]MWRRIVIRRKRDGAAEGLAPTVAPNIDSERTSNRQIAGAFGQQLIFRAAG
MVASLLTVTATTRYLGPSLYGDVTTAVMFVGLWMSLAELGIGAVLVRRVT
SGRGDLERLVRINAGLSVSYCIPLYAVAAASGTLIYWGDRQVVAMILIVA
ASLTLTTLSTCFIPVFLATVRFRAVALSDLLGRSISFALTVILVKYEAGV
LWFAVVQLVPPAVVLVIQGGAAKSIVNCTPIFSIRESWDLLRESLPQTVI
LIIGVLYYRIDGVILSLLSSPDEVGVYGLAFTLTTTVGVLAQFFLSSTLS
TMTGLYARDRQAFTNFISKSLQIMICIGAPVAIVGWMLAGELIELVGSAA
FVHRGAPTLAILSLSIAITFVTGVLGQALFAAHDQRFLMNLNLVALVINI
ILNIILVPQHGAQGAAVSLVATNCIGLLVATWRLRRRVSIQVPWLFLLRL
TVPLSLCIGAMLALRELPVAAVSVAAATVYLVVNVIVGPVSLRMIRSVVA
RT
315445675YP_004078554.1 transposase [Mycobacterium gilvum Spyr1]MLTVVHDAIEANESTGGAGRSLLDEIVRDGARQMLAAALKAEVAAYVAQF
ADQLDEKGHRLVVRNGYHQAREVLTAAGAVEVKAPRVNDKRVDPDTGERK
RFSSAILPAWARKSPQMSEVLPLLYLHGLSTSDFTPALEQFLGSGAGLSA
TTITRLTSQWQDEARAFAARDLSGTDYVYLWVDGIHLKVRLDQEKLCLLV
MLGVRADGRKELVAITDGYRESTESWADLLRDCKRRGMTAPVLAVGDGAL
GFWKAVREVFPATKEQRCWFHKQANVLAALPKSAHASALSALKEIYNAED
IDKAQFAVKAFTVDFGAKYPKAVAKITDDLDTLLEFYHYPAEHWIHLRTT
NPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRAVNAPHLV
ALVRAGAVFHKGKLLERPTEITPPTPPSDGDQQAGTEVA
315445674YP_004078553.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MFVRKVRTASGAVAVQVMRKDGRRDVLVEHIGSAHTDAELGVLLERARQV
ASGDQDVLDFEVPARAQRVADVADWRHGTLTLPAGVPKGVVVAPGRTAAT
SSRLLYDVIGGIYDWIGFDVVADAVFRDLVIARIVEPTSKMDSLRVLADL
GAEPMSYKTIQRHLAKVNTGNYRDAIATKCFTHAVDRGALSLLLYDVTTL
YFEAENEDDLRKVGYSKERRVDPQIVVGLLVDRTGFPLEIGCFEGNTAET
TTLVPIITAFAQRHDLGDTPIVVAADAGMLSATNLAALDEAGLGFIVGSR
SVKAPIDLASHFHWNGDVFTDGQIIDTVTPRHAKSIVNDTNKRAEPVWNA
DTHAGAWRAIWAYSAKRARRDQKTLHAQEERAKAIVSGERAAKSTRFVKT
TAGGRALDEASLARAQSLVGLKGYVTNLGVEVMAASEVIAKYHDLWHVER
SFRMSKTDLEARPMFHRTREAIEAHLTIVFTALAVAHCIQERSGLAIANV
IKQLRPLRSATIVINGASQAFPPEVPAPQREILAALGIKVAY
315445673YP_004078552.1 hypothetical protein Mspyr1_41450 [Mycobacterium gilvum Spyr1]MPKKIDPNVRERCVRQVLDTLPQYPSVTAACEAVARREGVGKESVRRWVV
QAQIDGGQRHGATSEELAEIKELKAKVRRLEEDNEILRRASIFFAGELDP
RNR
315445672YP_004078551.1 site-specific recombinase XerD [Mycobacterium gilvum Spyr1]MTIQHQLRLQAGTDVAWVLSGPGCGKYALVNEYLRYLADRNYSPRTLRAY
GYDLLAFCRWLGSVDVELSSVTTETVLDFMRHCRQTPIAGRPTNVVSMTG
TRLDRYSSTTINHRLAALTGLFTFRELRDPGLRTPIPSGREARRVSAEER
NGLLGHLVRPKRRSALRLREPRRLPRALNRRETAELLSSLRTWRDRALAG
LMLLSGLRSGELLTLDVTDVDIGARWVKVMGKGAKERRVPLDVEVAGLIQ
TYLLVERPESDSNRLFLVAKGPHRGQPLTAAGLRTIFRYHRIKSGVLAGH
PHALRHTFGTAMAEAGVDLAVMQALLGHAHIDTTARYIHLAPTHVKAEYD
AARTRLRSHT
315445671YP_004078550.1 site-specific recombinase XerD [Mycobacterium gilvum Spyr1]MLPEHDYAPTPETPAQIYAAYLVHLQRRDRGNTAYAQAARSFLRRWPRVQ
SWADIPLDEQLAANCSTRPFVTFLMVSRRLQPGYDYLVHRKLSSLWHELT
DSCLQPDLDQFISAALELGFTERVASAIGSQIIARLLIQTGRPLTGLRES
DLQELLHACHVRQERTGRGAKHYRSTTHSARQILFHLGILDTQARPAVTA
LTLEQRMVDVPVALRPAFVAYLNRKYATCVPKTVSSLATRLAHFGRYLAA
ADPSLTSLNQLDRRRHIEPFITSLTTATNSVTGEPITVADRIRRIHAVGN
FLAEITEWGWDDAPPRRLIFRTDLPRPPRCLPRYLPVDSDRKLTAALAKS
PYRLAADALLVQRACGLRIGELLDLELDCIHEIPGQGSWLKVPLGKLNSE
RMIPVNDEVLTLVDRITTTRSSGRPMIHPRTGAPADFLFTHHGKRLSQNA
VREELNRAAQAASLGHITPHQLRHTYATALINAGVSLQALMALLGHVSTQ
MSLRYAHLFDHTVRTEYERALDLAKSHIGALPKTAVGLPITDITGTGWKD
TPAIKSRLAGGYCLRAPAQGSCPYANICEHCPSFHTDSTHLAVLAAQRID
AQDLAADAEKRGWIDEAERHHNLVSRLDALITGSASA
315445670YP_004078549.1 hypothetical protein Mspyr1_41420 [Mycobacterium gilvum Spyr1]MNEPALLRVERVCAELATSGQPITFTTVAEHAQISRATLYRDHQLRAIVD
EHRTRQTDARTLTGLATEVAHLRTAVEALAAEVKRHEEQIRKLTKPPRR
315445669YP_004078548.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MGQVADTKVSVIIVAFNSLRTLEACLRSIPHSAEVVVVDQESRDGSAQFV
RQVRPSATLIRAGANRGFAAGCNLGAANAKGDVLLFLNPDAFLGPDCLSI
LVESALSANALVGPKILDPDGREKTWARNHSNMLMDIFEEILPRKFTVGL
LARNIPEDDEVYRVGGTVPYVQGSCMALSAENFWRAGGFDERFFLYYEEE
SLAKSLAKIGVRVKLEPKAVVTHIGSVSTSQSSNFAVTQLYRSRTLYYKL
YHRQSATLLFSCILWSLLSMMGITSSVRRLIGVRPSRDRVWYRSASAGVA
SGWKGRVVEPPGARWNTSKIAD
315445668YP_004078547.1 nucleotide sugar dehydrogenase [Mycobacterium gilvum Spyr1]MKISVFGLGYVGAVSAGCLAADGHFVIGVDPNETKVDLINTGVSPIIEND
IGTSIASEVRSGRLRATSSVNHAVQDSEISLICVGTPSQLNGNLDLSFVR
RVCEEIGEALREKGAYHVVVVRSTMLPGSMRSVVIPTLEASSGKTVGEDI
GVCINPEFLREGTAVWDYYNPPKTVIGEVDAASGQVLIDLYGHLNAPMIR
TSIDIAEMVKYADNNWHALKVAFANEIGTISKAVGVDGREVMSIFCQDTK
LNLSSYYMKPGFAFGGSCLPKDVRALTYKARSLDLEVPLLNSILPSNRCQ
VERAIEMIIAQRSRKVGILGFAFKSGTDDLRESPVVDVIEYLLGKGYDLR
LYDENVSMAALTGANRDYILNHIPHISRLMVSDMEEVLQFAETLVVGNGS
PEFDNITSLAHAGQVIIDFARVSSRPSGGNYQGICW
315445667YP_004078546.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MLVNRRRSGAATARRRVLILVENLPSPFDRRVWQEAVTLQQNGWQVSIVC
PTGKGYESRLEVIEDVHIYRYPLPAEGDGPIGYAVEYFVAMWHCFRLAAK
VWRERGFDLVHACNPPDLLFLVGGFFKLVTGSRFLFDHHDINPELYEAKF
GKRGALWKLMVWLERATFFTADVSIATNESYRRIAIERGRMDPDQVFVVR
SGPMLDRLKSRPPIADLKCGKRFLVGYVGVMGKQEGIDFLLKAVEHIVYG
MKRTDVHFGLVGGGTSLEEMRQLAVDLKVADFVTFTGRVPDEQLLDMLNT
ADVCVNPDIANDMNDKSTMNKIMEYMALGKPIVQFDLTEGRFSAGEASLY
AKRNDPLDMAEKLVQLLDDPVRSATMGAFGRWRVEHQLEWQYEVPKLLAA
YDAAMDRRK
315445666YP_004078545.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MKSRQIRVVFIVPDLRVGGAERHVTTLLPQMNREKFTTSVICIGEEGSLF
SALPEAGVSASAMHLGHKRNAGHALIRLIASIKRLQPDIVVVRGYNAEVL
GRIAARMGGTRHIIVWVHHIGDAKPRSSVRKLSDHILERWTSRYFGVANA
QRNYMMNELRLPRHKIRIIHNGVDPGAFSTQDDRQVLGDLDPRLGSGTPV
VGMIAALRPEKDHKNAFLAARIVLEQLPSVKFLIVGDGPMRAELEEYALA
LGISESVHFVGTRRDIGRLLPAITVFTLSSATVECFPIALLEAMACARPA
VCTDVGGVGEILRHGETGFLVPPKCPQMLAARLLDLLNSPRDARRMGLAG
RRRVENCFNLSQSVLATEAEFEQLFSSGRTR
315445665YP_004078544.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MFVRKVRTASGAVAVQVMRKDGRRDVLVEHIGSAHTDAELGVLLERARQV
ASGDQDVLDFEVPARAQRVADVADWRHGTLTLPAGVPKGVVVAPGRTAAT
SSRLLYDVIGGIYDWIGFDVVADAVFRDLVIARIVEPTSKMDSLRVLADL
GAEPMSYKTIQRHLAKVNTGNYRDAIATKCFTHAVDRGALSLLLYDVTTL
YFEAENEDDLRKVGYSKERRVDPQIVVGLLVDRTGFPLEIGCFEGNTAET
TTLVPIITAFAQRHDLGDTPIVVAADAGMLSATNLAALDEAGLGFIVGSR
SVKAPIDLASHFHWNGDVFTDGQIIDTVTPRHAKSIVNDTNKRAEPVWNA
DTHAGAWRAIWAYSAKRARRDQKTLHAQEERAKAIVSGERAAKSTRFVKT
TAGGRALDEASLARAQSLVGLKGYVTNLGVEVMAASEVIAKYHDLWHVER
SFRMSKTDLEARPMFHRTREAIEAHLTIVFTALAVAHCIQERSGLAIANV
IKQLRPLRSATIVINGASQAFPPEVPAPQREILAALGIKVAY
315445664YP_004078543.1 transposase [Mycobacterium gilvum Spyr1]MVADLRSDTTSEWEAMGRVADLLGVGTAETVRKWVRQAEIDAGDRAGQST
EESEVLRKLRRENAELKRANAILKAASVFFAAELDRPSQ
315445663YP_004078542.1 transposase [Mycobacterium gilvum Spyr1]MEFISAHQHMRVGVDGLKWGVESMCAVLSEFGVTIAPSTYYAHRARRGPS
QADWADARVIDAIWQLRRSQRLYRVLGARKTWIVLRTNGIDVSRCVVERV
MREMGWRGACKRRRVRTTVADPAATRAPDRVARRFVAEAPDRLWVADFTY
CRTGAGWAYTAFVTDVYARKIVGWKVATEMTQKLVTDAINHAIDTRKRSG
ATSLESLVHHSDAGSQYTAVAFTERLAAEGILPSVGSVGDSFDNALAESV
NSSYKTELIDHQPPYPGATELSLGTAEWVAFYNRERPNGYCQDLTPDRAE
ALYYHRQRHPHTEEALK
315445662YP_004078541.1 transposase [Mycobacterium gilvum Spyr1]MGSAHDDGEVEALKAAARQRLAQGQGALDLGLNTAGMDGEPLEIVSTKST
PLWESLSRAYRVLGFEKAAGGDEVFRDLVLARIIEPTSKIDSLRVLAEAG
VVPVDYRTVTRHLPMFAKPIVRQSLSKACAAHAGLGPASLVLYDVSTLYF
ETDAGDGFREPGFSKERRLEPQITIGLLTDAGGFPLALEAFEGNKAETAT
MLPVINAFKAAHQLSDVTVVADAGMISESNQVAIQVAGLSFILGTRIPFL
PGVVGEWHAKHPEEAIPDQLVLTQPWPASSSEKARGIPDRVIHYQYRHDR
ARRSLRGIDEQVAKAQRAVDGKAPVKRNRFITLTGATKTVNRDLEAKTRA
LAGWKGYTTNLTGESADFVIGAYHQLWRIEKAFRMSKHDLQARPIYHHKR
ESIEAHLTIVFAAMAVSHWIEVQTGWSIKKFVRTARRYRTVMIKAGNQVL
TAADPLPDDLRDAIAQINTGHAH
315445661YP_004078540.1 transposase [Mycobacterium gilvum Spyr1]MAGRKRNSAEDIVRKLRRADELAAEGKTGEEIATELEVSPATLYNWRRSY
GGMDTDAAKELKELREQNARLKRLLAEAELVKDALREVAKGKF
315445660YP_004078539.1 transposase [Mycobacterium gilvum Spyr1]MATGKDEDLQLDQVVSTREMAEALRASGAVDDLLAQIDTGEVALTGEGGL
LPGLIKLALERGLAAELTDHLGYEKGEPAGRGLPNARNGSSAKTVQTEAG
PVPLDVPRDREGSFTPRLVPKGQRRIGGLDDMIVSLYAGGMTLRDIQFHL
QSTIGTEVSHETISKIVDEISEAVLSWQHRPLDALYPVIYLDAIVVKVKD
GGHTRNKAAHIAVGVDMAGIKHVLGIWVQQNEGASFWASVCADLANRGVR
DVLIVCCDGLTGFPEAIAATWSQAAIQTCVVHLIRNALRFVSYSDRKTVA
AALKPIYTAPNAEAARAELDAFTASEMGKKNPTVTRVFDRAWEQFTPFLA
FPPELRRVIYTTNSIESLNYQLRKVTKTRGQFPNDAAVVKLLWLAICNIE
DKRAAERAKERGQKRCRTAPGRLVEGQVVTNWKKALEQLALVYPDRVEPY
L
315445659YP_004078538.1 hypothetical protein Mspyr1_41280 [Mycobacterium gilvum Spyr1]MADFRDGQSLKLGNYVTADSCGGFHGETALARRPARAGLPP
315445658YP_004078537.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MPRLRVCLIATHFAEYSNLLAQAIARSADVMVVANRENVEMELGREFDAR
NQFQRVLLVHQTKNPFSLLLQAFRLAQAVRRFAPDIIHVQEDSKDVFAIA
LHLMPVCPVVLTMHDPKPHAGADTVARQKTRRGFYIAQLRRRADAVIVHG
MSLVADAEEAIGQRPVTVHVIPHGPLGQIPAERVALPTERGRCLFFGRME
AYKGLDIFIDVIERLHSSNRAVRGVVAGRGSSLDALRGVLEGDERFEVID
RFLSPEEALQEFQRAEVVVMPYREATQSGIAAFAMGVGRPVVGFDVGAVR
ESVEHGETGLLVASGDVDALTTAVSEVLNDATLRHRLGRAAHARGKRKFA
WDEIGNLHFDVYQSLLRGDIHR
315445657YP_004078536.1 methyltransferase family protein [Mycobacterium gilvum Spyr1]MDNHSQGDESHAGAEHFCRIIKSSYGDLGSATHVLIAGCGRGHEALHIRR
KLDVRVTGVDVAEHWDPLETWAANIPDFELQTSSVQDLPFPDDTFDMVFF
HHVIEHVTDPAESLRELARVLRPGGIIYVGTPNRHRAIGYLGSFDATPLQ
KVQWNLTDYKARFSGRFRNEYGAHAGFTERELAALMGRFFVDLRVLTGDY
LRFKYEKKLPGTILRAVCSNGLREFAAPSVYFVAYTPVIS
315445656YP_004078535.1 transposase [Mycobacterium gilvum Spyr1]MLTTALGMSERLACKAVGLARSTCRRLPLSQTPADPDAEMRAWLRSYAVK
HPCHGFRRAWAALRYDERREVNKKKVHRLWREEGLQVRVRSPRKRAGVSS
IPPIVADAPNVVWAIDFQFDSTIDGKAIKIASMIDEHTRVSLLNIVERSI
TAERLVDELQTVFAVAGGPPKVLRMDNGPEFISQALQQFCDGRFGMSYIP
PGTPWNNGHIESFNNRLRKECLNRNHWNTLLEARVVIGDFKADHNHRHRH
SALGYRTPAEYAAVCRCTHTPMACSIN
315445655YP_004078534.1 transposase [Mycobacterium gilvum Spyr1]MAGRKRNSAEDIVRKLRRADELAAEGKTGEEIATELEVSPATLYNWRRSY
GGMDTDAAKELKELREQNARLKRLLAEAELVKDALREVAKGKF
315445654YP_004078533.1 transposase [Mycobacterium gilvum Spyr1]MSRTRRSFTTEYKVEAAHRVIDSGRTIAEVARELGLNEALLGRWVADERR
RVEAAAARNDEPLTPAERTELTRLRRQVAEQEKDIAFLKKASAYFAANGP
K
315445653YP_004078532.1 transposase [Mycobacterium gilvum Spyr1]MAAECATTAITRMACLLEVSTSGYYKHVNRSATEELTDREQRKADLSVKI
VTHHRDSGGTYGSPRITADLRATGEEVSEKTVAKIMAEIGLAGISPRTFK
VRTTVVDPTASFPPDLVERYFDQGRPDAVWSSDITYLSCGEGDVYLCAIR
DEHSKRVLGWSVADHMRTELVTDALARAVAARGGRVSGTIMHSDRGTQYT
AAAMAAACADAGLRRSMGATGICWDNSGAESLWSTFKHEYYYRHTFATTA
EIIAAVDKWMHFYNTQRRHSTIGMLSPIAYEQSLNAATQAA
315445652YP_004078531.1 hypothetical protein Mspyr1_41180 [Mycobacterium gilvum Spyr1]MGKRQRDCVECGAPVGFLGREHCCLCMRRRREQSAKTRCPGCGSDRVLVP
ETGRCVLCSRRCRECGGRIRFRDETVCRPCQKRAEHASARSMCPRCGKPG
YLRESTGWCGHCSRPSPPKDPPRVCARCGELRRHAGRGMCGRCWQRHPDR
PFVRGETLAAGLVEPPYWLDDFVAHLAGCQCPSRACVLITALARLLEDKH
SNHPQRVLERSRRPGRSMGSLARALEAFFTERGLAISTDQSDRLAAGRRQ
NRIDATPTGMRVAVSDFADFMLNARERARPAGTRPRADRTIETALAVVRD
LACFLDARRGKQDWALVEVADIEAFLADQPNSRARRLTVLGQFFRFTHSR
RKVLVDPTRGVAAKRYRGFRGRTLTITQQRALFHRWSVDPGAHPHEAMFG
LLAILHGASSSEVRLLRADCVDASDRSVRLGKRPHPVPLDPVSWSALQRC
LDHRDTLRSANPHVIVTRGTKADRRPASEAYMSHLLDPCGLPPKMLRTTR
LADLVSTMDPKLVAAAFGMRPEGAMIYLADHLDDGRLTGQLAEP
315445651YP_004078530.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MKIRWRLRMAAAQREVWTGTELRRLLAEKAGMHISAASVSALLTKEPSQI
KLSTLIALCTALDCTPDDLFEIDTTAVEAPAAPPRPVSTEWRTVNARGRS
MPPM
315445650YP_004078529.1 transposase [Mycobacterium gilvum Spyr1]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
315445649YP_004078528.1 transposase [Mycobacterium gilvum Spyr1]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICWDNALAESFFAALKNERV
HHMVYPTRKKARADIARYIELFYNRRRLHSALGYRTPHEVRIEYMNSQLA
A
315445648YP_004078527.1 hypothetical protein Mspyr1_41130 [Mycobacterium gilvum Spyr1]MESLRLIPGGAVAVEPVVSDPVVFQRECVDAFVASWRARGFSPVTIDNDI
GLLERALAALGRPAWEVTSEDIDRVVGDLAMAGRSASTRREYVQIFKGFH
RFLQVRKAAEIEAGFGVRLVCPVDEFNASRHVGDDSPAVAPPPSPERVDA
FFEFLKIRIAGARKYGPAARDYAMFRTLYHAGLRSEEAALLEIADVHFGR
GPFGKLHVRFGKVACSALLGLRISRELCREL
315445647YP_004078526.1 transposase [Mycobacterium gilvum Spyr1]MLSEHGCQIAPRTFYAWLARPPSARALWDTVITEILAGFYEPDEHGRRKP
ESLYGATKMWAHLQRQGIAVARCTVERLMRANGWRGVTRRKKVHTTIADP
AAGRAPDLVDRQFRVPAPNVLLVADFTYVRLASGVFVYTAFAIDAYAGRI
VGWTCSAGKSDAFVRQAIRHAAQLRLNEGNPLSGNTIHHSDAGSQYTSLR
FGETLALSGLVASIGTVGDAFDNALAETTIGLYKTEAVRDDSPFRRGPLH
RLTDVELLTAEWVHWYNTDRLMHRLGRIPPIEYETVYYATNTARSEAAHQ
315445646YP_004078525.1 transposase [Mycobacterium gilvum Spyr1]MPKKYDDQFKARAVQLVIDHTAEYDSRTACIAAVAKRLGVAVETLRRWVA
QSEVDTGQRDGLSTDAVRELRELKRKNRELEETIEILKAATSFFARESDP
RHR
315445645YP_004078524.1 hypothetical protein Mspyr1_41070 [Mycobacterium gilvum Spyr1]MSPNRAADPTPPSPAQVRTAVNVLATCNYSCPLSTVSSKVFTGDAVSGLP
LPDEVPMLCPPRWFATLFVITLGLSASGPYAFIAAADRACGTHSSEVPQM
PPAARFAEPFKGDYSTNDFSQWNRVETVQYVGEPKRYKASYSARVVDDSV
YGKAARFEVRAGDIPFGKGERSEVSGEIATTGGVEGQTRWYRFATKFDTS
FPRNQADLGWAVTNQWHPDSDKGSPLLSWSPGFKNGMWSLLVNTQKSPGA
YTGTKSIFDTPLELGEWHDVRMQVHWSTSEGWVRVWHNGDLRILASGSDT
YYLPTLIPGTTSVYYKEGLYREPTAKTGIVYHAGFRSASGEYALNAR
315445644YP_004078523.1 type II secretory pathway- component ExeA ( ATPase) [Mycobacterium MSIQRLQSHWGFSRMPFGRDLAPSMLHRHPGHSEAIARISWCVDQCAIGV
ITGEVGAGKTVAIRAAATALDPARHVIIYLANPTIGVRGMLTHIVAALGH
TPVFHTARLAPQAADALAAEHAERGRSPVLVVDEAHLLDNGQLEAIRLLT
NHDMDSGSPFAVVLVGQPTLRHRLRLGVLAALDQRIAVRYTLPGMTPADT
ADYINHHTKIAGRSDVLFADDAITLIHNASRGHPRAVNNLALHALTAAFA
AGHSIVGEKAARIAISETATD
315445643YP_004078522.1 Mu transposase/integrase [Mycobacterium gilvum Spyr1]MSLEDHKRRERANAIGLFRYQVICPALEEGLSTRQRGRVVREIAGRRHID
PFGTQVQIARATLDRWIRRYRGGGFEALVPEPRRLATRTDVQVLELAASL
KRENPARTAAQVARILRTATGWAPSESTLLRHFHRCELMGPAAGQSAEVF
GRFEAPDPNELWVGDALHGPRVGDRKTYLFAFLDDHSRLVVGHRFGFAED
TVRLAAALKPALAARGVPASIYVDNGSAFVDAWLLRACAKLGIRLVHSAP
GRPQGRGKIERFFRTVREQFLVEVTDTTAEDLAAAGVDHAGALLELNRLF
MAWVETEYHRRIHTETGQSPLARWEAGFDRLGHPAALPTAADLTEAFLWS
EFRIVTKTATVSLHSNTYQVDPALVGRRVELVFSPFDLQAIEVRDQDRSY
GQAIAHTITRHAHPKARPEISSQTPPAATGIDYLALTAAAHHEQLRDDER
IGYHALYGAQATATDDNQLPGQLALPSLDHKDGVSA
315445642YP_004078521.1 hypothetical protein Mspyr1_41010 [Mycobacterium gilvum Spyr1]MVTVEVDRVCVESRLVGGAISCPACPDGVLGGWGYARARHVEGLDDRVRP
RRARCRSCLVTHVLLPVTMLLRRAYAAERVWMALSARAEGVGHRGIAARL
QVPPSTVRGWLRRAGQRLESMRTWFLTVAVGTGIDVMIPDGLGCGWRDVV
AAVMVAASAIGQRFGPAGLLGVVTPALVVVAVSGARLLAPGWPPMSSAVP
CNTSCP
315445641YP_004078520.1 transposase [Mycobacterium gilvum Spyr1]MLSEHGCQIAPRTFYAWLARPPSARALWDTVITEILAGFYEPDEHGRRKP
ESLYGATKMWAHLQRQGIAVARCTVERLMRANGWRGVTRRKKVHTTIADP
AAGRAPDLVDRQFRVPAPNVLLVADFTYVRLASGVFVYTAFAIDAYAGRI
VGWTCSAGKSDAFVRQAIRHAAQLRLNEGNPLSGNTIHHSDAGSQYTSLR
FGETLALSGLVASIGTVGDAFDNALAETTIGLYKTEAVRDDSPFRRGPLH
RLTDC
315445640YP_004078519.1 transposase [Mycobacterium gilvum Spyr1]MPKKYDDQFKARAVQLVIDHTAEYDSRTACIAAVAKRLGVAVETLRRWVA
QSEVDTGQRDGLSTDAVRELRELKRKNRELEETIEILKAATSFFARESDP
RHR
315445639YP_004078518.1 transposase [Mycobacterium gilvum Spyr1]MIVAFIDELRAEGHAVESICRVLREQGPQIAARTYRDWARANRPVADRTI
TDAMVADQVRDLVWKVDHAGVRRMTPEGLYGRRKMTALVKRTTPAASPGS
VDRAMRLLGLQGVRRSKGIRTTIAAKDGTRAGDLLDRDFTAEAPNRTWVM
DFTYVRTWVGFVYVAFILDVFAQKIIAWNVAPTKAVELVDVPLRMALWAR
NREGHPVVRGELIGHADAGSQYTSITFTDHLAQEGILPSIGSVADAYDNA
LMECVIGLYKTECIRTTIFHGGPYRNIGDVEYATAGWVDWYNNRRLHSSL
EMMTPVEFEQAHYATLNREPQPV
315445638YP_004078517.1 hypothetical protein Mspyr1_40960 [Mycobacterium gilvum Spyr1]MPKKIDPNVRERCVRQVLDTLPQYPSVTAACEAVARREGVGKESVRRWVV
QAQIDGGQRHGATSEELAEIKELKAKVRRLEEDNEILRRASIFFAGELDP
RNR
315445637YP_004078516.1 transposase [Mycobacterium gilvum Spyr1]MAHVRTVKTASGATAVQIVWSNRRGSRSIEHLGSAHDEAGVAALKAAGVQ
RIAGGQDQLDLGLGTRADAEPLPITSSRAQHLWSALSDVYELLGFDEVAE
GDEAFRQMVLARIIEPTSKADSLRVIDEAGIAPVSYPTLNRRLPMFAKPA
FRQGLSSACAAHAQLGPASLVLFDVSTLYFETDAGDGFREPGFSKERRLE
PQITLGLLTDASGMPLMVQAFEGNKAETATMLPVITAFKKAHQLADVTVV
ADAGMISEANQIALQASGLTYVLGSKIPQLPSVVTEWQKEHPGREIPDGL
ILTQRWPSSTSEKARGVPDRMIHYQYRADRARRTSRGIDEQIAKAQRAVD
GKAPVKRNRYIQLSGATKTVNRTLEAKTRALAGWKGYTTNLVEQPPSFII
DAYHRLWRIEKAFRMSKHDLAARPIYHRTRESIDAHLSIVFAAMAISHHI
EAQTGWSIKKFVRTARRYRTITIAAGNHTLTAADPIPNDLAETLAKIRSD
AAH
315445636YP_004078515.1 transposase [Mycobacterium gilvum Spyr1]MAAECATTAITRMACLLEVSTSGYYKHVNRSATEELTDREQRKADLSVKI
VTHHRDSGGTYGSPRITADLRAAGEEVSEKTVAKIMAEIGLAGISPRTFK
VRTTVVDPTASFPPDLVERYFDQGRPDAVWSSDITYLSCGEGDVYLCAIR
DEHSKRVLGWSVADHMRTELVTDALARAVAARGGRVSGTIMHSDRGTQYT
AAAMAAACADAGLRRSMGATGICWDNSGAESLWSTFKHEYYYRHTFATTA
EIIAAVDKWMHFYNTQRRHSTIGMLSPIAYEQSLNAATQAA
315445635YP_004078514.1 transposase [Mycobacterium gilvum Spyr1]MSRTRRSFTTEYKVEAAHRVIDSGRTIAEVARELGLNEALLGRWVADERR
RVEAAAARNDEPLTPAERTELTRLRRQVAEQEKDIAFLKKASAYFAANGP
K
315445634YP_004078513.1 dTDP-4-dehydrorhamnose reductase [Mycobacterium gilvum Spyr1]MQLSVTEYGKALRINQTPIPGLLVVELPVHGDNRGWFKENWQREKMVTAG
LPDFGPVQNNISFNDAIGTTRGFHAEPWDKLVSVAAGRIFGAWVDLRSGS
TYGTSFTAELDASRAVFVPRGVGNAFQTLESNTAYTYLVNDHYSPDAAYV
SVNLADPQVGIEWPIPLARAELSGKDRANPRLSEVDLLPPRRILVLGASG
QLGRALRQEYAQASHVEFAARTDIDLTTTNLDSARRWRDYDAIINAAAYT
GVDASETAAGRLAAWATNVTGVAALARVAAAHGVTLVHVSSDYVFDGTAG
RPYREDDPVCPLGVYGETKAAGDLIVTTVPRHYIIRTSWVVGDGNNFVQT
MLSLAGRGIDPSVVADQYGRLTFASEIARAIRHCIETNAPYGTYNVTCSG
PISSWAEIGRQVFALAGHNPDRVTRVSTAEYFADATRPIAPRPRNSVLDL
S
315445633YP_004078512.1 dTDP-glucose 4-6-dehydratase [Mycobacterium gilvum Spyr1]MRLLVTGGAGFIGSNFVHHVVRHTDYDVTVLDKLTYAGNLASLSGLLEQR
VTFALGDIADAARVDDLVASADAIVHYAAESHNDNSLHDPYPFLKTNLIG
TFTLLEAARKHGTRFHHVSTDEVYGDLHLDDPFRFTENTPYNPSSPYSST
KAGSDLLVRAWARSFGVAATISNCSNNYGAFQHVEKFIPRQITNVLRGVR
PKLYGSGHHVRDWIHADDHSSAVLAILQRGRIGETYLIGANGEKDNRSVV
ELILRLMGRPTDDYDHVPDRAGHDLRYAIDSTKLRDELGWRPLYENFEQG
LTATIQWYRENADWWAPTKDATEAFYAQLGQ
315445632YP_004078511.1 glucose-1-phosphate thymidylyltransferase [Mycobacterium gilvum SpyMRGIILAGGSGTRLHPITLGVSKQLIPVYDKPMVYYPLATLMLAGIRDIL
VITTPHDAASFERLLGDGSHFGISLSYAQQPSPDGLAQAFTIGADFIGTD
SVALVLGDNLLYGPGLGAQLGSFNNVAGGAIFAYWVAQPSAYGVIEFDDE
GLAISLEEKPTKPRSNYAVPGLYFYNNDVVSIAHQLKPSPRGEYEITDIN
RAYLERGQLQVQILPRGTAWLDTGTFDQMTDAAEYVRTMERRTGLKIGAP
EEIAWRQGYLSDDDLRRRAEALTKSGYGAYLLALIERGR
315445631YP_004078510.1 protein-tyrosine-phosphatase [Mycobacterium gilvum Spyr1]MTLHVLFVCTGNICRSPIAERLATALATQLKIPDFTSSSAGVRAVIGHPI
HPEAALVLESLGGDASAFVARQFIPRIGSQADLIITMSAAHRDAVLERAP
RLLARTFTLAEVAEFASGSDSATIADLPRLRVMQGVSGFGDVPDPIGLDS
EAFDAVGTKIAASLPPILELCQRSGSF
315445630YP_004078509.1 exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferasMTAVNDRLEVAANIVPIPTKVPAWQRGYARRLVAIDMVGVTLAVGLAQWL
RFGGVGVEMSVFRSVDYVVLSLIIAATWMAALSINNSRSTRIIGSGAEEY
RRLWMATLSVFGGIAILSMLFKLEIARGYLMIALPAGLLILGFSRWVARQ
VVIRAREKHGRCITRVLVVGSPSAVRDLTTSLARDAGSEYEVVGACVPGP
LARTEIDVPGVGAIPTFGDESNVVGAVTATNSNAVAVTATERLNGRGIRD
LSWELEKLDIDLLVAPGVVDIAGPRLQMRPVAGLPLIHVEKPQYHGAKRF
QKRLFDVLFSSAVLLFGLPLLVPVALAVKLTSRGPVFYRSERIGLDGNPF
QMIKFRTMVDGADKMVDKLAAHNESAGGVLFKIREDPRVTPIGKLLRKYS
IDELPQFLNVLKRDMSVVGPRPPLAREVKTYDDYAKRRLLVRPGITGLWQ
VSGRSDLSWEDSVRLDMFYVENWSMISDLLIAVKTVKAVFSHSGAY
315445629YP_004078508.1 undecaprenyl pyrophosphate synthase [Mycobacterium gilvum Spyr1]MALIKWGCWCALNPAHVGLVPDGLRRWAETNGATLTDAYRRGSEKVIEIL
LALQRNDVQTVSVYNLSRANLGRTDDELEAVYTASIYFFNALIPAHFDPA
TTSVRLHGDRSLLPNEYVAAAQHVESASADDGFRINILAAYDAADELGEA
YLRAQRDGCDIAEAFEIGDVDLVIRTTPEPLLSGFLPYQSQYAQLIFLET
PLNDLTVRHIDDLIEDYRRSPQLRGR
315445628YP_004078507.1 UDP-galactopyranose mutase [Mycobacterium gilvum Spyr1]MNAPRQPLIIGAGPAGLTAALELVKRGVTPRVYEATPHVGGLARTPVDGD
WRVDPGGHRFFTSNEKVLELWNSLLPPDQWISVPRRSAMLVAGEYVTYPL
WGRDLLIQLGVRSGVRGAGSLLWSRFRRNFRLDDRSETFQEWGVDEFGRH
WYDLFFDGYVRKTWLADPNHLASDWANQRIKPIDWRRPGDRPADLDVFRY
PRLGPGQLWEAAARALANADVTVTLNAAVVAIRQDRRGWTVEFEDGQTAS
GDAVFASTPLRLLINSLEPQPPKHIRAFADTLRHRCVITVGVALQKRYDI
PFNWVYTPGEEFRVGRIQNYGRWSPALAPENWNGTHLGLEYFTLPHDDLW
EASDETLGHIVEQDLGTLGVDHSEIEHVMVVRSQFAYPIYDPGRERNVAR
IRDYLKQNFPTMHPIGRNGMHRYDNQDHAMLSAMHSVARYFGENIDPWQV
NTDLGYHEAGLLRN
315445627YP_004078506.1 hypothetical protein Mspyr1_40850 [Mycobacterium gilvum Spyr1]MVAAGIGLALTSGQGIAVADPSTPDSSGSVASTAGEPPSSADSAKKSRGT
HDSASGADQSDGPATDPARNDAESEDPESNERDTAETADDVADDEPSRTD
REVNSGAADEAESVATGSNANHSDADNSIADPQVTESAAVAPPVDANAGA
DAPQPAAPEPARETPPAAKATRPLGPAAAVVSTAVVPTKPAGFFTTLLSA
FGITDTPRPTASPLMTIVLAWLRRQVAATADVPLGSSPSAPQASQTSAQW
STTINVRDYGAVGDGVTDDSAAIKAAEAAMTSGARLYFPDGDYRFTQQSP
AGGAAIVLSGLSNITIEFDEGARLLMDNLTSSGHGQGHGIKIAGAASYVT
LLNPTIEWVTRPSWRSWGDGISIVGYPSDSAPAAGWTGSTGKVEFVSIIN
GRVVNAPQAVAVVMGASDVTVTDFTAVGTLADGLHFNANRRVTVDGLVAQ
NTGDDGLAFVTYYHETQPWTYGPTDGPFNQSSIGEWNNSDSTATNITVSG
GQANGFRVQGGYDITISNVTITNKAFGFHINSAIATHPGDWTSLASRTIT
ISNVTIENVGTGIVLGTNNVNGTEDSKWWDFSGTVISDVTILGAQNWSVA
VETPWTTTSKFAGVTLRNIYAETGVDNDGPNSGGNGGILLASLHESVIDN
VRLVSEHAANIIILGASRMRDGLTVADLPSSNLTIDDLSLEGPGQILIQD
IAGVEFGNVSSTGAEGAAVVLFRVKDASFDAITVELAGRGSGDGYGVRLL
QVRDIDITHVVIAMDDHMGSSWCSVQISGGNSTEGMAGDGVRIDSLTYTT
ERNAFASDIDVQGGPWGAANWYINAHWRHEGVATPHWTSYLYGDITPV
315445626YP_004078505.1 hypothetical protein Mspyr1_40840 [Mycobacterium gilvum Spyr1]MGYPENVLAKDEHVVLHRHPHWGRLTIPALVLIIASAAAAFVAAYVSTLN
WEQTAKNIVFAVIAAIWLILVGWLTVWPFLNWWTTHFVITDRRVMYRHGL
ITRSGIDIPLARINSVEFRHGLMDRVFRTGTLIIESAAQDPLEFQDIPRV
ERVHSLLYHEVFDTLGSEESPS
315445625YP_004078504.1 hypothetical protein Mspyr1_40830 [Mycobacterium gilvum Spyr1]MSRRRLLIPASMAALVVILFLNGASGTLLFARAQADPLAKVDAIVVLGGE
HDGREAYGVGLAEQGYADTVLLSNPYHGTDAVMAEACQPRSDIEVICKAP
VPGTTRGEALMARALAEARDWNSIIVVSWRYHLPRARKIFNECFASPTRS
VVMRDVPRDYPFSVAKWQYTYLYQYGGWVKAELQGRCD
315445624YP_004078503.1 hypothetical protein Mspyr1_40820 [Mycobacterium gilvum Spyr1]MMWGLVGLGGAAGTALGAFVLRKPSPRRLLVSTAVVCGLLGVCSAYPYVP
IMTAPLTFGVLGSAASMIAVGTAPPVWLDRRSIRRSTLAVIKRLAIYCAV
GVTSALFGYLAVRAGTTLYVKLR
315445623YP_004078502.1 hypothetical protein Mspyr1_40810 [Mycobacterium gilvum Spyr1]MALILGGAGGALLRYALATTWPHPREVLITTLLTVGLAFLIAGYVLAIGP
RSVVHFAVLGVCGSAASLSAYAVLTISQSMRLSVAFLTLTPVAAIGGLIC
GLLAARVVAR
315445622YP_004078501.1 hypothetical protein Mspyr1_40800 [Mycobacterium gilvum Spyr1]MSFADATIRRLPGPIRPYAERHHELIKFAIVGATTFVIDSAIFFTLKLTI
LEPKPVTAKIIAGIVAVIASYILNREWSFRDRGGRERHHEALLFFGVSGV
GVLLSMAPLWVSSYVLMLRVPMVSLMTENIADFVSAYIIGNLLQMAFRFW
AFRRFVFPDEFARNPEKALESALTGGGIAEALEDEYELRHPLKSGAKGDN
VTPMRGSRRRSQRQVDDPDEPRVSKTS
315445621YP_004078500.1 phosphoribosylaminoimidazole carboxylase [Mycobacterium gilvum SpyrMIGGGQLARMTAQAAIALGQTLRVLAVRSGESAAQVTPDVVLGSHTDLDA
LRRVADGATAFTFDHEHVPAEHLDVLIAEGVNVAPPPGALIHAQDKLLMR
RRLSELGAPVPRFSAVLSVEDAVAFSEHVGGPAVIKTVRGGYDGRGVVIA
ADTDEVRSAVERYLADGVPVMIEERVAMRRELAALVARSPFGQGAAWPVV
ETVQRDGICVTVLAPAPDLSGELGSAASELALHIASSLGVVGVLAVELFE
TVDGTLLVNELAMRPHNSGHWTMDGARTSQFEQHLRAVLDYPLGDTSALA
PTVMGNVLGAPETPAMSMDERVHHLFARMPDAKVHLYGKEERPGRKIGHV
NIVGGPSEPVESLRERAERAAHWLSHAQWTDGWDPHA
315445620YP_004078499.1 5-(carboxyamino)imidazole ribonucleotide mutase [Mycobacterium gilvMSSPRVGLIMGSDSDWPVMSEAAEALAEFEVPFEVGVVSAHRTPARMLTY
AQDAADRGIEVIIAGAGGAAHLPGMVASATPLPVIGVPVPLARLDGMDSL
LSIVQMPAGVPVATVSIGGARNAGLLAVRILGASDKALQERMIAFQASLE
EMVLQKDEALRQKLLGE
315445619YP_004078498.1 signal transduction protein containing GAF and PtsI domains [MycobaMSISLPGFDTWLTDRLEECADDSGERVEAYVARAVATQMITDCERVDRAS
AGKLKAHLSLTGLTGQTATEGLRSVLADPNRLRALEATGLMDTPPEAAYA
RLARTTADALSAPVASLVLVAADRQFVAGAIGLGEATIRSQNFAESFDTY
VVANGSPVSVDDARRHPLFKKWSSVRHAEVVAYLGMPLTDSAGHTVGTLS
VSDRSPRRWTSGHMQILSDLAAVATERIFGA
315445618YP_004078497.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MASWAGNPSFDLFQLPEEHQELRAAIRALAEKEIAPYAADVDENARFPQE
ALDALVANGFNAVHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN
KLGTMGLILRGSDELKQKVLPSLAAGESMASYALSEREAGSDAASMRTRA
KADGDDWILNGAKCWITNGGKSDWYTVMAVNDPDKGANGISAFMVHVDDE
GFSIGPKERKLGIKGSPTTELYFENCRIPGDRIIGEPGTGFKTALATLDH
TRPTIGAQAVGIAQGALDAAIEYTKDRKQFGKSISDFQAVQFMLADMAMK
VEAARLMVYSAAARAERGEGNLGFISAASKCLASDVAMEVTTDAVQLFGG
AGYTVDFPVERMMRDAKITQIYEGTNQIQRVVMSRALLK
315445617YP_004078496.1 biotin-(acetyl-CoA-carboxylase) ligase BirA [Mycobacterium gilvum SMPTPERPALNVDVLRSAITGTEWHRVDVVDETGSTNADLIARAARGEDIA
GAVLLAEHQTAGRGRHGRTWSAPPRSQISMSFGVDTTGVPPAGWGWLPLL
TGLAVAHTLRESYGVDAGVKWPNDVMVGPRKLAGILAEVSAPVIVVGLGL
NVEMSADELPDPNALSLSLLNHHADRTQLAASLLQEFSSRLRGWRLAGGA
DADLAADYRERSTTIGTRVRAILPGDSEIIGMATGIDESGRLLIDTDGTT
VTVSAGDITHLRPAYD
315445616YP_004078495.1 hypothetical protein Mspyr1_40740 [Mycobacterium gilvum Spyr1]MGSSVVAVVIVISLGLWHVHNRRHPGWLASPDGRFHVLNGYALATVAAYW
LAAAPTATTWEWALGNAWALVAMVSFVHGFAHLRQVTVAHAQSAQAIESI
DVAGRPAQPNPSLS
315445615YP_004078494.1 hypothetical protein Mspyr1_40730 [Mycobacterium gilvum Spyr1]MSSTVVALAVIVGVCALHARARRHAGWTASARGRFLMCLGYPTSAVAAYW
LTTASTGWEWALGAGWTLAAAASLATGEAALRRVVREHAETAMAMETVEP
STGVVHL
315445614YP_004078493.1 hypothetical protein Mspyr1_40720 [Mycobacterium gilvum Spyr1]MAANPAGPRITFYDDATGERIELSTATLANWAAKTGNLLRDELGATPGSR
VAVLLPAHWQTAAVLFGIWWIGAEVVLSGEADIALCTADRIDEADAAAGM
GEIAVLSLDPFGKPVADLPVGLTDYATAVRVHGDQIVPERSPGAALEGRS
ADDVLAAARASAAAQGLSGTDRVLATAAWETADDIVERLLALYVVGASLV
QVANPDLAAMERRTDSEKITRATP
315445613YP_004078492.1 cell envelope-related transcriptional attenuator [Mycobacterium gilMPAAHMLRAVSVALAVAIVIGTGVAWGKIRSFEAGINHINPIALGGEGED
GAIDILLVGSDSRTDAHGNPLSDQERAMLRAGDEVSTNTDTIILIRIPNN
GESATAISIPRDSYVEAPGIGKMKINGVYGSVHLEEMKELVEQQGVDPAE
AEPEAQAAGREELIKTVANLTGVTVDHYAEIGLLGFALITDALGGVDVCL
NAPVWEPLSGADFPAGWQKLNGTQALSFVRQRHDLPRGDLDRVARQQAAM
ASMAHEVISSKTLSSPSTLSALESAVQRSVVLSEGWDIMDFVEQLQKLAA
GNVAFATIPILEEAGWSDDGMQSVVRVDPTEVKDWVTSLLNDQDQGKTEE
LTYSNDQTVVEVYNDSDVNGLAAAVAHVLTGKGFTQGNVGNNEGPKVAGS
QVRAAKADDMGAQAVALDLGGLQVVEDPSVPPDTVRVVLADDYTGPGAGL
DGSDVTLMGADPSTSGVMSDTGAGVPPPSPIITAGSDDPKCVN
315445612YP_004078491.1 dTDP-4-dehydrorhamnose reductase [Mycobacterium gilvum Spyr1]MSGRIVIVGAGGLVGRVLAGQAGRQGRDVVALTSSDWDITEPGSGERHLA
AGDIVVNCAAITNVDLAEAVPERSRAVNAVGAGNVALACARVGATLIHLS
TDYVFGGDSTRPYDIDDEPAPLSVYGRTKLAGEHAVLAALPDAHVVRTSW
IFEGGNGADFAAVMRRAAAGSGDIEMVADQIGSPTYVGDLCAALLQIADG
GVRGPLLHAANAGSASRFDQAQAVFAELGADPGRVHPISGDRHPRPAPRP
SYSALAATKSTAAGLTPLRPWRAALAEALATMGGSLL
315445611YP_004078490.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MSDELFVVTVTYSPGPHLERFLATLAHATDRPVTVIIADNGSTDGAPEEA
VERHPNARLFRTGGNLGYGTAVNRAVAEYGLTSSTDFFIVANPDVQWGPH
SIDLLCEAAQRWPQAGSLGPLIRDPDGAIYPSARHQPSIIRGGMHAVVAP
VWPSNPWTAAYRQDRAEPSERTVGWLSGSCLLLRTAAFAQIDGFNERYFM
YMEDVDLGDRLETAGWQNVYVPSAEVLHAKGHATGRDPARNLAAHHVSTY
TFLADRYPKWWQAPLRWAFRTALGARASLVVRRSRRKSRQS
315445610YP_004078489.1 nucleotidyltransferase [Mycobacterium gilvum Spyr1]MVNPAQVDAVVLVGGMGTRLRPLTLSAPKPMLPTAGLPFLTHLLSRIAAA
GIEHVVMGTSYKAAVFESEFGDGSKLGLQIDYVVEDEALGTGGGIANVSS
KLRHDTAVVFNGDVLSGCDLGALLDSHEERGADVTLHLVRVGDPRAFGCV
PTDSDGVVTAFLEKTQDPPTDQINAGCYVFKRSIIEAIPKGRALSVEREV
FPKLLSDGKKVCGYVDATYWRDMGTPEDFVRGSADLVRGIAPSPALTHQR
GEKLVHDGASVAPGALLIGGTVVGRGAEVAGGARLDGAVIFDGVKIGAGA
VIERSIIGFGAHIGPRALIRDGVIGDGADIGARCELLRGARVWPGITIPD
GGIRFSTDI
315445609YP_004078488.1 diguanylate cyclase domain-containing protein [Mycobacterium gilvumMSDLHTLVFHSLSEQIAVIDEAGVIIDVNAAWIRFGIENGLRPDFVWTGR
NYLRVLAKADANGDSDAGAALRGIRGVIEGRTDTCEMEYPCDSPDEQRWF
MMSVCSLNDDSLRRFTISHIDITRRKLAEDQAQHLAMHDPLTGLANRRYF
NRILHREVRRSRRNGSPITVIAIDVDNFKKYNDEFGHLAGDHCLQELSTV
LLGAARRPSDLAARIGGDEFAVLCGDSDAADAQAIAESIVKEFADLRIGF
GASEPVTVSAGVATMIPRDEDEKWLVNEADKALYNAKRAGRNRVSQVVD
315445608YP_004078487.1 ADP-ribose pyrophosphatase [Mycobacterium gilvum Spyr1]MSLHQSTVDVLTAWNPPDPAQDSLRHSVLAFLAAREDACLRECAPGHITG
SALVVDHRGERALLTLHPRVGRWLQLGGHCEPSDETIVAAALREATEESG
ISGLTIEPEPAALHVHPVTCSLGVPTRHLDVQFVVRAPEGAEIVRSDESL
DLRWWPLDKLPDDGDFGLAQLAAAAKDVRGP
315445607YP_004078486.1 coenzyme F420-0 gamma-glutamyl ligase [Mycobacterium gilvum Spyr1]MTDHGTSARVEVLPVPGLPEFRPGDDLAAAIADSAPWLRDDDVVVVTSKV
LSKTEGRMVEAPTDPDERDTLRRKLIDGEAVRVLARKGRTLITENALGLV
QAAAGVDGSNVDSNELALLPVDPDGSAAELVAALHERLGVRVAVVVTDTM
GRAWRTGQTDVAIGAAGLTVLHAYAGEHDQHGNELIVTEIAVADEIAAAA
DLVKGKLTAVPVAVVRGLAVRDDGSSARNLVRAGEEDLFWLGTDEALALG
RSQAQLLRRSVRQFSPEPVDGALIGAAVGEALTAPAPHHTRPVRFVWVQD
GALRVGLLDEMKERWRADLLADGRDAESVERRVSRGQILYDAPELIIPFM
VPDGAHSYPDERRTAAEHTMFTVAAGAAVQGLLVALAVRGVGSCWIGSTI
FAPELVRAALEVPGDWEPLGAIAIGYGTDPVTPREPVPTDGLLVRR
315445606YP_004078485.1 LPPG:FO 2-phospho-L-lactate transferase [Mycobacterium gilvum Spyr1MTCFRRVALWRVYHAPTGRPEGSVHRLLSFDVKVTVLVGGVGGARFLLGV
QHLLGLGQYGTDDTNENEVTAVVNVGDDAWMFGVRICPDLDTCMYTLGGG
IDPERGWGHKNETWNAKEELAAYGVQPDWFGLGDRDLATHLVRTQMLRAG
YPLSDVTEALSRRWSPGLRLLPASDDRCETHVVITDPDDGEKRAVHFQEW
WVRHRAQVPTDSFAFVGADNATAAPGVVDAIEGADVVLIAPSNPVVSVGA
ILNVGGIRGALRSTKAPVIGYSPIIAGKPLRGMADACLSVIGVDSTSEAV
GRHYGARSATGILDGWLIHEGDHADIDGVNVKAVPLLMSEPSVTAQMVRA
GLELAGVAP
315445605YP_004078484.1 transcription factor WhiB [Mycobacterium gilvum Spyr1]MAFEQADFGDSIRFDSRLLGSVGSAPHIQTGPAPSGTNGRPQLSLVPERI
DSFGDDSGVLDEDQWQERALCAQTDPEAFFPEKGGSTREAKRICLGCEVK
DACLEYALANDERFGIWGGLSERERRRLKRGII
315445604YP_004078483.1 hypothetical protein Mspyr1_40620 [Mycobacterium gilvum Spyr1]MRGPLLPPTVPGWRSRAERFDMAVLEAYEPIERRWHERVATLDVAVDEIP
RLAPKDPESVQWPPEVVADGPIALARLIPAGVDVRGNSTRARIVLFRKPI
ERRAKDTDELTELLHELLVAQVATYLGVEPSVIDPTLDDD
315445603YP_004078482.1 hypothetical protein Mspyr1_40610 [Mycobacterium gilvum Spyr1]MNVPRRCCRPGCPHYAVATLTFVYADSTAVVGPLATVSEPHSWDLCVMHA
GRITAPRGWELVRHAGPLPTHPDDDDLVALADAVREGREVPGAGVTAGFT
AGLNTGFTDPVSGAHGGALMAPPARRPETNGRRRGHLRVLPDPAE
315445602YP_004078481.1 phosphomannomutase [Mycobacterium gilvum Spyr1]MSRPAEAVQRVIKAYDVRGLVGVDIDEAFVADVGAAFARLVRDSLDQPAT
QVVIGHDMRASSPALSKAFADGVLAQGLDVVHIGLASTDQLYFASGLLDC
SGAMFTASHNPAAYNGIKLCRAGAKPVGRETGLAAVAEEVIAGVPGYDGP
RGSESERDVLADYGDFLRSLVDIGGARPLRVAVDAGNGMAGHTAPAVLGS
IASLTLKPLYFELDGEFPNHEANPLDPANLVDLQAFVLETKADIGLAFDG
DADRCFVVDERGQAVSPSAVTALVAARELNREIGATVIHNLITSRAVPEL
VGERGGTAVRSRVGHSYIKALMAETGAIFGGEHSAHYYFRDFWGADSGML
AALHVLAALGEQDRPLSEMMADYQRYEASGEINFTVTDAPEIVDSVLQAL
GGRIHAIDHLDGVTVDLGDGRWFNIRMSNTEPLLRLNVEARTAEEVTEIV
DEIGGYITSGARAST
315445601YP_004078480.1 hypothetical protein Mspyr1_40590 [Mycobacterium gilvum Spyr1]MTSPASAAEVDLDDGEGLLAADRHGLLRAASMAGAQVRATAAALTEGDLD
AVRSDSPPRTVVWVAGPGTAEAAGMMLAAILGGSVGAPIVVAAEAPPWIG
ALDVVVLAGDDPARPELVTAAATAVRRGARIVVVAPYEGPLRDATAGRSV
SIPPRLPVPDDFALVRYFAAGLAVLHVVLPGFSVDLPAIADALDEEAFRN
SAGRELFTNPAKVLAERMRDHDVVLAGDSAATISLARHACTVMLRVGHQV
VAPAGLSDTLVAIGTGWGRAGGGEASIFHDEELDGPLPQQGRTVVLTTDA
ERHNVSARLRGFDDVYVVNANDVPDVAAPGGNSEPGSATTPGSARPEQQL
ALLAVRLEMAAVYRRLVRG
315445600YP_004078479.1 mannose-6-phosphate isomerase- type 1 [Mycobacterium gilvum Spyr1]MHLLRGAVRTYAWGSRTAIAEFVGGPSPTPHPEAELWFGAHPGDPAWLQT
DDGERSLLDALRADPEGELGSAVRGRFGDTLPFLVKVLAADEPLSLQAHP
STEQAIEGFAREDRMGIPVSAPDRNYRDPSHKPEIIVALSQFEALAGFRP
AARSVDLMAALGVADLDPYIGLLSGQRDEDGLRALFTTWITCPQPDLDLL
VPAVIDGAINYVRSGAQEFAREAKTVLELGERYPGDAGVLASLLLNRLSL
APGEALYLPAGNLHAYLEGVGVEVMANSDNVLRGGLTPKHVDVPELLRVL
DFTPAEDVLVVPEAIRGGAEIVYPTPAPEFAVSILHLDGESLGHEIDAPT
RHDGPQILLCTDGAATVQANGSAVALKRGAAAWVGAGDGPIRLSAQEPTK
LFRVTVGI
315445599YP_004078478.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MPRAGWRKPESDRRLSDLVSVGVLTRVFPPAMVDEVIEATGRTQVRHRAL
PARVMAYFAIGMGLYSDGSYEDVLSQLTDGLAWASGWREQYQLPGKSAIF
QARERLGSQPLAALFARVARPLGAADTPGTWVAGRRVVAIDGTCLDVADS
PVNEEFFGRPGVNKGEKSAFPQARLLAVAECGTHAIFAATIGAYRDAEST
MVEHVLDALTPEMLVLADRGFFSYALWRNASDTGADLLWRVSTGRNGPTP
THVEDLADGSWLAHLRAAKDRHGEPMLARVIDYTVDDGRDNPVAYRLLTT
LTDPDTAPAVELAAAYAQRWEIESVFDELKTHQRGSKVVLRSKSPDLVLQ
EIWGYLCCHYAIRSLMSQAAHHSGHDPDRLSFTAALRVVRQSVAHQGAFS
P
315445598YP_004078477.1 hypothetical protein Mspyr1_40560 [Mycobacterium gilvum Spyr1]MGRKHAIVIGASLGGLCAARVLSSAFDDVTVFERDPLPEGPANRPAVPQG
RHVHLLMARGAAEFESLFPGLLADMVACGVPILENRPDCIHFGAAGHLLG
TTHRLQDEFTAYVPSRPHLEWQIRRRVLALDNARLMDRGVDEPVYDGHRV
TGVRTADGATVDADFVVDATGRGTRLPVWLSQWGFERPREDTVDVGIAYA
THQLRIPDGLIDEKVIVVGASRTQPRGLGMLYYEDGTWGLTTFGVGKVPA
PTDFNEMRELAEELLPAHIGAALHQAHPLGDVALHKYPTSRWRRFDELDR
YPRGILPFGDAVASFNPTFGQGMTMTSLQAGHLQRALQTPDPEATFLAAT
AKSTWPVWTMNAIGDLTMHGADGPAPWWYRPVGALFDQFLGAAESDPVLA
EWFLRRFSLLDSLYMVPSARLIGRTIRHNMTLWARSNTVQLVADDGDAGW
VFGLWPVLVR
315445597YP_004078476.1 amino acid transporter [Mycobacterium gilvum Spyr1]MTQEPVTQAPGRLRLKSVEQSIADTDEPGTKLRKDLNWWDLTVFGVSVVI
GAGIFTITASTAANITGPAISLSFIFAAIACGLAALCYAEFASTVPVAGS
AYTFSYATFGEFVAWIIGWDLILEFAVAAAVVAKGWSSYLGTVFGFAGGT
AEVAGFDLDWGALVIIAIVTAILAMGTKLSASVSLAITALKVSVVLLVVI
VGAFYIKMENFSPFIPAPEPGEAGGTGAEQSLFSLMTGAEGSHYGWYGLL
AGASIVFFAFIGFDIVATTAEETKVPQRDVPRGILASLGIVTVLYVAVAI
VLSGMVSYKDLRDAESPNLATAFSLNGVDWAAKVISIGALAGLTTVVIVL
VLGQTRVLFAMSRDGLLPRQLAKTGEHGTPVRITLLVGAVVAVTATVFPI
DKLEEMVNIGTLFAFVLVSAGVIVLRRTRPDLKRGFRTPWVPVLPILSII
ACVWLMLNLTGLTWIRFSVWMAIGVVLYFVYGRRHSLVARRQRERAGLHT
DTP
315445596YP_004078475.1 alkane 1-monooxygenase [Mycobacterium gilvum Spyr1]MTTHDMLDKPDALQWRDKKRYLWLMGLIAPTALFVVLPLVWALNALGWHA
AAQVPLWIGPILLYVLLPTLDRFFGPDGQNPPDEVMERLENDKYYRYCTY
LYIPFQYASVIFGAYLFTAPDLGWLGFDGALPWPAKIGLALSVGLLGGVG
INTAHEMGHKKESLERWLAKITLAQTLYGHFYIEHNRGHHVRVATPEDPA
SARFGETFWEFLPRSVFGSLKSAWELEAKRLERAGKPTWHWSNDVLNAWA
MSVVFYGALIAVFGWALVPYILISAIFGFTLLETVNYLEHYGLLRQKLPS
GRYERCAPVHSWNSDHIVTNLFLYHLQRHSDHHANPTRRYQTLRSMEGAP
NLPSGYASMIALTYFPPVWRKVMDHRVVDHYDGDLTRINIHPRVRDKVLA
RYGVRGGVDA
315445595YP_004078474.1 rubredoxin [Mycobacterium gilvum Spyr1]MTAYRCPGCDYTYDESKGEPREGFPAGTRWADVPDEWCCPDCAVREKVDF
EEMGVKS
315445594YP_004078473.1 rubredoxin [Mycobacterium gilvum Spyr1]MSDYKLFVCVQCGFEYDEAKGWPEDGIAPGTRWDDIPEDWSCPDCGAAKT
DFEMVEVARP
315445593YP_004078472.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MGGGNDKRISYAEASRVLLRDSILDGMREMLLARDWSQITLSDVAKAAGI
SRQTIYNEFGSRQGLAQGYAMRLADRLVDQIHAAIDNNVGDMYAAFLQGF
RDFFVESAADPLVISLLTGSSKPDLLQLITTDSAPIINHCSSRLTESLMG
SWVRCSEEDAGVLSRAIVRLAMSYISMPPEADHDVARDLARLMTPFAERY
GVVADPVEDGNSQVTRRP
315445592YP_004078471.1 adenosylhomocysteinase [Mycobacterium gilvum Spyr1]MTALTADVRNGIDYKVADLSLAEFGRKEIRLAEHEMPGLMELRREYHDVQ
PLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVV
VGPNGTPEEPKGTPVFAWKGETLEEYWWAAEQMLTWPGEPANMILDDGGD
ATMLVLRGAQYEKAGVVPPAEDDDSAEWKVFLELCRKGYEQSKDKWTKIA
ESVQGVTEETTTGVLRLYQFAAAGELAFPAINVNDSVTKSKFDNKYGTRH
SLIDGINRGTDALIGGKKVLICGYGDVGKGCAESLAGQGARVQVTEIDPI
NALQALMDGYDVVTVEQAIGDADIVITSTGNKDIITLDHMKAMKDHSILG
NIGHFDNEIDIAALERSGATRINIKPQVDEWTFGETGKSIILLSEGRLLN
LGNATGHPSFVMSNSFSNQVIAQIELWTKNDEYDNEVYRLAKHLDEKVAK
IHVEALGGTLTRLTKDQAEYIGVDVEGPYKPEHYRY
315445591YP_004078470.1 hypothetical protein Mspyr1_40490 [Mycobacterium gilvum Spyr1]MAHRFTAVLFGLALALTACQGQPASEEAFTDTGAATSRPAPEIRHDTEEL
AVTFPALGTPVSASWIAWDNSGGSETSRLSLRWIDAVVRVSPETMAGLVD
RYHAEDVGHRPAVQKVLEPELPPGPFLTGVELNMFFGGPRRSTRVFLDPP
RDTVVLQSSVAGRA
315445590YP_004078469.1 esterase/lipase [Mycobacterium gilvum Spyr1]MASADDSESTGSGSVTTSKTEARVSAKPAPARSDAPDGVGDENSTSDESA
DVSSSPLTRIRGRDGDDTQREPREAVADRDAPEDVEEVVEEVVPDPSPAP
PAAAPMADAPRHRYDAAAQNAVVFTDEPTLFDQVVVGSLYVMRAVSTALG
IDLYGVIGKILENDDPPWFVRAGLDVRRTEYPSSGEKPWDVWEFRPPNPT
GKTVIAVHGGGFIVEPLVTHWLDYAQMARQTGATVLVPMYPLATTPAGTA
VTAVPVMAQFIADQIASRGAHNVSIYADSAGPSLAMAAVRELILTGRPVP
ASLVLLSFAPDASLSNPAICDVRDPIIDVRTLDFYTRENHWSDGLDPQDP
LLSPLFFEDAVFAALPPSTIYVGELEYALPDTLLLHEKWSAAGGVVSTVV
GVGQFHDWALGGLPVNSQAPKVRPAVYRQLGLNDVASGPDTITTGPPTYS
DRLVADILRTLRWLNETTGITILSGLAGASIITDPPPLLMHGLTVTEREF
NGWTVWEIAAPRRSGEYVVALHGGGFESEANILHWSDYAQMARDTAATVL
VPIYPLAPPKNTGTAATLVPPMADYVSQLIAEHGVDNVSLYGDSSGGSYA
VLVVRELLRRCAIEVACVPSQAGPSRMVLISPALHLTLRGPEVDAIDDPI
LPRHAPGEGPRFNGDWSLDDPRVNPIAGDNLSGLPPTTVYIGTQEKLYPG
AIAFRDKVLAQDPAADLTVVIGDGQLHGWALGGIVVNSQAQIWRPNVYRQ
LGLLPTNSARYVTLTVA
315445589YP_004078468.1 thymidylate kinase [Mycobacterium gilvum Spyr1]MLIVIEGVDGAGKRTLTNGLRAAFESGGRSVATLAFPRYGVSVPADVAAE
ALHGQHGDLADSVYAMAMLFAMDRAGARDEIGHLTSAYSVVILDRYVASN
AAYSAARLHQGADGDVVAWVRDLEYGRLKLPVPTWQVLLDVPTELAAQRA
VNRAAEDAARARDAYERDDGLQRRTGAVYAELAAAQWGGPWAVIPPDVDA
AELAARLLG
315445588YP_004078467.1 hypothetical protein Mspyr1_40460 [Mycobacterium gilvum Spyr1]MLVESRIRSTSLPTLDQLLARIAAANQSFDQGRHTEATVLAGYLRAVLYG
SGGSDALHGMKETLTWVDTAGVPNPKTTACLTAGLTLMRIRSRHHGCGEY
VPKLAMYPPAPIRTHSGEQILSGSRIPFQDWWTNPVIQDVDGTHFSRKQL
VLALAPGEDREARAARRALARSRSLGEVVGGAMPADRLCASPVIASVRQI
GYEVLQSIAEQRDILEAAA
315445587YP_004078466.1 response regulator with CheY-like receiver domain and winged-helix MDSMRQRILVVDDDPSLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYVMKPFKPKELVARVRARLRRNEDEPAEMLSIADVDIDVPAHKVTRQGE
QISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPQVVLTVRGVGYKAGPP
315445586YP_004078465.1 signal transduction histidine kinase [Mycobacterium gilvum Spyr1]MIFGSRRRIHRRSAPLIRGLAALGRALSLAWRRSLQLRVVTLTLGLSLAV
ILVLGFVLTSQITDRILEVKVGAATEEIERARTTVSGIVGGEETRSLDSS
LQLARNTLIDRKADAGAGLAGTFDAVLVVAGDGPRAATAAGPADQVPAAL
RDFVKAGQVSYQYATVHTDGFSGPALIVGSPTSSPVTNLELYLIFPLNSE
DSTIALVRGTMATGGVVLLGLLAAIALLVARQIVLPVRSASRIAERFAEG
HLTERMPVRGEDDMARLAVSFNDMAESLHRQITQLEEFGNLQRRFTSDVS
HELRTPLTTVRMAADLIHDHIHDSPDDLDPALRRSTELMVNELDRFESLL
NDLLEISRHDAGVAELAVEAVDLRSIVQRALDNVGHLAEGADVEMDVEMP
PDDVIAEVDPRRVERILRNLIANAIDHAEHKPVQIRMAADVDTVAVTVRD
FGVGLRPGEEKLVFSRFWRADPSRVRRSGGTGLGLAISIEDARLHQGRLE
AWGEPGKGACFRLTLPLVRGHKVTSSPLPVKPIETAAGAGRRVREPAGES
V
315445585YP_004078464.1 lipoprotein LpqB family protein/sporulation and spore germination pMTRTRFAALVTALVLAVAGCAGVPTSSSPQAIGTVDRPAPPSLPTPTPGM
DPDVLLREFLKATADPSNRHLAARQFLTESASSTWDDAGSALLIDNVVFV
ETRTPERVSVTMRADILGSLSDMGVFETGAGALPDPGPIELVKTAGGWRI
DRLPNGVFLDWQQFQATYKRHTLYFADPTGKTVVPDPRYVAVSEPDQLAT
ELVSKLITGPRPEMDKTVRNLLSPPLGLRGPVTRADGGKTGIGRGYGGAR
IDLENLSTTDPHSRQLLAAQLIWTLSRSGINGPYVINADGAALDDRFAQG
WDTGAVAATDPGAADGAAAGLHALVGGTLVRLDGDRAPRVAGPFGQMPGQ
TGAALSRSGQEVASVVTMRPGAPDMASSLWVGPLGGNAAQVMDGRSLTRP
SWSLDDAIWVVVDGNNVVRVIQDASGQPARIPVDATAVLTRFPGGIAELQ
LSRDGTRAAMVIGGKVILAGVEQTPGGGYALTYPRRLGYGLGENALSLSW
RTGDDIVVTRTDPQHPVSYVNLDGVDSDGPSRNLLMPVRSVAANPSAVYV
SDGRGVLQLSGSAAEDPSWVEVRPLMVAGALPVLPG
315445584YP_004078463.1 Rieske Fe-S protein [Mycobacterium gilvum Spyr1]MEIPRKTVLVGASVGVAAIAVAACSRGSESPGSSPGTSAPSGEKLASTSD
VPVGSGTIVGEVVVTQPVAGEFKAFSAVCTHTGCLLNKVADGTIDSPCHG
SRFSLDGAVVNGPAEKPLQPVAVRVQGDSIVAD
315445583YP_004078462.1 hypothetical protein Mspyr1_40410 [Mycobacterium gilvum Spyr1]MGEPFIGSEALRAGRLTRHQLRTAHIAVYPDVYVPVATTLTAVAKAKAAS
LWTGREGIIAGQSAAALHGARWVDARRPAEVLWHNRRAPRGVLVWSDRVA
DDEVTTVRGVRVTTPERTALDIACRYPQRRAVAAIDALARAAHMKLADVE
LLVDRHKGRRGIRAARAALNLVDPGAESPQETYLRLTVIGNHFPPPQTQI
PVWDCGALVAELDMGWEHMMIGLDYEGDHHRTTREAFNKGIRRHDAVTEL
GWTDIRVTCNDTEGAIIARLTTAWRQRLCALGENPDAGPPWTHVRRQRPG
E
315445582YP_004078461.1 amidophosphoribosyltransferase [Mycobacterium gilvum Spyr1]MLDLILPKQCGGCGAVATGWCDACADDLTVTDDQPHLITPRLDPGVPVLS
LGRYAGARRNAIVAVKEHGRTDLRRPLADALRAGLDHLLTWGVLAAPLTL
VPAPTRRTAARRRGGDPVTRIATQAARPPHQSVATVLRFRAFTRDSVGLS
SAARQRNVAGRVVLTRPVAGPVVVVDDVVTTGATVTESVRVLQTAGIDVV
AVLALANA
315445581YP_004078460.1 30S ribosomal protein S30P;sigma 54 modulation protein [MycobacteriMSSNSVDSDSTMVMDGEQHDAQSSDLPSAEVVVKGRNVEVPDHFRLYVAE
KLARLERFDRTIYLFDVELDHEKNRRQRKNCQHVEITARGRGPVVRGEAC
ADSFYGAFEAAASKLEARLRKSKDRRKIHYGDKTPVSLHEATALDRLDAA
FAKPTETSAVEAPVDDHEPGRIVRTKEHPATPMTVDDALYEMELVGHDFF
LFHDKESDRPCVVYRRHAYDYGLIKLA
315445580YP_004078459.1 protein translocase subunit secA [Mycobacterium gilvum Spyr1]MLSKLLRIGEGRMVKRLKGVSDYVNTLSDDMEKLSDADLRAKTDEFRRRL
ADGKEDLDDLMPEAFAVAREAAWRVLNQKHFDVQVMGGAALHFGNVAEMK
TGEGKTLTSVLPAYLNALTGKGVHIVTVNEYLAKRDAEQMGRVHRFLGLD
VDVILGTLTPDQRRAAYNADITYGTNWELGFDYLRDNMALRLEDCVQRGH
NFAIVDEVDSILIDEARTPLIISGPADGGSNWYTEFARLAPLMEKDVHYE
VDIKKRVVGINEIGVEFVEDQLGIENLYEAANSPLISYLNNAIKAKELFE
RDKHYIVRNGEVFIVDEFTGRMLVGRRYNEGLHQAIEAKEHVEIKAENQT
VAQITLQNYFRMYNKLAGMTGTAETEAAELHEIYKLGVVPIPTNRPMIRA
DQSDLIYKTEEAKYIAVVDDVVERYEKGQPVLIGTTSVERSEFLSRQFEK
RRIPHNVLNAKFHEQEAGIIAEAGRLGAITVATNMAGRGTDIVLGGNVDY
LLDRRLRQRGLDPIETPDEYEKGWHEELPHIKEQVAEEAKDVIAAGGLYV
LGTERHESRRIDNQLRGRSGRQGDPGESRFYLSLADELMRRFNGATLETL
LTRLNLPDDVPIEAKMVSRAIKSAQTQVEQQNFDIRKEVLKYDEVMNQQR
KVIYAERRRILEGENLRDQAEQMLVDVVTAYVDGATSEGYSEDWDLEKLW
EGLRQLYPVGIDHRDLIDSDAIGEPGELTRAELLDALVNDAKSAYAVREA
EIEQIAGEGAMRQLERNVLLNVLDRKWREHLYEMDYLREGIGLRGLAQQR
PEVEYAREGYDMFIGMLDGMKEESVGFLFNVQVEPVAAPTVSAQAAPSGL
AEFAAAAAQQGSVATKERPTGGLRAKGIDDQSRPLTYTGPSEDGTPEVKR
SENAPAASTGMTRKERREAARQQQKAGRHAKRG
315445579YP_004078458.1 hypothetical protein Mspyr1_40370 [Mycobacterium gilvum Spyr1]MPSYPIPSVPSSSQGCGAWVTSPVIDYEPVPQPIAERPCPMPSGSALHRA
SLRPLRPPQRTPVRETPPPRSAVVFAEASLRRVIEVIDRRRPVSQLRPLM
TPFLIDCVIACAEAPRTGSATLRKVRVRSVDTGTEVGAAEVFASFTRAGR
VHAIAGRIERHRDSWRLVALQIG
315445578YP_004078457.1 choline/carnitine/betaine transport [Mycobacterium gilvum Spyr1]MAGISEHEARAHADTSARSGTSTEEPALHPVLDRPLDEDRITRSRGIDWV
VFGVTAVFAVGFLVWGFLSTESLATASGSALTWVMNNTGWLFVLTSTGFV
VFVLYLALGRYGAIPLGRDDETPEFNGVSWVAMMFSAGMGIGLMFFGVAE
PLSHFTTPPPGTGAEGGSEAVQNAMATTLFHWTLHPWAIYAVVGLAIAYG
VYRKGRLQLISSAFEPLLGSRANGSWGKVIDMLAIFATLFGSAASLGLGA
LQIRSGLQIVAGIGETGNAILVVIISVLTVCFVLSAVSGVARGIQWLSNI
NMVLAISLAFFVFVVGPTVFILNLLPTALGSYFADLNMMSARTAAEGSDV
NEWLQSWTIFYWAWWVSWTPFVGMFIARISRGRTIRQFVGGVLLVPSLVS
LVWFAVFGGAAINVQQSGTDLAGEGGVEAQLFSLLDQYPIATIASVVVMV
LVAIFFVSGADAASVVMGSLSQKGTIHPSRGTVVFWGVATGAVAAVMLLV
GGEDALTGLQTITIIAALPFVLVMIGLAVSLVKDLRTDPMVVRRKYANEA
VESAVISGVTQHGDDFIISVEKDPHCDGGKPGG
315445577YP_004078456.1 hypothetical protein Mspyr1_40340 [Mycobacterium gilvum Spyr1]MTAGNPVADKAQRKADKPGKKTKKSKLPGDVYEAELFRLQTELVKLQEWV
RATGARVVVVFEGRDAAGKGGAIKRVTEYLSPRVATIAALPAPTERERGQ
WYFQRYIQHLPTSGEIVLFDRSWYNRAGVEKVMGFCTPAEHALFLRQAPI
FEQMLIEDGIILRKYWFSVSGEEQLRRFKSRHSDPVRRWKLSPMDLESVY
RWEDYSRAKDEMMAHTDTPLSPWYVVESDIKKHARLNMIAHLLSTIDYYD
VEAPKVTLPKKVVCSADYQRPPREASTYVDDHVASLMGDRE
315445576YP_004078455.1 hypothetical protein Mspyr1_40330 [Mycobacterium gilvum Spyr1]MRVYVPATLAMLQRLVADGSLRPVNGTAFAVTPTLRESYSEGDDEELGEV
ARREAALASLRLLGHEDTGELPPRRVVVETDIDEAADGLTLRPDLDDAVV
RLSGEIDLGRVIAAYVDNQAAEAAVRAAVEVIDAADLGNEDAELTVGDAQ
DHDLAWYAPQELPFLLDLL
315445575YP_004078454.1 flavodoxin reductase family protein [Mycobacterium gilvum Spyr1]MAKSTIKNTAKVADTVRPAVAGAKERPLWHALRTVAGRITTPLLPDDYLQ
LANPLWSARELRGRVLEVRRETVDSATLVIKPGWGFSFDYEAGQYIGIGL
LVEGRWRWRSYSLTSPPAERPRGTAGKGARTITITVKAMPEGFLSTHLVG
GVEPGTIVRLAAPQGNFVMPDPAPPSVLFLTAGSGITPVMSMLRTLVRRD
AIGAPGHIVHVHSAPTEADVMFAAELAELARSHEGYRLELRATRTQGRLD
LGRLDDVVPDWRDRQTWACGPEAMLEAAERTWKAAGVGERLHQERFAVSR
APVHGSGGTVTFARSDKTVTVDAATALMDAGEDAGVQMPFGCRMGICQSC
VVGLVEGHVRDLRTGVEHEPGSRVQTCVTAASGDCVLDV
315445574YP_004078453.1 fatty acid desaturase [Mycobacterium gilvum Spyr1]MAITDVPEFAHLTDADIENLGRELDAIRQDIEDSRGAQDARYIRRTIAIQ
RGLEVAGRLMLAGSAKRSYWWAGTATLGVAKIIENMEIGHNVMHGQWDWM
NDPEIHSSSWEWDMSGASKHWRFTHNFMHHKYTNILGMDDDVGYGVIRVT
RDQRWTPMNLGNLFFNTLLCVAFEWGVGLQHLELGKIFKGRDDRKATMGR
VKEFGVKAGQQVVKDYVAYPAITSLSPRATFKSTLTANAVANVIRNVWAN
AVIFCGHFPDGAEKFTKTDMIGESRGQWYLRQMLGSANFEGGPLLRFMSG
NLSQQIEHHLFPDLPSNRYYEISLRVRELCDKYDLPYTTGNFLVQYGKSW
RTIAKLSLPDRFLSDTRDDAPETRSERMFDGLEPTERSGLKSAIAAVRSR
RRAKRAQKAAVKGQDLAA
315445573YP_004078452.1 aldo/keto reductase- diketogulonate reductase [Mycobacterium gilvumMTHVPAIELNDGASIPQLGFGVYQISPEDTADVVRQALEVGYRHIDTAQM
YQNEKGVGQGIRNSGIDRGDVFVTSKLNNGFHTPEDARRAFDETLKALEF
DYVDLFLIHWPLPTLYDGDFVSTWKTLEEFTKDGRARSIGVSNFQVAHLQ
RLADETDTVPAVNQIEVHPYFANDEVRAYGTEHGIATEAWSPIAQGKVLD
DPVVTRIAEATGKTPAQVVLRWHIQRGDIVFPKSVTLQRIKDNFALFDFE
LGAEDFDAVSGLDKGEAGRIGPNPDTFDYVPS
315445572YP_004078451.1 GTPase [Mycobacterium gilvum Spyr1]MSPREYDETDVRVRPGRGSRPRTKTRPVHADAEHAMVVTVDRGRWGCVLG
NDPGRRVTAMRARELGRTPIVVGDDVDIVGDLSGRTDTLARIVRRGERRT
VLRRTADDTDPTERVVVANADQLLIVVALADPPPRTGLVERALIAAYAGG
LVPILCLTKTDLAPAEPFAEQFRDLDLTVLTAGRDDALETVDALLANKVT
ALLGHSGVGKSTLVNRLVPEADRATGAVTDIGRGRHTSTQSVALPLLHGG
WVVDTPGIRSFGLAHIAPDDVVMAFSDLADAIDGCPRGCGHMGPPADPGC
ALDALTGAAEGRVHAARRLLAALRES
315445571YP_004078450.1 3-phosphoshikimate 1-carboxyvinyltransferase [Mycobacterium gilvum MVGVSNWPAPSTATPVHATVTVPGSKSQTNRALVLAALAAREGSSRISGA
LRSRDTDLMIGALETLGLSVAASDSDPADLTVSGTLAPAAEARVDCGLAG
TVLRFVPPIAALSAQTVTFDGDEQARSRPIAPLLDGLRTLGVDIDGDGLP
FAVRGTGTVAGGTVEIDASGSSQFVSGLLLSGAAFTDGLTIVHTGDSVPS
APHIAMTVSMLRDAGVEVDDSAPDRWRVSPGPIGARDWVIEPDLSNSVPF
LAAAVVSGGAVRITGWPTVSIQPADTILKILAGLNGEVRKGSSYLEVQGA
TNYGGIDVDLRDVGELAPSVAAMAALADPGSVSRLRGIAHLRGHETDRLA
ALSTEINGIGGQCEETEDGLVITAREMHGGTWSSYADHRMATAGAIIGLR
VPGIEVEDIGTTAKTLPDFPQLWADMLGGQTDDLQQGPSARETPGR
315445570YP_004078449.1 hypothetical protein Mspyr1_40270 [Mycobacterium gilvum Spyr1]MGFMCGRFAVTTDPALLAEKIKAIDESTAASKDRPTADYPTANYPTANYN
VAPTTTVATVVKRHSEPEDESTRRVRLMRWGLVPPWVKAGEDGGPDTKSG
PLLINARSDKVTSSPAFRSSAKTKRCLVPMDGWYEWKGTKGAKTPYYMYA
GDGVPLFMAGLWTTWRPKDAPKGAKPLLSCTIITTDAAAQLADIHDRMPL
TISEPDWDRWLDPDAPIDEGLLRGHGDLDRIEIREVSRLVNSVRNNGPEL
IEPVTPQAEQGTLL
315445569YP_004078448.1 methyltransferase family protein [Mycobacterium gilvum Spyr1]MTGPLHAGSVVDAIAADMRSANYTTDGVADLLGADAGAAFSRGLWWSALR
ATDRAAADRERLATLIRLFLLGTEEARDRVALAVPTSDVDALIDNGVLEQ
TPDGALRAALDIRPTSDGAADFLVVSDQDAALRAGPVRRDHVLGIGGASV
SLAHAVVRDPVGRALDLGTGCGIQALHLEAHCDEIVATDTNPRALALAAA
TARLNGMSWDLRCGSMFEPVAGERFDLIVSNPPFVVGTGSLDYIYRDSGM
AGDGLCQNLIAQVRDHLRPGGTAQIMANWIVRDPQNWQERVHGWLADTGL
HAWVVQREFADPVSYVSLWTSDAGESPEQAARRGGEWLDWFDAEGIAGVG
MGMITLRAPRDGETRSPDQVVEEITGAGEALTGPEVGAFFARREYLDRTG
DEQLLAAKLSTAPVFLEEQSLPGPDGWQVVGSAVRRPGGPAAVIGVDEVS
RALFAGCRGEVPLGTLIELLAGYHGVDADALADAAMPVVREAIGRGILYE
AG
315445568YP_004078447.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTSSTFWSAGRYDAVGDRIAPIAREVVDAADARRPLRDAAVVDLACGTGS
AALDAAARGAKVTGVDITPELIAIAAERDGAAEVRWHTGDASDTGLPATS
FDAAVSNMGIIFVEPARQVAEVVRLLKPGGVFAFSSWVRSVSNPLFDPVL
AVLGPPATSTFSPDQWGDEAVLTERLGSQFDGVDVRRGDHRWEFESMPAA
MRFLTSESPMHVETFRRAETSQRARLAAEFEDALRPHLEPSGSVAFLSPY
VVVTATLRG
315445567YP_004078446.1 hypothetical protein Mspyr1_40240 [Mycobacterium gilvum Spyr1]MSLAGKTMFISGASRGIGLAIAKRAAADGANIALVAKTAEPHPKLPGTVY
TAAEEIEEAGGQALPIVGDVRDGDSVVAAVAQAVEKFGGIDICVNNASAI
NLGSIEDVPLKRFDLMNGIQVRGTYAVSQACIPHMKGRDNPHILTLSPPI
LLESKWLRPTPYMMAKFGMTLCALGIAEELRDARVASNTLWPRTMVATAA
VQNLLGGDESMARSRKPEVYSDAAYAILTKPSSFTGNTLLCEDVLLEAGV
TDLSVYDCVPGSELGVDFWVDSANPPGYTGP
315445566YP_004078445.1 ybaK/ebsC protein [Mycobacterium gilvum Spyr1]MARAATPAIAALVAAGVAHDVVQYHHDPRTDSFGAEAVSELAGAGGLAPE
QIFKTLVVSLPRGLGVAVLPVPSKLSLKAAAAALGAAKATMADPAAAQRS
SGYVVGGISPLGQRKALPTVVDASALNWDRILCSAGKRGWDVSLDPRDLV
RLTNAVTADICAL
315445565YP_004078444.1 RNA polymerase sigma-70 factor [Mycobacterium gilvum Spyr1]MVPVMAMKAPSRSVFVLDVIGGAATEGTVFPTMTDTNGLAASPAPADAGE
AREETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAY
SGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLAA
NAEHTSTGLRSAEVEALELLPDSEIKEALQALPEDFRMAVYYADVEGFPY
KEIAEIMETPIGTVMSRLHRGRRQLRELLAGVARDRGFIRGEQLEAPEEV
TS
315445564YP_004078443.1 anti-sigma factor [Mycobacterium gilvum Spyr1]MSGIEGGGGVTDNPEERWTPPVGPIDPEHPECAAVIAEVWTLLDGECTVE
TRDKLRQHLEECPACLRHYGVEEKIKRLIAMKCSGERAPEGFRERLRIQI
SQTTIIRQG
315445563YP_004078442.1 hypothetical protein Mspyr1_40200 [Mycobacterium gilvum Spyr1]MAKRGRKKRDRKHSKANHGKRPNAGSKSVGR
315445562YP_004078441.1 pyruvate carboxylase [Mycobacterium gilvum Spyr1]MAEDVRAEIVASVLEVVVHEGDQIGEGDTLVLLESMKMEIPVLAEVAGTV
SKVSVSVGDVIQAGDLIAVIS
315445561YP_004078440.1 signal transduction histidine kinase [Mycobacterium gilvum Spyr1]MSTLGDLLAEHTILPGNAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGH
LVCVAQVRPNTAPTVLLADAVGTLAEADDIPIVAAAFRSGDIGRATVDGE
FGASGLNVEAVPVRHGSDVVAVLTHQTSLAPRQASPLEAAYVDCAGDLLH
MLSEGTFPNVGDLAMSRSSPRVGDGFIRLDEAGVVTFASPNAISAYHRMG
LSAELEGHNLVTVTRPLIADTFEAQELANHVRDSLAGGSSMRMEVDAGGA
TVLLRTLPLGVHGVGVGAAVLIRDVTEVKRRDRALLSKDATIREIHHRVK
NNLQTVAALLRLQARRTNNPEGREALMESVRRVSSIALVHDALSMSVDEE
VNLDEVIDRILPIMNDVAAVDSPIRINRVGDLGVLDADRATALTMVITEL
VQNAMEHAFDAETPQGCVTIRAQRSARWLDVIVHDDGRGLPEGFSLEKSD
RLGLQIVRTLVSAELDGSLGMHEAAEGGTDVVLRVPIGRRVRVSQY
315445560YP_004078439.1 transcription factor WhiB [Mycobacterium gilvum Spyr1]MDWRHKAICRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTAECLSWA
LESGQDAGVWGGMSEDERRALKRRNARTKARTNV
315445559YP_004078438.1 sphingosine/diacylglycerol kinase-like enzyme [Mycobacterium gilvumMRAVLIVNPNATSTTPAGRDLLAHALESRVELSVVHTDHRGHAIEIAQDA
ARGGVDVVIVHGGDGTVNEVVNGIVGQCGPGNPAPAVGVVPGGSANVFAR
ALGISPDPIEATNQLVDLLGAFRRGGSWRRIGLMDCGERWGVFTAGMGVD
GDVVAAVEAQRAKGRKVTASRYIRVAVREMLAATRKEPQLTLHLPGREPV
GGVHFAFVSNSSPWTYANSRPVWTNPDTTFETGLGVFATTSMNIWANLGL
ARQMNSRKPRLDAKHLIRDDDLAWVEVTSDTPVACQIDGDFLGPRDRMRF
TAVPGALQVVAPPARMGR
315445558YP_004078437.1 3-dehydroquinate dehydratase [Mycobacterium gilvum Spyr1]MTERRLLLLNGPNLNLLGTRQPEVYGSTTLAEIEAKVAEVAKDAGLQVRA
VQSNHEGVLVDAIHAARTECVGIIINPAAYSHTSVAIADALRSVGLPVAE
VHLSNIHAREEFRHHSYVSAVADMVVAGAGPLGYEMAVQFLADRLGP
315445557YP_004078436.1 hypothetical protein Mspyr1_40140 [Mycobacterium gilvum Spyr1]MTFRDSRMFTPRPVRLAGAIAALEGALALLMAVVLVVREAAGHHEDAISG
YGTAGWFTIMGSGVAAAGWALWTGRRWGRGIAVFANLVLLPVAWYVFSSG
WAGYAAVVAAAAITVLAGLFSPSGLHWLTQEPDPGTSREASSDRPGPDTR
315445556YP_004078435.1 acetyltransferase (GNAT) family protein [Mycobacterium gilvum Spyr1MSRRGERSDGGNICIRAVRPGDEAELTAMIHELAEFEHAAEECTVTESRL
AQALFGPEPAVYGHIVEVDGQAAATALWFRNYSTWDGVAGIYLEDLFVRP
QFRRRGLGRKLLATLARECVDNGYSRLSWAVLDWNANAIALYDGVGGKPQ
TEWITYRVSGPGLSELASRDVPGSGS
315445555YP_004078434.1 isochorismate synthase family protein [Mycobacterium gilvum Spyr1]MTREPTFVFAGPDGVVVGEGVHTAFPHIADARAALASHSSPIVVGALPFD
LSRPAALMRPQSVRFTDVMPEGPGRELASTEITETSPDADEHRRRIGVAL
ARLRDPADPLDKVVLARALLLTAQGRLDARTVLDRLASADAQATKYLVDL
SAAGEGYSGTALVGASPELLVARHGRQVLCRPFAGSAPRRPDPEDDAASG
AALVESDKNRHEHQLVVDALRAALEPLCTDLQIAPRPQLTRTAAVWHLYT
PITATLRERSTTALDLAVALHPTPAVGGSPTDRAVALIDELEGDRGFYAG
AVGWCDQRGDGRWVVSIRCAQLSADRHTALAHSGGGIVAESDPGAELDET
TTKFRTILSALGVES
315445554YP_004078433.1 fructose-2-6-bisphosphatase [Mycobacterium gilvum Spyr1]MGLLQHRLILLRHGETEWSKSGKHTSSTELELTEHGRAQARAAADTLKQM
ELDDPYVVSSPRVRATTTADLAGLTVDEVSPLVSEWDYGDYEGTTTADIR
KAVPNWLVWTHGCPGGETSAQVCARADQAIDVALGHMESRDVVFVGHGHF
SRAVITRWIEQPVYEGIRFAMPAASIAVCGFEHGVRQLSALAQTGLPNPA
VST
315445553YP_004078432.1 chromosome partitioning ATPase [Mycobacterium gilvum Spyr1]MTRVLAVANQKGGVAKTTTVASVGAAMVEQGKKVLLVDLDPQGSLTFSLG
HDPDKLPVSVHEVLLGDVEPDVAIVETPEGMSLLPANIDLAGAEAMLLMR
AGREHALKRALDKVSAEFDVVIIDCPPSLGVLTLNGLTAADEVVVPLQCE
TLAHRGVGQFLRTVSDVQAITNPDLKMLGALPTLYDSRTTHSRDVLFDVV
DRYGLPVLAPPIPRTVRFAEASASGASVLTGRKNKGAMAYREFADALLKH
WKTGKDLATFTPDL
315445552YP_004078431.1 hypothetical protein Mspyr1_40090 [Mycobacterium gilvum Spyr1]MAAAAIAGVIVLVAAVVWWTSDARATRSTPAAEPLPSLKPAVAVPDSLTQ
LWTARSGETTRPLVVGGAVVTGDGQAMQGREPATGDVVWSYARDLDLCGV
TWVYNYAVAVYPDARGCGQVSTVDAKTGRRGPARTSYADRHVTLSGDGST
VLSQGETRLEMWRSDMVRMLSYGALDAPIKPGVPATPLCRFVSAGASSDS
VSVLEACESQDLRLTLLRPSDEEDSPEAKYVQQTGVADGTGARVVAVSDT
YTALYVPTPKPRLDLIDDTGATVDTTIVDGPPSPEATMSKAGDLVTWWTG
DALMVFSGNDLRYKYTVAATGPDAPVGPATIMAGKLLVPVTTGYDVFDPE
TGTGEKHIPVQRPPVDGPVVPAVAGTTVLELRGDDLVALG
315445551YP_004078430.1 DEAD/DEAH box helicase [Mycobacterium gilvum Spyr1]MTPVTTHPNPTFAQLGVRDEIVRALAENGIEHAFAIQELTLPLALAGDDL
IGQARTGMGKTFAFGVPLLHRITTDTERPLTGIPRALVVVPTRELCIQVY
EDLVHASKYLMADDTRKLTVTAIYGGRPYEPQIEALQKGVDVVVGTPGRL
LDLAQQGHLQLGGLNVLVLDEADEMLDLGFLPDIERILKQIPAKRQAMLF
SATMPDPIITLARTFMTQPTHIRAEGVQGSATHDTTEQFAYRAHALDKVE
MVARILQAEGRGATMIFTRTKRTAQKVADELGERGFRVGAVHGDLGQSAR
EKALKGFRNGDVDVLVATDVAARGIDIDDITHVINFQIPEDEQAYVHRIG
RTGRAGKTGIAVTLVDWDELPRWSMIDKALGLDTPDPAETYSNSPHLYDE
LNIPTEAGGSIGKPARSADKPKREPREPRAERPARDRTRRRTRGGQSVSG
HPEGTPDAADTSSSEASDSDSAGDGAPRPARRRRRRRPNKASTAGTAAGT
SAGTN
315445550YP_004078429.1 hypothetical protein Mspyr1_40070 [Mycobacterium gilvum Spyr1]MNSTPSEAAASAPTGELGDLSGHADAPPISLDHAGITELFALLAYGEVAA
FYRLAEEARMAPNLSGRINMAAMAAAEMQHYEVLRDALGRRGVDVVPAMT
RYASALENYHRLTTPSTWLEALVKTYVGDAMAADFYLQIADVMPDEAAEV
VRSVLAETGHSQFVVAEVRAAVTASDRQRHRLALWSRRLLGEAITQAQFV
MADHDELVDLVMAGGGLSQMTEFFDRLQNTHNARMQELGLG
315445549YP_004078428.1 hypothetical protein Mspyr1_40060 [Mycobacterium gilvum Spyr1]MNRPYTAQSPYSLTPTERIRSGQASGRRGGGYGGSDVDELDRYGDSDTDA
LPPYRDYRPGDHDAHDAYDSDDYTDVENYDEYLDEARIDRRWMWIAGVAG
AILFVAVITVSMILGGGDSGSVSATVAAPLPTSSAPEPSAAPSPRAAAPA
SPSLPAETVTTVTPTAETPAPAPVAPSPLLPAPQAAPPPAAAAPGTVTYR
ITGNRALLDLVTIIYTDEQGALKTDVNAALPWTKTVVLNPGVTLSSVTAT
SVSGQLNCAILDANGSLIAVQNNNSIITNCTR
315445548YP_004078427.1 hypothetical protein Mspyr1_40050 [Mycobacterium gilvum Spyr1]MEVKIGVTDSPRELVFASAQTPAEVEKLVADALSGEPGVLGLTDEKGRRF
LVQSTRIAYVEIGAADSRRVGFGVGAVGSEAV
315445547YP_004078426.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSELAKTAPRRGGQPANGTGSSGAARRGNRLPRDERRGQLLAAASEVFVD
RGYHAAGMDEIADRAGVSKPVLYQHFSSKVELYLAVLQRHVDNLVSGVRQ
ALRTTTDNRQRVRAAVQAFFDFIEHDSQGYRLIFENDYVTEPQVAAQVKV
ATESCTDAVFDLISHDSGLEPHRARMIAVGLVSISVDSARYWLNNERPID
KDDAVEGTVQFIWGGLSHVPLTRS
315445546YP_004078425.1 hypothetical protein Mspyr1_40030 [Mycobacterium gilvum Spyr1]MTYDPGRGRVPVLRDEWREPLRAQRDPLAEHPGRVRSNRDEHRRWRKQTW
IGRFVSTYGWRAYALPLLVVLTAVVIYQTITGTSAPQAVEDEGPVQGPPT
IGVPSTSIVGAPPKGLTEFDANLPTGILPQGGPFTEAGAGTWHVVPGALP
QVGQGTTKVFTYTVEVEDGVDTTTFGGDEGFARMVSETLANPKSWTHNAQ
FGFTRVDAAAGVVPDFRVSLTSPMTIRQGCGYDIQLEASCYNPAFGGQPR
VFINEARWVRGAVPFQGDIGSYRQYVINHEVGHAIGYQRHEQCTENGALA
PIMMQQTFSTNNNDAARFDPGTVTPDGLSCRFNPWPYPIA
315445545YP_004078424.1 dinucleotide-utilizing protein [Mycobacterium gilvum Spyr1]MSTPLPPLVEPAAELTKEEVARYSRHLIIPDLGLDGQKRLKNARVLVIGA
GGLGSPTLLYLAAAGVGTIGIVEFDVVDESNLQRQIIHGQSDIGRPKAQS
AKDSVLEVNPLVTVNLHEFRLEPDNAVELFEQYDLILDGTDNFATRYLVN
DAAVLAGKPYVWGSIYRFEGQVSIFWEDAPADEGGRERGLNYRDLYPEPP
PPGMVPSCAEGGVLGILCASIASVMGTEAIKLITGIGDPLLGRLMVYDAL
DMSYRTIKIRKDPSTPKITELIDYEAFCGVVSDAAAEAAADSTITPRELR
ELLDSGKPLALIDVREPVEWDINRIEGAELIPKGGFESGEALSKLDNDRT
PVFYCKTGIRSAEVLAIVKKAGFADAMHVQGGIVAWGKQLEPDMVMY
315445544YP_004078423.1 hypothetical protein Mspyr1_40010 [Mycobacterium gilvum Spyr1]MAVTAERPPEHVLAAFGLSGVQPAPLGSSWEGGWRCGEVVLSMVADHARA
AWSAKVRETLFVDGVRLARPVRSTDGRYVVAGWRADTYVAGTPEPRHDEV
VSAAVRLHEAMAKLERPRFLTQPPIAPWGDVDVFIAADRAAWEERPLHSL
PPGARVGPGAADGQKSIELLNQLATLRRPTKSPSQVVHGDLYGTVLFAGT
AAPGITDITPYWRPPAWAAGVVVVDALSWGEADDALIERWAQLPEWPQML
LRALMFRLAVHALHPRSTAAAFPGLARSASLIRLTL
315445543YP_004078422.1 methylated-DNA--protein-cysteine methyltransferase [Mycobacterium gMAAITDDQVEVVRALVAAIPAGRVATYGDIAGAAGLSSPRIVAWIMRTDS
ADLPWHRVIPVSGRPAPHLAGRQLDRLRAEGVLARDGRVPLAEYRHTF
315445542YP_004078421.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMTEQLCTYRFGPAGPARVLAIHGLTGHGKRWESLFTRHLSDIPAVAPDLV
GHGRSSWDAPWTIEANVAALTALLDAEAEGPVVVVGHSFGGAIALNLAAA
RPDLIAGLVLLDPAVGLDGRWMREIADEMYTSPDYTDREEARQEKIGGSW
GEVAEDELDRELDEHLVASAGGRVGWRISIPAMLCYWSELTRPAVIPRDG
TPTTLVRATRTDPPYAGDELVAALDAGLGPNFTLLEWDCDHMVPLARPAE
TARLIRDLLP
315445541YP_004078420.1 DNA/RNA helicase [Mycobacterium gilvum Spyr1]MSAPQTELTTDALGRRDLRGTVRVLGGPGTGKSSLLVDTAVAHIAAGCDP
ESVLLLTGSARLSAQVRASITSALLGAGGRAAVREPLVRTVHSYAFGVLR
LAAQRNGSPPPRLITSAEQDGIIRELLAGDVEDGPASPVRWPEQLRPALS
TVGFATELRDLMARCSERGIDPVALQRIGRHAGRPEWQAAGRFAQAYEQI
MLLRSAVGMAAPQATVPALGAAELVGAALEAFAMDADLLSAERSRVQLLL
VDDAQHLDPQAARLVEVLAAGAELTVIAGDPHQTVFGYRGADPALLRGDG
PALILNRSHRCAAPLADAIAAITRRLPGADASREFTGRGEQGTLAVRIAA
SPHAESALIADALRRAHLVDGVPWDRMAVIVRSVPRTGASLGRALAAAGV
PVEDPHPDVPLANQPAVQALLTVLEATAEKLDGERALALVTGPIGRVDPV
SLRQLRRTLRRGVTAPDRGFGELLVEALGRDVAALPDEHARALRRLRAVL
TAARRSAEQGGDPRQTLWQAWNRSGLQKRWLAAAERGGPAAAQAERDLDA
VTALFDVAEQYVERTAGASLRGLIDHITGLSLPPARDDARSGDAISLISA
HAALSGEWDFVVLAGLQEGLWPNVSPRGGVLATQHLVDVIDGVAAPGHRL
SSRAPLLAEERRLLIAAMGRARSRVLVTAVDSDSGDEAALPSPFCHELAA
MATEPVPEPALPIRAPRVLSPAAVVGRLRSVVCAGSDEVSEDERVCAAAQ
LARLATAGVHGADPSSWYGARELSSDEPLWDGDDHVVTLSPSTLQMLADC
PLRWLLERHGGARGRDVRSTLGSLVHALVSESGTAESVLLDELDKVWGKL
PFDAQWHSDNERIRHLEMLATFLKWRSDTRGELTEVGTEIDVDGVVAGGD
GDGPGVRVRGRLDRLERDSEGRLVVVDVKTGKSPVSKDDAQAHAQLAMYQ
LAVAAGLIADGDEPGGGRLVYLGKTTGGRATERHQDAVTPEVRELWEARV
HEAAAATQGPSFVARVNDGCAHCPVRATCPAQNSRSQP
315445540YP_004078419.1 DNA/RNA helicase [Mycobacterium gilvum Spyr1]MSTPLYSPAELSRALGLFEPTEEQAAVIAAPPGPLVVIAGAGAGKTETMA
ARVVWLVANGYATPGEVLGLTFTRKAAGQLLRRVRSRLARLAGAGLTIPA
AGADLADDPVTIGTYHAFAGTLLREFGLMLPVEPDTRLLGETELWQLAFR
VVCEHPAALDTDKSPASITAMVLRLAGQLSEHLVDTEQLRDTHVELDRLV
HTLPAGRYQRDRGPSQWLLRMLATQTERTMLVPLIDALHHRMREERVMDF
GMQMASAARLASTHPAVGEQLRQRYRVVLLDEYQDTGHAQRVALSSLFGG
GADDGLALTAVGDPIQSIYGWRGASATNLPRFTTDFPLSDGTPAPTLELR
TSWRNPPEVLHLANAASVDARRRSVEVRSLQPRPNAEPGSVRAALLSDVE
AERDWVADQVAHRWHGGLAASGTAPTAAVLVRRNADAAPMADALSRRGVP
VEVVGLAGLLAVPEVADVVAMLRVAVDPTAGAAAVRVLTGPRWRLGARDL
TALWRRAVTLVDTGPSASDAVSATAEIVAKLEPDADDACLADAVCDPGPA
AAYSPTGYARIVALGRELTALRAHLSSPLPDLVAEIRRTLGIDAEVRAAQ
PISAGWSGTEHLDRFGDVVAEFASRGTPTASGLLAYLDTAEQVENGLAPA
EVTVSSDRVQILTVHAAKGLEWQIVAVPHLVGRVFPSTASARTWLTDAAD
LPPLLRGDCATVSAHGVPVLDTSDVSDRKGLSDKIAAHKSSLDQRRTDEE
RRLLYVAITRAEHTLLVSGHHWGATESKPRGPSTFLTEIRDVIDASTEDG
RPCGSIDVWADAPADGETNPIRGRVVEAVWPVDPVAGRRGPVDRGAHLVA
EVLSGECPEVGSDDDHGWVADVDALLAERDLAAQRAVPSLPAQLSVSAMV
ELGRDPEAVAHRLQRRLPRRPDSHALLGTAFHEWVQRYFQAEKLFDLDDL
PGAVDADRQDRGELDELQTAFAVSPWAARTPIDVEVPFDMMLAGRIVRGR
IDAIFADGDGSFTVVDWKTGEMPTDPEVLAHNALQLAVYRLAWARLHGCP
TSAVRAAFHYVRSGRTVMPDALPEEDDLIALLADRDDEDAA
315445539YP_004078418.1 hypothetical protein Mspyr1_39960 [Mycobacterium gilvum Spyr1]MTSSPSALQRISTSSRGARMGAWLVGMGVLHFAAPKPFDTIIPEELPGSA
RFYTYASGVAEVGVGGLLLVPATRRIGALSAIALFVGVFPGNANMVRMWF
RDPTKNLAMRLGAIARLPLQVPMITQAWKIYKES
315445538YP_004078417.1 K+ transporter- NAD-binding component [Mycobacterium gilvum Spyr1]MAEGRLRRRLRRFDQSLADMPVHALTDRVQIPTETVSPARRITVRVIYAL
GALFAAVLIVYLDRDGYRDSQENPLSFLDCLYYATVSLSTTGYGDITPIT
PEARLINVLVITPLRVAFLIVLIGTTVETLTTQSRQVYQIQRWRSRLRNH
IIIVGYGTKGRTAAAAMVGDEIAPGDIVVVDEDTSALDRAKSAGLVTVRG
TATDSEVLRLAGAQHAKTIIVAANRDDTAVLVTLTARELAPRAQIIAAVR
ETDNEHLLKQSGADSTVVTSETAGRLLGIAVQTPSVVEMMEDLLTPDRGF
AIAEREVSPKEAGGSPRHQTDIVLGVVRNKKLIRVDDPEVDALELGDRLL
YIRSADEDR
315445537YP_004078416.1 Zn-finger containing NTP pyrophosphohydrolase [Mycobacterium gilvumMTPFRLRNIPLLSRVGADRADTLRTDIDAAIAGWSEALLLRVDRRNQVLI
SDGRAVLNRAVSVGPSPPENAVFLGKLDDGRHVWAVRSDLQPPEDETTPV
QVLDLRRTGDVFDDVSAQLVATATALLNWHDSARFSPVDGAPTTPIKSGW
ARINPVTGQEEFPRIDPAVICLVHDGHDRAVLARQTVWPPRLFSILAGFV
EAGESFESCVVREIAEEIGLTVTDVEYLGSQPWPFPRSLMVGFHAVGDPE
QPFSFNDGEIAEAQWFTRAEIREALDQGDWSSDSSSRLLLPGSISIAREI
IESWAALD
315445536YP_004078415.1 glutaredoxin-like protein [Mycobacterium gilvum Spyr1]MSTDVPAVTMYTTSWCGYCVRLKKVLKNEGITFAEVNIEEDPAAAQFVGS
VNGGNHVVPTLKFADGSTLTNPTGAQVKAKLAS
315445535YP_004078414.1 DNA/RNA helicase [Mycobacterium gilvum Spyr1]MMVAMSPTASRDRLLGDLDDEQREAVLAPRGPVCVLAGAGTGKTRTITRR
IAHLVTAGHVAPGQVLAVTFTQRAAGEMRGRLRALDEGSGTGGVQAQTFH
AAARRQLSYFWPRVVGNTEWQLMDSKFAVVAQAANRGGLPTGTDNVRDLA
GEIEWAKASLISPETYADAVAEVSRDIPFDAAKIATVYANYEALKTRNEG
LVLLDFDDLLLHTAAAIENDPAVAQEFRDRYRCFVVDEYQDVTPLQQRVL
DAWLGNRDDLTVVGDANQTIYSFTGASPRYLLDFSRRFPEVTLVRLERDY
RSTPQVVSLANRVIAGARGRMAGSRLHLVGQRPPGPEPVFKEYPDEVAEA
AAVAKSIRTLIESGTAASEIAVLYRINAQSEVYEEALTEAGVAFQVRGGE
GFFSRQEIRQALLALQRVAERGAGDTGGSLPEIVRAILEPLGLTAEPPAG
TRARDRWEALVALAELVDDEVAQRPHLDLRALLTELRQRADSRHPPVVQG
VTLASLHAAKGLEWDAVYLVGLADGTLPISHALSHGPDSEPVEEERRLLY
VGVTRARVHLTLSWALARKPGGRQGRRPSRFLTGIAPQSQRDDGPSRSRK
PRGPAPRCRVCNAQLTSPTAIMLRRCESCPSDIDDELLAELKDWRLRISK
EMSVPAFVVFTDNTLIAIAESMPTDDAALVAIPGIGARKLEQYGPDVLAL
VKGRQKS
315445534YP_004078413.1 hypothetical protein Mspyr1_39900 [Mycobacterium gilvum Spyr1]MISNDMITSFSATGMLRTLHVPSQVHPAHPIAAAAAAAVAAPRKRRAAAG
TIAASVKGYPEVPARH
315445533YP_004078412.1 transcription factor WhiB-like protein [Mycobacterium gilvum Spyr1]MSSPTCEMTPSSETRQPFETRQPAVPCHVEDPDLWFAEDPRDLERAKTLC
ADCPVQRACLNAALERQEPWGVWGGEILERGSVIARKRPRGRPRKDSKSP
VAA
315445532YP_004078411.1 protein kinase [Mycobacterium gilvum Spyr1]MSEIKRGSVARNAKLASLPVGMAGRAALGFGKRLTGKSKDEVNAEMMDKA
AQQLFTVLGELKGGAMKVGQALSVMEAAIPEQYGKPYREALTKLQREAPP
LPAAKVHRVLDQQLGTKWRERFQTFDDKAVASASIGQVHKAVWADGREVA
VKIQYPGADEALRADLKTMQRMVGVLKQLSPGADVQGVVDELIERTEMEL
DYRLEADNQRAFAKAYAGHPEFVVPRVVASAPKVVIQEWIEGIPLSHIIR
EGTQEQRDLMATRLFEFCDDAPTRLEMVHGDAHPGNFMLLPGDKMGVIDF
GAVAPMPGGWPIELGQMLRYAVDKNYDKLLPTMEKVGFIQKGQTVSTREI
DDMLKQYVEPLEVEVFHYTRRWLQKMTTLELDKAAGQIKAARQMDIPPKL
AIPMRVIASIVAISCQLDAHVPTRRIAMENVPGFADPDGV
315445531YP_004078410.1 hypothetical protein Mspyr1_39870 [Mycobacterium gilvum Spyr1]MTRYALSPATPVLSRPDGTVQVGWDPRKAVVVRPPAGLPGSVLAELLRAL
QGVATAPQLQRLAAGYGVDAPVVDGLVAHLITRGVVTEAPRTPVRSVAVR
VHGDGPLADLLINSLRHANVRVSHSTRPNASSGRPDLVVLTDYLVADPRL
VRDLCDARVPHLPVRVRDGTGLVGPLVIPSVTSCLRCADLHRSDRDAAWP
AIAAQLSRTVGNADRATVLATAALALNEIDHIVRSLRPDHPGAVAASPET
LDTTLEFDVAAGTVQARRWTRHPDCSC
315445530YP_004078409.1 hypothetical protein Mspyr1_39860 [Mycobacterium gilvum Spyr1]MADLPFGFSAGDDPDRDKRNKDNSGSGPGSGADPFGLGMPGAGGEFDMSQ
LGQIFSKLGEMFSGAGTSMSGGTSGGPVNYDLARQLAASSIGFVAPIPEQ
TTSAIADAVRLAETWLDGVTPIPAGTTRTAAWTPTDWIDNTMSTWKRLCD
PVAEQISTVWAQALPQEAQAMAGPLLAMMSQMGGMAFGSQLGQALGTLSK
EVLTSTDIGLPLGPKGVAALMPEAVESLAEGLEQPRSEIVTFLAAREAAH
HRLFSHVPWLSSQLLNAVEAFAKGTKIDMSGIEEFARGFNPASLTDPSEM
EQLLNQGIFEPKATPEQTAALERLETMLALIEGWVQTVVTDALGDRIPGT
SALSEMLRRRRATGGPAEQTFATLVGLELRPRKMREAADLWVRLTEAVGA
DARDGVWQHPDLLPSASDLDEPAAFIDRMIGGDTSDIDSAIADLERDFRR
GDSGPGESTE
315445529YP_004078408.1 hypothetical protein Mspyr1_39850 [Mycobacterium gilvum Spyr1]MNRRISTLVVALAPILIFGILLSAVTVPYVALGPGPTFDTLGEVDGKEVV
DIEGADVHTTSGHLNMTTVSQRDGLTLGQALIFWASGRDQLLPRDLVYPP
DKTREEIDEANSQDFRQSEDSAEYAALHHLKYPMAVTVESIDEEGPSKGK
LQGGDAIDGVNGKPVATLDQFQELLKAYKPGDTIAVDYRRKNAPMGTAEI
TLGKHPDRDQGILGVNVLDAPWAPFTIDFNLANIGGPSAGLMFSLAVVDK
LTTGDVTGGKFVAGSGTISGDGKVGSIGGITHKVTAAQEAGATVFLVPAD
NCAEARTADADGIELLKVETLEQAVDGLRTLSAGGEPPRC
315445528YP_004078407.1 hypothetical protein Mspyr1_39840 [Mycobacterium gilvum Spyr1]MRPAARMPSLTQRSRFLIAVSAVLVLLLLLGPRFIDTYVDWLWFGELGYR
SVFTTQIITRLVIFFVVAILVGAVVFAGLALAYRTRPVFVPTAGPNDPIA
RYRTAVMARLRLIGIGVPLAIGVLAGFVGQSYWQRVQLFLHGGDFGVSDP
QFGIDLGFYAFDLPFYRLVLTYLFVGVFLAFLANLLGHYLFGGIRLAGRS
GALSRAARIQLITLVGLLMLLKAVAYWFDRYELLSHTRGGKPFTGAGYTD
INAVLPAKLILMAIAVICAVAVFSAIFLRDLRIPAIGVVLLLLSSLVVGA
GWPLVVEQISVRPNAAQKESEYISRSITATRQAYGLTEESVTYRDYPGNA
SATAQQVAADRATTSNIRVLDPNIVAPAFTQFQQGKNFYFFPDQLNMDRY
RDDSGNLRDYVVAARELNPDRLIDNQRDWINRHTVFTHGNGFIASPANTV
RGIANDPNQNGGYPEFLASVVGANGEVSSPGPAPLAQPRIYFGPVIASAA
DDYAIVGESGTPREYDYETNTDTRNYTYTGSGGVPIGNWLTRSVFAAKYA
ERNFLFSNVINENSKILFNRDPADRVEAVAPWLTTDTTVYPAIVNERIVW
IVDGYTTLDNYPYSELSTLSSVTTDSNEVAQNRLQLDKQVSYIRNSVKAT
VDAYDGTVTLYAQDEQDPVLQAWMKVFPDSVKPKSDITPELQEHLRYPED
LFKVQRALLAKYHVDDPVTFFSTSDFWDVPLDPNPTASSYQPPYYIVAKD
LAENNGSASFQLTSAMNRFRRDFLAAYISASSDPETYGRLTVLTVPGQVN
GPKLAFNAISTDTAISTELGQIGRDGQNRIRWGNLLTLPMGDGGLLYVAP
IYASPGNTDAASTYPRLIRVAMMYNDQIGYGPTVRDALTDLFGPGADATA
TGPAATEPPAGQAPQTQGNNTAPPAAQPPNRQGQAPAGRPEVPVAVPPTG
PTQLSAAKSAALQDVNAALDALRGAQESGDFAQYGEALQRLDDAVNKYQE
TD
315445527YP_004078406.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MRYRLLGPLQVVHGEAAVDIGPRKQRSVLAALLLAQGRVVSTDRLVDVVW
GDDVPASATASLQVYISNLRRALRSGAGDRTVSSVAQPIVRQPPGYFLDA
GPDESDIAVFTAACARAAAAIDGERWDEALAEADTALSLVRGELLEDIGD
ADWIREDAARFAEMRTECLAGKVMSLLALGKIPAALTAASQLGALDPLAD
RGCRLQMLALYRAGRTADALEVYTRYARRLDAELGLEPGPELRDLQTAVL
RQAPELSGWPRSPGWTGAAAVTATEAVPVRLDTVESASHRAPLVGRRREL
AAAADVLDRVTAGAARWLVLSGPPGIGKTRLAEEIAGLVAAGDGDVVWVN
CPDERGTPPWWPMRQLVRALGADADEVLEIPPHADPDTARFLVYERIQRL
LESAPRLLAVVVDDVQWADTTSAACLAYIAGTLRDRPVLVVVTVRDGEHP
AEVSRLLSTVARGEANRLIEVPALSSEDVATLANEVAEEVVTAAEAAELA
DRTGGNPFFVSEYARLPREERAGNEIPRAVRSVLDRRLAALDPAVMQVLR
AAAVIADVLDSVTVPLLARTTALDLDTLADYLDEAADERIIVNSHTGDGY
VFAHGLLREQLLTGMPALRRQRVHAKVADVLADSALPDAPTWRAQHLVAA
QPLVEPTVVVPACRLAAEQATQQWSSDIAAGWWQAALDAYDRLPASERDD
ADRDALTVELLEAHSRAGRGQLVLDSVTRYLGEALRTGRAASAGRVASAL
LRASGGWPWLAPGNDPGELLTLLSRAATLSEGEPASAARVLPALAVGHCY
HPDPTIAPELLDRAERLAEATGDPDVIADVLIGRLITFSGVATLSAQSLE
WVERLNALRHSRSREDAVVAHSVATMAAMNLGDVDGARRHVQAGIAGSEE
LQLPVLRAQLRWMEAVLAVWHGDFAEAGRHHAIAAHVHEQTELYEAGSGL
LARATLLRERGGPVDPSWTDLNAQQAGGLGMVGVVRTGVLTLLSGPKARA
EALATLRHWAQHTDRAHIWTTLGHHTLLAHLAVDHDLPDFAEPLLAQLDP
YRDRIAVIGQVGMAGPVALATARLHALRGDKVAALTDLAVARTIAERSAG
VPTLLRCRLLECELAEESPGRSAAASALAAEAADLGMAAVVEAASRLV
315445526YP_004078405.1 hypothetical protein Mspyr1_39820 [Mycobacterium gilvum Spyr1]MYARSSTVHARSSAVDAGITYIHDTVWPGLTELDGYVGLSLLVDRQTGRC
IVTTAWDSEEAMHASRRTADTYRDHAAEILGGSPTVDEWEIAALHRDHRS
SPGACVRVTWARVAHENVERAVDGFRLATIPALEELDGFCSASLMVDRDS
GFGVASVTFDSAEALRRNRQAMEELRSATIRDAGAEILDECDCDLVLAHL
RVPEMA
315445525YP_004078404.1 FAD/FMN-dependent dehydrogenase [Mycobacterium gilvum Spyr1]MTVPTDLRRDEALRSLRDQVATPVALPGEPGYERCRPWNVVAPVEPAAVV
LATSPEDVAGTVRFAAAHGFRVTVQATGHGAVGVGPDTILIQTSAMRHVS
VDVVNGTARVGAGARWQDVLDVATPHGLAPLCGSAPGVGVIGYLTGGGIG
PLVRTYGLSSDHVRSFDVVIGEGRLLRAAPDENADLFWGLRGGKATLGIV
TSAEIDLLLVPEFYGGAVYFAADDVADVLRAWAAWCVDLPETINTSIAIQ
QLPPLPEVPEPLAGRMTVAVRYAAVGDVDEAEQALAPMRAVATPVLDTVG
VLPYAAIGAVHADPVDPMPINEDQALLRELPPEAVEALLAAAGPESGSPQ
AIVELRHLGGALAREATHRSAFCHRNAAFSLAVIGVPAPEIAGMVIAHAG
AVTGAVAPWSTGGQMPNFAPSYDPARPSRVYTDDTLHWLAGLADRYDPAR
TLATGQVIRTVV
315445524YP_004078403.1 molecular chaperone of HSP90 family [Mycobacterium gilvum Spyr1]MAPHVEQLEFQAEARQLLDLMIHSVYSNKDSFLRELISNASDALDKLRLE
AFRNKDLDVDTSDLHIEIVVDKEARTLTVRDNGIGMSRDEVVRLIGTLAK
SGTAELRQQLREAKDANANEELIGQFGIGFYASFMVADRVELLTRKAGES
EATRWESTGEGSYTIETVDQAGGEVPQGTSVTLHLKPEDREDELHDYTSE
WKIRELVKQYSDFIAWPVRMDVERRTPASEEGGEETVTVETQTLNSMKAL
WARPRDEVSDEEYTEFYKHVAHAWDEPLETIAMRAEGTFEYQALLFIPSH
APFDLFQQNATVGVQLYVKRVFIMGDCDQLMPPYLRFVKGVVDAQDMSLN
VSREILQQDRQIRAIRRRLTKKVLSTIAEMQAERPEKYRTFWTQFGRVLK
EGLLSDTDNQDTLLRVSSFASTRSDDEPTTLAEYVERMPEGQTQIFYAAG
ESRQQLLNSPHLEAFKAKGYEVLLLTDPVDEVWVESIHEFDGKPLQSVAK
GEVDLDSEADKEAQETERQEREKEFADVIAWLTEVLGDHVKEVRLSTRLT
DSPACLITDTFGITPALARMYRASGQPVPVEKRILELNPTHPLVVGLREA
HKSRGADDELAGTAELLYGTALLAEGGALEDPARFAGLLADRLTRMVGDQ
S
315445523YP_004078402.1 monosaccharide ABC transporter substrate-binding protein- CUT2 famiMRRSRTALLGAVGVTMSLVAASAGAANASPDAGDVTMVNVVKVEGIPWFN
RMAVGVENFASRTGVHASQVGADDTSAQKQVQLIADLIPRRPTAITVVPN
SVDALEDVLGQARAQGITVVSHEATGIRNADIDIEAFDNAAFGRQTMQSL
AQCMEGQGEYVQFVGSVAMTTHMQWVDAAHDMQLAEFPGMTRIEGPVETA
NDEPTAYARATELLVKYPNLKGFQGAASTDVPGIARAVRDAGLQDRTCVM
GTAVPSVASTFFADGSIDKIFFWDPAMAAEAQLQIALMLVQGEKIETGTD
LNVPGYDSLTKLDGYDNVFVGNAALEADANTISQYQF
315445522YP_004078401.1 fructose-2-6-bisphosphatase [Mycobacterium gilvum Spyr1]MPDPRTCRVRRILIAALSAVLLVLVSAIPSWAMTLTFVRHAESLANEAGI
IDTRVPGPGLSEAGELQARAIAPVLAGMGFDGIYVSSMLRTQLTAQPMLD
LLPGSSYQVLPGLREISAGIFEGSSENEGLGRLGYALAPVTWMLGARFVP
VPGGEDGNAFDARVDGAIAEIADNGDENAVAFAHGATIMFWVMMNVDNPD
LLLMLRHQLDNVESVVVEGSPEEGWTLVSWAGQAVSADPSLATKLLVNVR
DLVVAPQTALYNVGTAFSSGDFETLVNAVRDGLIEVTRAVVRFIPDTVRD
IVDEFRPSVTEDSLDVTELHRAVVTAAPQDDDEAEPQSVAVAEAETRNGS
GVAPAGSTPPSGDEVTGSTDDDEATASDVVLEDTVDVDTIDVDTVEEDTG
ASDHAVGNHPDAEADDAAPANGSAKSSDDDGDSDDDASERAAA
315445521YP_004078400.1 hypothetical protein Mspyr1_39760 [Mycobacterium gilvum Spyr1]MTTYVRHPLTAVWAVLTVVTVVSWLTARDGGASHHLNATVTVVVLLIAAV
KTQLVIWHFMEVRDAPRWLKVTTNGWLVAVVGLLLGFYFAAL
315445520YP_004078399.1 heme/copper-type cytochrome/quinol oxidase subunit 3 [MycobacteriumMTGLGVAEAHETPRKAKGRGHLPGEPSMWFFVIGDLTIFGVYFVVYMYYR
GQDHQLFLESQARLNTDIGAVNTVVLLTSSLFVALGTSAVRAGKVSDAHR
LFWMALVTGAVFPVLKAFEYVPEVTAGLTPGTNLFFMFYYVMTGMHLCHV
LLGLAILYFVIRDLRGPTEPRISLVATGATYWHMVDLLWIMLFALLYLMR
315445519YP_004078398.1 hypothetical protein Mspyr1_39740 [Mycobacterium gilvum Spyr1]MSTDTAPAHAGGRARRPRRPAKLDQWIAFWSVPVFFSLFGLVFIPLSWMM
PPRSPSSPQDEIVAFMQSPNLLIACVILILAFGLAPVSNACYLNQIRRMS
VSPALRYALMAGATTGTIVGMLFPMFCFGLGAFRPGYDPAILAMLYDLGY
LAFIGSLGCFCIMWMAFGLAIILDKNTILPKWLGYYTVWQYVTELMAAPV
WIAKTGPFAWNGLLTFWFAMALYVSWQMIVYVCIFRAIKNQPDDELDNAA
LIAPPTGPPVRSGADS
315445518YP_004078397.1 hypothetical protein Mspyr1_39730 [Mycobacterium gilvum Spyr1]MTTTTAAPSAAMNTRGQRILLWTVPPAAALFVLAYFLFPVFSAPLSPTMT
PEQVAAFFADNVTGILGVAILCNLIACSLVPLFAVTAVQISRIGTSSNVF
TYAYMLCVGVGLTAFILADYCWAMAAFRTDRDPQLISLLNDMAWFFFIAP
VGTIVVANLCLAVSIYLDARPEPVFARWVAHFNVATAVLLVPSAFSLLYK
SGPLAWDGAVSFDLRMIVLAVYVAVMFVVLVGVVNRQGAERDETV
315445517YP_004078396.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MRQNGRVPNSATQREVQRQNTRARLLDAAIVEFQRSGTGGADINAIVKAA
GVARSTFYFHFPTKEHVLLELIRRDERHLAEELDRFLETRHDLPTVLTTI
VELVLDLESRWGGALFHDVIRLYFSPARPEREQWINHPIFVLLAAEIERS
RIRGELYDDVDAYHSAAFFLLGLYALLTTVGESRSERDLALTKFVTSTLR
SLRPASPR
315445516YP_004078395.1 EAL domain-containing protein [Mycobacterium gilvum Spyr1]MRDLVGELIASIDPQSLLQRIVEQVCVRMPTASGASVALKTPGDYLEVLA
TYGVTGAVQGRVVPIDETFQVYPLGSGRPEIVDDTATDERITPQVRELSQ
QLGVRSCLSIPLISEGSAIGTLSVVAHEPYAFGASDVAPVSAVAEFLGVL
ISASAQLAALLKDLLGAGSIRVDSRAAADLLASVLLPELSERDELRRVID
DVVMAGEIVPVFQPIFDLITGEVIGFEGLSRFKCEPTRSPDKWIALAHNV
RRGIDVELKALRALLKGALSIPDKYLVSVNLSPLALADPIIQQELLSYPR
GVVVELTEREPAPELLGESVEPLRQSGIRLAIDDAGSGFAGLTTILRLRP
DIIKLDRELTVGIDTDPSRRALATALTHFAREIDAYTVAEGIETEVQMQL
LRDIGIRYGQGYFLGRPQPVDVFEESLFSRA
315445515YP_004078394.1 thioesterase superfamily enzyme [Mycobacterium gilvum Spyr1]MSDDPAIELAGSVRRLIDATIRTLADDATIRAVQSQIDSLTAQLTVETIP
GAVGVHHVAGFSRVAGNVIIGERNAIAPPLTMHHRDDGGVATDFALGVAY
EGPPGHVHGGVCAMILDHVLGAAVHQPGRPAVTGTLTLRYRRPTPLDAAL
RAEARIRETQGSKTFVEGFITHGGEVTVEADGIFLFPRR
315445514YP_004078393.1 hypothetical protein Mspyr1_39690 [Mycobacterium gilvum Spyr1]MTTHPELLVPDPATMRHVLGHFCTGIAVITGHDGVRPLGFACQSVTSVSL
EPPYISFCPASTSATWPLIRSTGRLAVNVLARDQRELCAQFATSGGDKFR
GVSWSPGHNGSPVLDGTVATIEAELEYEHGAGDHTIVVAHVTGLRAARDT
EPLLYFRGAYGGLDASAP
315445513YP_004078392.1 PadR family transcriptional regulator [Mycobacterium gilvum Spyr1]MTDSADSGSGRKPGLAATSYALLGLLSYEQELSGYDIRKWIGWTMRFYYG
SPAYSQIYSELKKLESLGLVTSRVESTGGARSRRLYKIAPAGLDEVIRWA
NDEPFDPPSLKHGPLLRMTFGHLSTPARLKELLNEHIAYADDMEREAAKD
ARLAGADPSWAYARVALRWAERYYANERELALQMIKDLDEAEAEFPRAAH
GDQAAVAWPEPAYWYEVEQRAQSEADS
315445512YP_004078391.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMDGRCSTHQEAVYRLRAAAPNVTAVTAASATIPAGLPVSDTTVDLLVVGS
GTGMSAALAAHEAGLSVLIVEKSDYVGGSTARSGGALWLPASPVLGAAGA
GDSVERARTYLDAVVDGAAPAERSAGFLAHLTGTLDMLRRTTPMKLFWAR
EYSDYHPEQPGGSAAGRTCECRPLDTAVLGEYLPRLRPGVMEVTIPMPTT
GADYRWLNLMTRVPRKGLPTIAKRLGQGVGGLLLGRRYAAGGQALAAGLF
AGVLRAGIPVWTDTALVELTGDDARVTGAVVSHRGAEITVTARRGVVLAA
GGFDHNMDMRWKFQSESLQPGVSLGADTNTGDAIRIAQDRGAAIGLMDQS
WWFPAVAPLPGKAPAVMLAERSLPGSLIVDQNGRRFANESSDYMSFGQRV
LELERTGTPVESMWIVFDQKYRNSYVFAAELFPRMAIPQSWYDAGIAHRA
DDFSELAGLMGVPPETFGDTMRRFNESAGAGIDSDFHRGESAYDRYYGDP
TVTPSPNLRPLAKGPFYAVKMVLSDLGTCGGLRADERARVLREDGAAIEG
LYAIGNCAANAFGATYPGAGATIAQGLVYGYVAALDAARG
315445511YP_004078390.1 ring-hydroxylating dioxygenase- large terminal subunit [MycobacteriMTVQPPADEVRLIEADAAPTRFARGWHCLGLIRDFGDGTPHQVNAFGQKL
VVFRAEDGSINVLDSYCRHMGGDLSQGTVKGNEIACPFHDWRWGGDGRCK
QVPYAKRVPRLARTQTWPTLEQDGMLFVWNDPQRKPPPDDVTIPRIEGAT
SDEWTDWHWYTTVVHTNCREIIDNVVDMAHFFYIHGSLPTQFKNIFEGHT
ATQFMSSGGRPDLGQAEGGVKLLGTTSLAAYHGPSFMIDDLTYHYEHGDT
KTVLINCHYPIDANSFVLQYGIVVQKSADLPEDLAVQTAVALGDFVKMGF
EQDVQIWRNKARIDNPLLVEEDGPVYQLRRWYEQFYVDVEDVTPDMVDRF
EFEIDTTRPRESWMKEVEDNIAAGRIPKLASGTT
315445510YP_004078389.1 hypothetical protein Mspyr1_39650 [Mycobacterium gilvum Spyr1]MTVRPDNRLADGPMAPVQCNRCAATVLVRKSSWHQTSVQWDATATARCEE
RHDARQLAGEGGLFLTCSALGDSVADAVVRGTLHTVDDA
315445509YP_004078388.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMADEYDVIVVGFGAAGAAAAIEAADRGARVLALDRGYGGGATALSGGIIY
AGAGTAEQHAGGHTDSVDNLRAYLTQEVGDAVGEDTLTRFCAESPGLIEW
LKAQGVEFRGGPVSSYKTSYPTDDFYLYYSGNEKAYPYAQHAAPAPRGHR
VLAPGMSSGRVLYERLRDSAKAKGVTVIPLARVHGLITDAGRVVGVRYRV
LDQGHPNAHRHRVLTRATAKLGTWMPGLVNGVVARAERLWAEAAVQTEAR
APSVILAAGGFIFNREWVQAHAPEFTKISPLCTAGDDGNGITLGLDAGGF
TDKMGNVAAWRFLAPPSAFLEGLTVGADGLRITNEDLYGATHSTVMMREF
GGTGWAIYDARTWAKIRGQVRTQTQLFQRLQLIYLFTTGHRKSSTLEGLA
RKNGIDPAGLRRTVDAYNSGIVSGTGDPAHKDPGLCAPMTTGPFYSIDIS
AASSMFYPVPGLTLGGLVVDEKTGEVMHRAGGTVAGLYAVGRTAVGICSN
SYVSGLSLSDCVFSGRRAGAHAAG
315445508YP_004078387.1 hypothetical protein Mspyr1_39630 [Mycobacterium gilvum Spyr1]MLTEERRRELSDVLRPAAPPVEVDGVYTEDQKRRLLDVVHDRGPWKLIIA
QHFASADELMATMSGAFPEGFEPSLDLFLTPTFRGYLANYGAVLYPELHD
VFYNEKFLSHAKSYWGAQYAKPELMLFNINGPCANRDPGHLDSPSFRGVR
HENAPTWLCSVMGKSGLFSDYLIKMAQVITWFSLDEGSGFTYWPEGPLAA
PKRLLPPINNRGVVVQNEMMVHRGEANGPLEQQMPAGLAFDTVFAGDPAD
RDRWVLKNGDDVIARHHTDDLRFLVHWSAEVFSDFDELKKNMDGSDDLTI
DKAIDMLVDNLRKQGINLDIPSAPLHDPAFIGALNAAYDIGAPTTYPAEA
PLSAFQLA
315445507YP_004078386.1 esterase/lipase [Mycobacterium gilvum Spyr1]MPGPTLDPDAAARVASFGPIPPMRERGLDAVRAGVENTPVPDDMPAMASI
EERCAPGPDGPIPLRIYRPTDATDAPVVVYFHGGGMVMGSNRSFEPLARA
LAAGSTATVVSVDYRLAPEHPAPAQFVDCSAVTTWVAENATSLGVGPARL
AVAGDSAGGSLAAAVTLAARDFGGPVICAQVLMYPGLDRDMAAPSMVAMP
DAPLLSRADIDYMHELADDGVGAPHDAYRIPAYAEDLSGLPPAIVVTGEC
DPIRDWGERYAQRLRDARVQTTLTRYPGMYHGFLMRPDGTARGRLAMAEI
GALLRAKFAEPLPF
315445506YP_004078385.1 hypothetical protein Mspyr1_39610 [Mycobacterium gilvum Spyr1]MSARDTFAGGVAVITGAGAGIGAGLARHASSLGMTVVLVDIDAGAVAGLR
AELEAAGGVAVDAVCDVRDPDAVQELADRVYRDVGPVRLLVNNAGVEQFG
YLWDTPVANWNRIMDINVDGVFHGVRAFLPKMIDAGTPAWVWNMSSIGGV
AVVPLQAPYIVTKHAVLALTECLHLEVRHAGHDHIHVQAVLPGAVVSNIF
ESARGVDDSDSEAVTAAESQRAAMLDIKAAAMDPVAAAEVVFDQAAAGEF
YLLTQPEYVSSAMTERARVLSTRQAPQLRTERRFDPAKH
315445505YP_004078384.1 hypothetical protein Mspyr1_39600 [Mycobacterium gilvum Spyr1]MSNEITLPEVQEFIAGFWYHYDQGHFEELASRIGDEMEYVSRSDSGNCPF
EELLAAELHGGEQTLAWLTQHRNENPYPLRHHATNIFRTGVSGEVTTARF
YLYVNQVTNKVPFDVSSGVVDVGIRRGEGGLVFTSMSVVLDAEDSIPFAE
YRTKNSAAVVSGS
315445504YP_004078383.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MPEDLLAAQIRRVRSQTVGDIPRRSARRHPHKLAIVDGTTRLTFAELDAH
VDHVASALRDSGFGKGDRIALLSHNCWQYAVLTFATARAGVVMVPVNFML
GPDEIAFILGHSKVTGFVVETALVPVADEAMAAAGEDCAVATRIAITSGD
PVPAGWQDYADWSQSAATPAPPVEIADDDVLRLMYTSGTESRPKGVMHTS
RSLMWQYISSIVAGSMSGEDVEIHSMPLYHCAQLDNFLITDVYLGATSII
LPGPDPEAILRTIEAEQVTNFFAPPTVWIALLRCPAFDRYDLTSLRKGYY
GASAMPREILHELRDRLPNVSLWNFYGQTEIAPLASSLGPDEQDRHGGAA
GRPAVNVETAILDDSDNPVPPGTVGEIAHRSPHLMVGYLDDPQRTAEAFR
GDWFHSGDLGYYDEFGLLHVVDRKKDMIKSGGENVASREVEEVLYQHDDV
QEAAVFGLPHPVWVEAVVAAVVPREGRVLDPDAVIAHCRSRLAGFKTPKQ
IFTVAELPKNPSGKLLKRELRERFASAMN
315445503YP_004078382.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MRRVHYTDDHLAFGELARDFAAKAVAPHYEAWEDAGIIPRDVFTEAGALG
LLGFAAPEQYGGVGTADFRYNQILVERFMDAGCGGVGLSFAVHNDICLPY
LADLTTHEQKKRWLPGFVGGRLIAAIGMTEPGAGSDLSGIRTSAVDKGDH
FLVNGAKTFITNGQNADLVITAVRTSPDRHRGLTLLVMERGLDGFERGRN
LDKLGLHCQDTSELTFTDVKVPKENVLGEVGDGFAHMMRNLAQERMQIAV
GSLGRIRAALDWTVTYVRERTAFGKPIGALQNTRFSLADVATQLAVTQAF
IDNCVIELNEGRLTAADAAMAKLWASETEFRCLDACQQLFGGYGYMREYP
IARAAIDARITRVYGGTSEIMREIIGRDLRLDRSPSAKEATRA
315445502YP_004078381.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MTAAPETASASRYDPAELRANLMQADAGVLVCVLAQLTGDAGVVDRFGPL
IEHVADPPERIGVTDEQTRSALADAIIAALDAPATDAAEKVTDREFFALL
LSTGLGSEVDDEQVDLLLEQGGFRPSAPTLPRTVAIPDTTTMAIIGAGIA
GIAVALAAAEEGVSFEIFDRNHEVGGTWLTTTYPGIGVDTPSAYYSLSRE
VNPNWTNYYPQGAEYQDYLVALADKHQLREHIRFGTEVEALWWDEERGQW
QIHTVGADGTRSVSHAGVVVTAAGYLNRPRWPDVKGRDTFAGVSVHSAQW
DSSLDLTGKKVAVIGAGCTAVQIVDACVDEVEHLTVFQRQPHWVAPRKRP
SDDVPEHRRYLGKHLPYYANWHRLKSYWATADNNYPVILQDPQWAAEHLS
ISPANDVLLQLCREYIDRTFGAGSELAKKVTPDFAPYGKRIIRDPGGYYA
ALTRDHVDVEASEPAEINARGIVTADGRQIDLDVIIYATGYHLDFLSTVD
IRGRDGRKLSEEWGDSPRAYRGGTVPGFPNLFITSAPNYSPGHGAGANFS
MEVLAHYIIECLQLMALRGATTMEVTREAYENYVAGIDEAMSRTVWCHTP
NAHTYYRSSSGRVVVSTPFRLVDLWQQHRAPIEEDFTLR
315445501YP_004078380.1 hypothetical protein Mspyr1_39560 [Mycobacterium gilvum Spyr1]MTGLLTGRTALVTGSSRGIGRAIAQRLAAEGATVAVTARAHQPSESVRAG
VSAALPGTIDETIALIEQSGGTAFGLAADLENSEDRAALVDRVVERTGRV
DILVNNAGFADYSVVADMSMATFERTVEHYVRTPFVLTQAAVPHMKTQGQ
GWIVNIGSVTGLAPARPYREYNKTSGDVIYASMKAALHRFTQGVAAELLD
ADIAVNAVGPSSAVRTPGAAALIPDSFPTEPVEYLAETVLAMCHRPAAER
TGLVAFSLHYPWSQKLPVHSLDGATVLPPLEPPATANPNILPAGL
315445500YP_004078379.1 stress responsive A/B Barrel Domain-containing protein [MycobacteriMYSVIRLLDVAEPERDRVLRDVQAAAARTGAHRTVVEPTLPGSRNGGDVL
VHLRFQDEDEWRCHTADFEGALQDSAITRVNGAEYPGRPQPGHPGPSGVY
RTLLLRVLPGTEPSVVARFEDELRLMPRYVRSITAWQLSRAQDPTGDAGW
THVFEQQFTDEAGLMGPYLMHPIHWAVVDRWFDPETTDVIIRDRVCHSFC
ALPAPVLD
315445499YP_004078378.1 hypothetical protein Mspyr1_39540 [Mycobacterium gilvum Spyr1]MAEVFVVDRVITRPGCARKFVDRYLAEYAPGALTRGMVLRDILVSPPIWF
EDQPNIVTATWVLSGPQAWWEMTWKGRPDPTLGPWWDSVGEFISERQRSV
AAAAAHVDGLCDV
315445498YP_004078377.1 NADH:flavin oxidoreductase [Mycobacterium gilvum Spyr1]MSPNPPEPFSPVSLGPVTLRNRVIKAATSEGRSPHGLVTDDLIAFHRAFA
DGGVGMTTVAYCCVSPQGASAPGQIVMNEAALPGLRRLTESVHEGGAAIS
AQLGHAGVVAPKKLTGVTAVAPSRFVNPTSFAYCRQITRDEIRSVTAQFA
AAAQIAVDAGFDAVELHFGHLYLPSSFLSPLINRRKDDYGGSIDNRSRFV
REIAARVRDTVGGRIAVIAKLDMDDGLPGSIWIDEALRTAALLDADGALD
ALELTQGSSVYKPMYLFRGDVPVREFATVMPPAMRPAVRLVGKQTMGVCP
YQDLYMLDAARQFVPVMRNTKLVLLGGITERSHIETGLREGFDFVAMGRA
LLREPDLVNRIRSDPSTRSRCTHNNKCMVTVFGRTHCVLDPDQRYGGVSP
VQQRGELLA
315445497YP_004078376.1 esterase/lipase [Mycobacterium gilvum Spyr1]MRLDPQIAALIDALDGGFPAVHTMTGAQARATIRSRFTPAAEPEPVHSVH
DMAVPVDDGEVPVRVYRPAGPAPLPALVFAHGGGFVFCDLDSHDGLCRNL
SNRLGAVVISVGYRLAPEHRWPTAAEDMYAVTRWVSGDADALGVDPARIA
VGGDSAGGNLAAVTALMARDRGGPALRAQLLLYPVIAADFDTESYRLFGH
GFYNPEPALRWYWDQYVPALSDRQHPYASPLHGELTGLPPAVMVMTGHDP
LRDEAVAYAQALTDAGVPVVRCEFDGAVHGFMTMPMLDIAHEARRRSCQE
LTALLHG
315445496YP_004078375.1 IclR family transcriptional regulator [Mycobacterium gilvum Spyr1]MTTPVETPSAVIDRVSLVLDAFDGPGRLTLAQIVRRTGLPRSSAHRMLER
LVQLRWLRRTGRDYELGMRLVELGSLAVHQDRVHRAATPLLHDLHRATGL
VVHLAVLDGSDVVYLDKIGDGMASAIPTRVGGRQPAHCTAVGKAMLAFND
DVDVDLQSRMTKYSIGTAAQLAAELAKVRAHGVAYEREESLPGFGCVAAA
IGRPGEAVAAVSVCGPMNRMAFERLAAPVRVTAMGIWRNAEDGPARVTPT
LQPLRPLRGGPAARPVAVRNDALQYA
315445495YP_004078374.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMSVAPIPASSVSSWDDEADVVIAGYGIAGAAAAVEASRAGADALVLERTG
SWGGAAAMAGGFIYLGGGTATQKACGFDDSAVNMAAFLNTALGPGADERR
IADYCENSVAHYDWLVGCGVVFKPEFFDEPGWEPMGDQGLMYSGGENSYP
FNTIATPVPRGHVPQMQNKKQGEASAGFMLMKPLVETATAAGARARYDVR
VQALVVDDGRVVGIRARQYGTDVFIRARRGVVLAMGSFAYNDAMVAQYAP
RIAGRPAASVEQHDGQAIRMAQALGADLAHMDATEVAIFIDPQQLVRGIL
VNERGQRYVAEDTYPGRIGQLTLYHQNNTAYLVIDGDAQEEAMASLSPRL
MMRPATWVADSVADLESEIGLPPGSLQSTVTAYNDAAVRGEDPLLGKKAR
WVRPIGAPLGAIDLRASTGGFTLGGLHTTLDAEVLHVDGHPIPGLYAAGR
CAAGLAAWGYASGISLGDGSFYGRRAGRSATR
315445494YP_004078373.1 2-3-dihydroxybiphenyl 1-2-dioxygenase [Mycobacterium gilvum Spyr1]MSDIKSLGYVKVQATDLPRWRQFAFGVLGFAQGSGPEPDALYLRMDERAA
RIIVVPGDVDRIVTAGWEVRDRRGLEAVMRALDAAGTPFKELSLAEADAR
RVEEVIAFEDPAGNSLEVFHGAVLDHSPVVTPYGARFVTGAQGLGHVVIP
ALDVNGLFDFYTQVLGFKSRGAFRVPTPPEYGPVRVRFLGVNQRHHSLAI
CPAATVRDPKLVHLMVEVDTLDAVGQALDRVHKDGFQLSSTLGRHTNDKM
VSFYVRAPGDWDIELGTEGMLVDKSSYTAEEITADSYWGHEWVTDLPIAM
QP
315445493YP_004078372.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MSERVLDRLNELAGQFKEQAVEAEKLGKLPDATVKSMKSIGSIRLLQPKK
HGGLEVHPREFAETVMATAALDPAAGWVNGVVGVHPYQLAYADPKVGEEI
WADDIDTWVASPYAPQGVAVPTDGGYIFTGRWQFSSGTDACDWIILGAMV
GDAKGVPLMPPQMLHMILPRKDYQIVDDSWDVVGLRGTGSKDVIVDGAFV
PTYRTMDGMKVMDGSAQIEAGMTEPLYKMPWSTMFPLGISSATIGICEGA
LAAHLDYQRERVGANGTAIKDDPYVMYAIGDAAAEIEASRNTLLSNVDRV
YDIVDSGREVTFETRAAVRRSQIKAVWRAVAAVDQIFARSGGNALRMDKP
LQRYWRDAHAGVAHAIHVPGTVYHASALSSLGVDPQGPLRAMI
315445492YP_004078371.1 ferredoxin [Mycobacterium gilvum Spyr1]MSSAECVTESVATVRIDLDGDRHELRWPRDKTLVEIMLEAGIAVPYSCRE
GHCGSCVTTVTSGEVSMDTCDILDEADLADGLVLACQARPVDDDIAVEY
315445491YP_004078370.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MSNSADAGVVDAVVVGAGFAGLYALHKLRSQGLVVRVFEAAPEVGGTWYF
NRYPGARCDVESVDYSYSFSDELEQEWTWTEKYATQGEILRYINWVADKL
DLRPGITFDTRVVSATLDEKTLRWTVVTDAGETVTARFVIMATGPLSAAL
TPAFPGLDTFAGEVYHTAHWPHEPVDFSSKRVAVIGTGSSGIQSIPLIAE
QAEQLYVFQRTPNYSVPAGNRTLTESDVAEVKSNYAERRAMSWRSGGGSP
HVAHPKLTMEATAEERRAAFERRWELGGVLFSKTFSDQMIDPVANDEARR
FYEEKVRAVIDDPEVADLLIPNDHPIGTKRICTDTNYFQTFNRPNVRLIS
VRRTPIESIDATGITTSDAHYDIDALVLATGFDAMTGALAKIDIVGRGGQ
GLREDWAEGPRTYLGLGVDGFPNLFLVSGPGAPAVLANMVLHAEAHVNWI
ADAITHLDSHGHTALEATAESVDNWIAECNRRAEATLFPRANSWYMGANV
PGKPRVFMLFIGGFGVYLDICAEVAAAGYKGFQILDAS
315445490YP_004078369.1 hypothetical protein Mspyr1_39450 [Mycobacterium gilvum Spyr1]MDVTKYGPWAVIAGGSEGVGAEFAKALAEDGANLVLIARKPQPLDETAQE
CRRLGAQVRTIALDLLDADSTSRIVDATSDVEVGLLIYNAGASTCNERFL
DAELSEFGKVIDLNTTRMLELTQHFGRRMAAMSRGGIVLVGSLSGYMGAE
RHSVYAGAKAFSRVFAESLWLELREHGVDVLELVLGVTRTPAMERAGLNF
DAPGIIVNDPADVAREGLRHIADGPVFIAGGNAERAARSSAPDRAAVVLG
SHEMIKRLRGMRP
315445489YP_004078368.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMRIGLSTPVVVQTPAAASPWEAGAGICDIARIAETADDLGFDYLTCSEHV
AVPVGDAAVRGATYWDPLATLGFLAARTARIRLATSVLVLGYHHPLEIAK
RYGTLDRVSGGRLILGVGVGSLQPEFDLLGAPWEERGARADDAIRALRSS
LSVAEPSYDGDFYTFGGMVVEPHAEQPRVPIWVGGRSRRSLRRAVGLADG
WMPFGLRTMQIADMLATVDIPDGFDIVLPAGPLDPREPSGCLTRLRALRD
VGATAVTCSVAADSTDHYCAQLASLRGIVDEL
315445488YP_004078367.1 hypothetical protein Mspyr1_39430 [Mycobacterium gilvum Spyr1]MGSDRGDLEARLQQVEDRLRVVEDERDIARLIATYGPSVDAADAVAAAAL
WSADGVYDVEGLRMSGRDEIAAMVRSGGHRRLVDNGCAHFLGPAVVTVRG
DDAVALCESLVVLRAAEGYAERESGATAERLPAPGYVVWRAAANHFRLRR
VDGDWRITERTSRLLDGNAAAHALLRAGAAGDVVRAEPA
315445487YP_004078366.1 hypothetical protein Mspyr1_39420 [Mycobacterium gilvum Spyr1]MTMRAAAAAVLLTAAALTSAPAHAEPFFANYSLNIQGRYDFHTWTWAVTY
CIPAAADCAQIKAIPMPTAKAFEYSGDARLVDGRYTLAVDVPDGLRCGNV
YYGPVVPTHDVYEWDATTLQGTMTSSFARGCDGAPGGAFTYPFTLVRL
315445486YP_004078365.1 hypothetical protein Mspyr1_39410 [Mycobacterium gilvum Spyr1]MSSTPAGLSALVRYSDRRVLITGGGSGIGQACALRILAEGGRVAAADISA
DGLADTVDKAGDLAANLTTVAMDVGDEESVTSGVAQAIDTLGGLDTLVNA
AGILRSAHLADTTLADFEQVLRINLIGTFLVTRESLAALRGGRGPAVVNF
SSTSAHFAHPYMAAYAASKGGVLAMTHAWALEFAKAGIRFNCVQPGSISS
GMTDGTGASRQSVGPGLPEDADYALFGKVAPMLPLDGGAIFAAPDAVAGV
VAMLGSSDAYFITGTEVRIDGGSHM
315445485YP_004078364.1 organic solvent resistance ABC transporter permease [Mycobacterium MVNEAADRWSTGLPGLRSGVSTPMQGIGGLLSMSADAVKFLFRRPFQTSE
FLLQSWFVARVSLAPTLLVAIPFTVLVSFTLNILLSELGAADLSGAGAAF
GAVTQVGPMVTVLIVAGAGATAMCADLGSRTIREEIDALEVLGINPVQRL
VTPRMLASGLVALLLNSLVVIIGIVGGYVFSIFVQGVNPGAFAAGITLLT
GVPEVIISCVKAALFGLIAGLVACYRGLSISTGGAKAVGNAVNETVVYAF
MALFVVNVVVTAIGIQMTSG
315445484YP_004078363.1 organic solvent resistance ABC transporter permease [Mycobacterium MVAIRTLHPQLVRRLGRPVDTLGGIGEHTAFYGRALAGVPHAVVHYRREI
IRLVAEISMGAGTLAMIGGTVVIVGFLTLAAGGTLAVQGYSSLGDIGIEA
LTGFLAAFINVRISAPVVAGIGLAATFGAGVTAQLGAMRINEEIDALETM
GIRPVEYLVSTRIVAGMIAIAPLYSIAVILSFLASKLTTVVLFGQSAGLY
NHYFTTFLNPRDLLWSFLQAILMAMAVLLVHTYFGYFAGGGPSGVGVAVG
NAVRTSLIVVISVTLLVSLAVYGANGNFNLSG
315445483YP_004078362.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MTTRPGRPLIGLATVLALAAVVAVAVGLFRGSFTSTVPVTVLSQRAGLVM
DADAKVKWHGAQVGSVESIEALPDGRASIRLAMDPSYLGIIPSDVRVDIA
SSTVFGSKYVELVPPAEPSTQALRAGQVLTADHVTVEINTVFEQLSQVLN
KIEPAKLNQTLGALGTALDGRGDQIGQTMADFDAFLADIEPSLPAMEREL
AVAPTVIGTYADVAPQLVDTLDAATTISDTLVAEQGNLDTLLVSVIGLSD
IGNDVVGGNRQAISDVMELLIPTTDLLNQYHQALTCGIGGAVQLAKAPGT
PVPGGLLLQTVVLGQERYRYPQNLPKVAAKGGPQCTDLPKVGFQKRPPFV
ITDVNANPAQYGNQGIILNSDGLKQMLFGPIDGPPRNGGQIGHPG
315445482YP_004078361.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MTDVGKAAAKFAAFGLTMVLLTAGLFMIFGEYRSGSANRYSAVFTDSSSL
RGGDSVRAAGIRVGTVRGVTLQDDNTVVVDFDADDNVRLTEGTRIAVRYL
NLVGDRYLELLDEPGSARIQPSGSRIGVERTEPALNLDLLLGGLKPVIQG
LNPDDVNALTSSLIQILQGQGGNLESLFSRTSSFTNSLADNGQTVERLID
TLNETLATVSADGQNLSSAIDQLEQLATGLAQDRDPIGDAITALDSGTAS
LAGLLTEARPPLAGTVDQLNRLAPLLSNETDLARLDLALQKTPQNYRKLV
RLGSYGSWLNLYICGVSIRVSDLQGRTAHFPWVIQNTGRCGEP
315445481YP_004078360.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MQKYRGASLVRAGFLGAVLIALVIVVGLQPQQLWAMATSVRYQAVFAEAG
GLAPGNEVKVSGVTVGSVSDVALERGTALVTFSVDSAVRVGDATTATVGI
STVLGERVLVLKPEGTRSLGSMGVIPLTRTGSPYSLTDAVGEFTTNTEGT
DTAAINQSLDTLSDTIERIAPQLGPTFDGVSRLSKSLNSRNESLVALLDA
AADVTGVLSERSAQVNTLLLNANDLLAVLQDRRYAIVNLLSSTTAVAQEL
SGMVADNEQELAPTLEKLNTVSEMLERNRDNISASLKGLAKYQVTQGEAV
NNGFFYNGFASNLLPGPAIQPFLDYALGFRRGVNAGQPPDNAGPRAEFPW
PYNGIPGGSR
315445480YP_004078359.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MTARVRQSSVARMVLLAALSALAVAGAGVVIYQQFFSPYTVVAYFRSATA
IYAGDEVRVAGVRVGTIEAIEPQGTRAKMTMAIDHDVPVPADAEAIIVAP
NLVSARYVQLTPAWGATPETSGPIMVDGAEIGQDRTAVPVEWDEIKQQLT
RLATELGPTGGVSETSLGRFIDTTAGAMDGNGEKLRETISQLSGVARVLG
EGSGDIVEVITHLETFVTALRDSNVQIVQFQDRLADVTQVVDGSRSELNS
AITTLSEAVGEVQRFVGGSRSQTAEQVQRLANVTQVLADDSLVLKNILHA
APNALVNGYNIYNPDTGGPRGSFAMNNFSNPVTLICSAIAAVENVTAEES
GKACAQYLGPALRLMNFNYLPMPFNAYLGPAPQNVIYSEPGLAPGGGGTP
PAPAEIGPAVSAYTGAGDVAPPPGWTDPPQPPGAFAPHGLPANPSGALYP
GAPVPPGVPAPPPAAGPAGIAEMLLPAEAAPSPGGNP
315445479YP_004078358.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MPRPTVRRTRRWAAAACCVALTATGCSFDGLNSLPLPGTVGTGSDAVVYR
VQLANVGSLESNSPVMLDDVVVGAVGRMTFDDWHAEVDISVRPDVVVPAN
AVATVGQTSLLGSMHIALDPPVGEPPTGRLAPGANLPLNRTSTYPSTEQT
LSSLSVVVNGGGLTQIGDIISNFSAALDGRQGQIRSLLTRMNDVVGVLDG
QRDNINATISALYRLSETLAGQREVLTAALKRIPEALEVLNRERPRIVTA
MRKLGDFSDTATQLIDESQEDIVGNLRNLEPAVRALADVGPDLATALSYL
PTYPYTQEFIDRGIRGDYMNQFIVFDFTIPRLKSGILLGTRWGEPGASLV
PAPGDPWYSMYTRDPLQAPITPIPAEVATIPPLIDLPPAPADNPAEGGN
315445478YP_004078357.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MLTRFVRIQLIVFTIASAVGLGAMVFVYLQAPVLLGIGRMTVALKLPNTG
GLYEFSNVTYRGIEVGKVTGIEPTSDGVTVTMSLKSSPQIPADLTANVRS
VSAVGEQYVDLQPRSDAGPYLQDGSVITGDRSSIPQAVGPMLDQMSALVD
SIPTGTLSGLLDESYAALNGSGYELGSLFDSSARLAADADSTGDRMRNLI
TDSEPLLDGQAQKADAITTWARSLAGITRQIADDDQAVRTILQTGPGAAD
EASRLLTDVKPTLPVLLANLTTVGQVGVAYHPSLEQLLVLLPPYLAATQS
YGSSLNNPTGMALSEFSLTLGDPPACSVGFLPPSSWRSPADLTDVDTPDG
LYCKLPQDSPIGVRGTRNFPCMEQPGKRAPTVEICQSDRPFEPLAMRQHV
TGPYPIDPALIAQGVPPDDRVTLDDQIYGPLEGTPMPAPAPGAAPASVPG
PVPAAGGPPVAVATYNPETGQVATSDGEVFTQSNLAAPNPAAGEGKSWQD
MLPR
315445477YP_004078356.1 hypothetical protein Mspyr1_39320 [Mycobacterium gilvum Spyr1]MIRVPSAAGAVAAVAICGATWGAPSAAADNPDWGLNGTYVATSNGEWARK
NEVFYDQASLRSTWTVRTQCSYPGECTGTVDSEWGWSAPIYQKSGVWYVK
HTVENWIPCPDGTSAPGLQVFRFKAMNAEGAMADPTATTLVGEDVTTGVS
GACGVSRSVYINMPFKLVKVG
315445476YP_004078355.1 hypothetical protein Mspyr1_39310 [Mycobacterium gilvum Spyr1]MVLAASLAAGLWTSAPGAAQPPDCDDAFCTPGITPAVVLGAPCGDTANYV
FGTTSWGRLVFCGSPRRYEPRYFRSPSMAGVKALDANCAGYENWVAQSPE
GLFLSCQSKNGAPTWSRGDDG
315445475YP_004078354.1 hypothetical protein Mspyr1_39300 [Mycobacterium gilvum Spyr1]MTGRAPAVVSALLLAAVVSAPAAAADQPTPRQITYTVTADRPVSADIYYR
DTDPPNWADYSHNPYRYSPRARVDIGPQQPWVRSVVLADPDRWAMVSATS
GAGPVDSGLRCALAVDGQVVATGEGPHGALCSLRHW
315445474YP_004078353.1 hypothetical protein Mspyr1_39290 [Mycobacterium gilvum Spyr1]MRISKPRAGWRRPRWQTAAGIVAVLCSVAMLAAGGFIWSEHRDAVRGQQS
RAEFAAAAEQVAVTLMSLDHADPQTGVQRILDNSVDPFLSEFRSTTGDFV
KLSKDAEVTTKAVANAAAVQSISGDAAVVLVAATSTVTNADGVTEAPRSW
QLKLDLRRDGDRIKMSKVEFLQ
315445473YP_004078352.1 hypothetical protein Mspyr1_39280 [Mycobacterium gilvum Spyr1]MRIGGAVASRWRIVAVSLLLIASGALLATLYVTQYRIDSQTDGAAAEAAV
EAASSATATLLSYTPETIDADLAAARSVMTGEFATYYGGFTSEVVAPAAR
DRGVKAQAHVIDSALMDIQPDQAKVLVFLKQETASRERPEAAVTASSVAV
TVTKVDGTWLVSAFDPV
315445472YP_004078351.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum Spyr1]MSPDPVYILGAGMHPWGKWGRDFTEYGVVAARAALADAGLDWQHIQLVAG
ADTIRNGYPGFVAGATFAQKLGWNGIPVTSSYAACASGSQALQSARAHIL
AGLCDVALVIGADTTPKGFFAPVGGERKNDPDWQRFHLIGATNTVYFALL
ARRRMDLYGATTDDFATVKVKNARHGLANPNARYRKEATLDDVHASPVVS
DPLRLLDICATSDGAAALIVASKEFTEKHLGSVAGVPSVRAISLQSPQYP
QHLPELPDIATDSTAVVPGPDRVFKDQILDAAYTEAGIAPEDLSLAEVYD
LSTALELDWYEHLGLCPRGDAEHLLRSGATTLGGRIPVNPSGGLASFGEA
IPAQAIAQVCELTWQLKGQATGRQVENAKVGITANQGLFGHGSSVILAR
315445471YP_004078350.1 nucleic acid-binding protein [Mycobacterium gilvum Spyr1]MTVLPAVENWWRTDESGDTYLIGGKCTGCGTYVFPPRENNCPNPGCASDE
LALVPLSRRGTLWSYTENRYAPPPPYPSPDPFEPFAVAAVELAAEGLIVL
GKVVEGTLAADLHVGMEMELTTMTLYVDDDGVTRTTHAWRIAK
315445470YP_004078349.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMHSIDYQESLREVATPAGVLRYHEAGDGPPLLLLHGSGPGVTGWRNYRGN
LAVFAQHFRCLVLEFPGFGVSDDFGGHPMMDAQSSVVAFADALGLDRVDI
IGNSMGGGVGINFAVNHSHRVGKLVTIGGIGVNIFSPGPSEGIRLLQEFT
EDPTRQRLVDWLNSMVYDPALVTEQLIEERWELATDPETLAAARRMYGKA
AFAAMMEMMRDADFPLPWATMHKVKAPTLLTWGRDDRVSPLDMALVPMRT
IPNAEFHVFPNCGHWVMIEAKAAFERTVLSFLTESSAAAR
315445469YP_004078348.1 arabinose efflux permease family protein [Mycobacterium gilvum SpyrMTIATPSDPATLRRVALSSLLGTAIEYYDFLVYGTMSALVFGRVFFPDSD
PAVATIAAFGTLAAGYVARPVGGILFGHFGDRLGRKRMLVLTMGLMGAAS
FAIGLLPTFAAVGVTAPLLLVALRVIQGIAIGGEWGGATLMVTEHAEPHR
RGFWNGVMQMGSPIGSLLSVTVVTAITLLPDEAFVSWGWRVPFLLSVVLL
AIGVYVRVSITESPVFEQAKPKVVESRRIPLIEVLRRPRNLILACAVGIG
PFALTALISTHMISYATSIGYHRTDVMTSLVFTSLSALIAIPVFSALSDR
VGRRPVMLVGGVAIICYAWPFYWLVDMRAMAWLVVAMMVAQIVQSLMYAP
LGALYSEMFGTTVRYTGASMGYQLAALVGAGFTPMIASSLLVDEVTSVPL
VVLAMGCGAVTVLAVWRIRETQGVDLAGIDSGRNAVRTP
315445468YP_004078347.1 hypothetical protein Mspyr1_39230 [Mycobacterium gilvum Spyr1]MGAQSPWRERSRLVRALRLWRTRDPHTFREKVRYKMLRDHRALVVTFADK
AAVRDYVAHRVGDRYLPYVHGIVDDPAMLPELPESFVIKPTHGSGAAIIV
APNAPADARLPPVAQSWTYAHIRPEFSDRAQILAIATDWLTRLYGQGPNA
EWVYGQVQRRILVEELLTRADGGIPDDYKFFVFHGRCAYIEVDAGRFGSR
TQDFFTADWTHLPLSGGLPWAQPEPRRPRTLDEMIEVAERLGAETDFVRV
DLYDVDGRIVFGELTSFPAGGNSPFDPESFNAEFGRHWTVPRHYR
315445467YP_004078346.1 amino acid ABC transporter substrate-binding protein [MycobacteriumMGEAVVNARRRALLTVILMVAGMVTASGLAGPAAAQPSAVTVAVAPVTPF
VINNDGIWSGFTVELWQAIASRERWTTDWLAVDTLDQQLAAVAEGRADVA
AGAISVTADRRQRFDFSQPILDAGMQIIVPNHDPQPSSPGLREFLRLVFS
GTMVTWLAAALAITILPAHLLWLIERRHTDPAVSKSYFPGIVEAFGWGLG
TLAASDAASPRHWVGRAMGIGWAFIGIIFVAFYTANLTAALTVEKLDAQI
NGPNDLYGKSVCTEAKTTSAAYLTRIDVKPVLVPVIEQCYDGLRDDTYEA
VVFDAPVLRYYVTHDGNGIAGMTGPVFHDEDYGLAMPVGSPLRARIDQAL
LELREDGTYDLIEEKWFGDDQDTEAGSGG
315445466YP_004078345.1 serine phosphatase RsbU- regulator of sigma subunit [Mycobacterium MADDRNLPAFRRHGRQEGDRTDAEFDELIAARNQMDHLVRAIVAIGSDLD
FSVTLERIVTAARELSGARYGGLGIRAAGGNLVSFVESGDEFDVAALAGL
PIDGGLRIDDLRDHPEITDLQALNRPIRALLAIPVTVRGADFGSLYLADD
RPGRVFSDAQESAVRALATAAAAAIDNARLFEREREAARWTKASREITTA
LLSGDPQTGPLQLIVNRALELAGAEQAILLVPLEPDVPAEDVDTLIVAAT
AGRYSSEVIGRQVPMAGSTTGGVARRGLPMITDSFQYPIEGFTDVGERSA
IVMPLIVDDAVLGVIAVARRPNQPAFDEDYLELVSDFARHASIALALAAG
REHALNRQLAQADSVSEAMAGAAEELRRLWRARRVLAVTFPTRSEAADVE
PVVVSAGEHTTWRELPDGIRQILLSMRRGDLLTPNAAEPGTAGIAVQHPE
GILVVWIELAEHRSFTLEDQTLLTVLAGRLSAGLQRVHQVDQQRETALAL
QHAILGPAHLPPGFTVRYQAASRPLQVGGDWYDVVDLDDGRIALIVGDCV
GHGLAAATVMGQVRSACRALLLENPSPGAALSGMDRFAARLPGAQCTTAV
VMVLDPASGEIAYSSAGHPPPLVVHADGEVETFDDAHTIALGLRLNWARP
ETRRTLEVGSTLVLYTDGLVERRRIPLEEGISRATDVVVEHRAAPLDDLA
NAIMSELAPSVGYQDDVALLLYRHPAPLELTFPAHADHLAPTRTALRRWL
SGAKVEQGRVMEVLVAAGEAVANAIEHGHRHGPPGTVRLRATALVDLVEL
IITDSGSWKPPSAIPDTYRGRGIGIMRGLMQDVTIAHDSDGTTIHLYARI
S
315445465YP_004078344.1 STAS domain-containing protein [Mycobacterium gilvum Spyr1]MPTFLTFDTVRAADGREVRLIAAGEIDLSNVDDLKSALSAAIGETAAAGA
VLVVDFAAVEYVDSAAINVLSADSETIHKIVVHPFLLTTFRVSGLTELVT
VEAAAI
315445464YP_004078343.1 bacteriophytochrome (light-regulated signal transduction histidine MTGPGPAGLDASDGLVAVGTPIDLDNCAREPIHIPGSVQPRGVLVVVREP
EFEVRQVSANVEELLGHPVESVLGRHLSALMGASQAARVQQAASIVGDLH
RRNPVECVLDVRGKSLEFDAILHREPGGVLLVELEVAFGARPYSFPNTYQ
AVRSSVEALNRATTMADLYDTAARSVRELTGFDRVMVYRYDEEYNGEVVA
EAKRDDLNSFLGLHYPSTDIPAQARALYEKNWLRLISDVDYAPVPLVPAV
DPAVGKPLDLTHATLRSVSPIHIEYLQNMGVHASMSISLLRHGRLWGLIA
CHHYAGPHLPPFGNRAAAEFLGSTLSLRLVDQYEDDQLHRRLDAQAVLVK
LTAATMNDGKPLVSALLGAPDLLDLVPADGVVVDIGGHHRTRGSVPSPEV
VAAVAAWARAAEDEIARSDSLSRTLPDLDVDPALAAGALVLNLPDGQFAA
WFRRESLRSVDWGGDPHNKAIAVSEGGEVRLSPRKSFERWQEIVRDRGEP
WTPTEIESADMLRRHLVETLYHRTRGALRVAELVQRSLIPDSIPDLESWE
LTAHYEPAAGERVGGDWYDAFELRDGRLIVVVGDVAGHGVTVAGTMAQLR
NALRAQLFAGAAPAEAVRQLNDFCVHLLRSAFATVLVARVDLDSGLVEAT
SAGHLMPYLTEGSATAVAAPIRLSPPIGLSSARYTQSTFTIEPGQCLVLY
SDGLVERRGEVIDDGMDRLARGLGECAEPAAYPIWAALASGHTEDDVTVV
TLRRP
315445463YP_004078342.1 PE-PPE domain-containing protein [Mycobacterium gilvum Spyr1]MRKTGVVCGTVFASAALALSSSSLGQAANTALVIGGISTPSMADALMSPL
LGGKFKDQQRVSVKWPAQAGPMTGKGDLTLGASIAQGATNLNAQIDAALA
QLKSGEKVTVVGLSAGSLVVNEILRELDESADAPGKDKITFVVVADSSRQ
KVISRTRYNANLDYTYQTAPETKYDIIVVTGEYDGMADFPDRLNLLAIVN
AVAGGIFVHIPVMYADLSKVPARNISVEVNSEGGTTTHYLVPAEKLPLVR
LFPSLANREAELKAKIDAAYSRNDVVAVSAPKAAVFAAAPAPAAPTAVVQ
TPSAAQVPGSVVASLRTAKADAAVEDAVVSEDAAVEDAVVSEEAAVSEEV
DVKGADSADADIEDADTADQADIDSGAEKEAAQEDSDAGAQSGDDADKDG
SVSSDSGASTDRSPSKPSATSDS
315445462YP_004078341.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMRTVVVDSQRSIRVDTRPDPRLPGPDGVIVDVTASAICGSDLHFLDGHYP
IDQPVPIGHEAVGVVVETGSDVTRFTNGDRVLVSSVTGCGRCAGCLTLDP
VKCVHGPQIFGTGLLGGAQSDLLAVPAADFQLLAVPDGIGTEEALLLTDN
LPTGWAAAKRADIPVGGTVAVIGAGAVGQCALRSALALGAARVFAVDPVV
ARRERAAAAGATPMDSPAAQTILEATDGLGADSVIDAVGTDASIDDALAG
VRTGGTVSVVGVHDLTPYPLPALVCLLRSLTLRMTTAPVQQTWAELVPLL
QAGRLSVDGIFTDAMPLAEAEAAYAAAFSRSGEHLKVHLVP
315445461YP_004078340.1 squalene-associated FAD-dependent desaturase [Mycobacterium gilvum MPSTIRVMHPSSSQHVVVVGGGLAGLASTVWLAELGYRVTLLESNGSLGG
RTIGLTSGHGDAIENGQHVFAGSYENIFRYLDSIGTRHLLEFPDQFGVRY
PGGHAEKFGLRLANLRRMMLGRVRGLGLPTLLRASPAWARLMRDVIRFDD
SLDDITVDEWFDRVGFPPEVRRVVLNSMVIGLLNEQPHLASAHAFAALLR
TGADRVRSFGGSAVRIGYPTVDLDTLYLDGARRVMAERGVDVRLRTRAVT
VTTDAGRATGVTLSDGATVAADAVVLAVPSWNLRSLLDDVPSSEDARLSA
KKLEPIPIMNAYVLLDRPLGTVAPWESLLDSDIGWVFDRDRMHGPRDDGN
HLYALTTCAAYDLMPLKNSEVADRLVRALRDSYPAAADAEVLDVTVVPWP
RATFSSRVGMSTIRPQNRTALPNLALAGDWTHNDWPTTMEGAAQSASHAV
DLVHAELGGSG
315445460YP_004078339.1 diguanylate cyclase domain-containing protein [Mycobacterium gilvumMSASAVTSPVEGRVTDTPDAEYVRGMARLLQAVQELSLARSLPEIQRIVR
TAARELTGCDGATFVLRDNGKCYYADEDAIAPLWKGSRFPMEICISGWAM
LNREAAIIPDIYLDGRIPHEAYRPTFVKSLVMAPIRKLDPVGAIGNYWAQ
ERQPTPREVSLLQALADATSIAMENVQIYAELEQRVRDRTAALEQANEEI
RQLSLTDDLTGLNNRRGFRLLAEAALLAARTHGHDCALAFLDVDGLKRVN
DGIGHDAGDSLIVDVARVLRETLGPSAIVARLGGDEFCTLVPEYSDGAAA
LTARVQDAFRRFDARSSRPYQVMISVGVVEIPPTDVSPLEDLLSRADELM
YAQKKAKSCAEIA
315445459YP_004078338.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium gilvum Spyr1]MSAPAPVRHLIAGQWRPGHGEALRSVNPAHPAVVVAEGSAAVAADVDTAV
GAAAAAARPWAALGVHQRGAMLSAAAQIVERNAEPWGHELATEEGKTRAE
GIGEVRRAAQILRYYGAEGDRQAGEIYASPRAGEQILVTRKPLGVVGVIT
PFNFPIAIPAWKIAPALVYGNAVVWKPASTVPLLAIRLAEALTEAGLPPG
VLNLVIGGVDIGDALVNHPGVEGITFTGSTAVGRRIAAAAAARGVPAQAE
MGGKNAAVVLDDADLDLAVEQVMLGAFRSTGQKCTATSRLIVTAGIADAF
CDALLAQARALRVGDPVDDATQMGPVVSDLAQRSITAGIDTALAQGATAL
AGGQPYADGPLADGFFVAPTVLQLGTSPGDVWTDELFGPVLAIRRAADAE
EAFTLANDSEFGLSAAVFTQDMTRALEAVERIDVGVLHVNSESAGADPHV
PFGGAKKSGLGPKEQGGAAREFFTHTTTVYLRGGRPGA
315445458YP_004078337.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MSTTTAPATKAVYAPLELFDTARLLEQDEREIAATVRKFVDSELKPNVED
WFESATLPKELGKRFGELGLLGMHLQGYGCAGTNAVSYGLACMELEAGDS
GFRSFVSVQGSLSMFSIHRYGSEEQKNEWLPRLASGDAIGCFGLTEPDFG
SNPAGMRTRAKRDGSGENADWILNGTKMWITNGNLADVATVWAQTDEGIR
GFLVPTDTPGFTANAIHRKLSLRASITSELVLDNVRLPASAQLPEAVGLS
APLSCLNEARFGIVFGALGAARDSLETTIAYTQTREVFDRPLAGYQLTQE
KLANMTVELGKGMLLAIHLGRIKDAEGVRPEQVSLGKLNNVREAIAIARE
CRTLLGGSGITLEYSPLRHANNLESVLTYEGTSEMHLLSIGKALTGHAAF
RA
315445457YP_004078336.1 nicotinamidase-like amidase [Mycobacterium gilvum Spyr1]MDISSAMSETALLVIDMFNTYDHPDAEPLADNVAAIVDPLTELIRRSNER
DDVAVVYVNDNYGDFAAEPSDIVEAAVNGARPELVRPLVPGPEARFLTKV
RHSAFYATSLDYLLTRLDTRRIILTGQVTEQCVLYTALDGYVRHYDVVVP
PDTVAHIDDKLGTAALEMMERNMKAELPESTASLP
315445456YP_004078335.1 hypothetical protein Mspyr1_39090 [Mycobacterium gilvum Spyr1]MKNTKLLLGIGAAAVLPAAGLVGAGSAAAQPCTGPSTVIAGHGGGRCDSP
PAPDGSFTRCDTVYVFGLGGTNCYQVPAGTPPV
315445455YP_004078334.1 hypothetical protein Mspyr1_39080 [Mycobacterium gilvum Spyr1]MEVLRSVVVLLHIVGFAVIFGAWAAEAAARRFRTTRLMDYGVLVSLLTGL
ALAAPWPAGIELNYPKIGIKLVILVVLGGVLGMSNARQRKTGQDVARPLF
YSVGALAFTAAAIAVLW
315445454YP_004078333.1 hypothetical protein Mspyr1_39070 [Mycobacterium gilvum Spyr1]MWAILWRVVKGLAGKGVLVTGAASGIGLATVRRLLEEGAAVVGMDVCTEA
PADVPGDFTYHRGDVLDAAAVGRAVTAVVERTGRLDGVVHSAGVGGGGPI
HLLPDDEWDRVVDVNLKGTFVVLRAALAQMTTQDRVTGERGSIVTLSSVE
GLEGTAGGSAYNASKGGVVLLTKNAAIDYGPSGIRINAICPGFIETPLFD
SVMGLPGMEGPRDGLRHEHKLRRFGRPEEVASVATFLVSAEASFVSGQAI
AVDGGYTAGRDHHVTELLGLGEQ
315445453YP_004078332.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMTETLGAPEPFLTDGHGGIVIAADRRGEPTARAVVFLHGGGQTRRSWDRA
AAAVAQRGWQSVTVDMRGHGESDWSPDGDYRVASFAADVREILAQLPPRP
VLVGASLGGITAMLLAGELARGIASAVVLVDIVPDMDPTGAERIHAFMAD
KMVDGFASLDEVADMIAEYNPHRPKPTDLDGLRKNLRHKGGRWYWHWDPR
FIDGTAPHPPMEVTDTDRLHAAVGRIVDDGVPVLLVRGQVSDLVSRDRAA
AFLSRFPQIDFVDVDGAGHMVAGDRNDLFADAVLSFLTRREVAKP
315445452YP_004078331.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MPFLTGEHVRSPELTALTGLPFDDDDEVLRAAIDDASVPALLMSMVHMTG
DPGILDRLPRPYMLIAMDLQGGMSEPDKQVVRDKAFEVAREYRDRGCPPP
FVPDEHQLRVMLDVITGGQVGSELIEYIAADLRVTDADQNGPPLASTARQ
RADFPVLVIGCGEAGLLAGIKLKAAGLPFTIVEKQSGVGGTWLANRYPGC
RVDIASQYYTYSFEPTDHWEHHYATQPEILRYLRDVMDRHGIADHVRFDT
EVVGARWDELSATWRVRVRTGGGAVEELTARALICAVGQFSNPVIPDIDG
ADTFEGPTCHTADWDDTLDLTGRRVAVIGAGASGFQLVPAIAGTAAHVDV
YQRTPQWMAPNVHYHEAVSDGARWATRHLPYYGRWLRFVSWWPIADALDE
QITIDPDWDTGGLSVSAGNQMIRDMFIAWMQAFTDDEDLLAKVTPKYPPM
GKRTLQDDGTWLRTLQRDDVELINDGIAAITADGVTDVHGVHRRADVLVW
ATGFDVNHQLGPIDIRGRDGLSLNEVWGDAAYAYLGMTVTGFPNFYCMFG
PGTNAVNGASLIYNSECQMRYILGCIDMIIASGAAAAEPRAEVCRDYDRR
SQQRLQTMVYAHPAVTSSYYKNSTGELPTLFAWRIADYWKWTRYPDPADY
QLETAAPQEVS
315445451YP_004078330.1 hypothetical protein Mspyr1_39040 [Mycobacterium gilvum Spyr1]MTGRLAGKVALISGAARGMGASHARVMAGHGAKVVCGDILDSDGEAVAAE
LGDAARYVHLDVTSPDDWDRAVAAAVADFGGLDVLVNNAGILNIGTVEDY
ELSEWHRILDVNLTGVFLGIRAATPTMKAAGRGSIINIASIEGMAGTVGC
HGYTATKFAVRGLTKSTALELGPFGIRVNSVHPGLVKTPMADWVPEDIFQ
SALGRIAQPHEVSNLVVYLASDESSYSTGAEFVVDGGTLAGLAHKDFSAV
DVDQQPEWIT
315445450YP_004078329.1 LuxR family transcriptional regulator [Mycobacterium gilvum Spyr1]MRAALPAAMMNAMSDASPQAADDPQVAGFLSAATSAPTGLIIEGDAGIGK
TTLWLSLLQTARTRGFQVLTARVGQAESVMAFAALADLLGAVSDEHFAAL
PPLQRLALDRVLLRAGADGPATDQRVVAAGFVSLLHILAADAPVLIAIDD
VQWLDASSRTAIEFAVRRLKGAFGVVVTERCVPGDGTTAGWLTLERPDGL
IRVSVPPMDAGRLHALISQRLGRTLTRPVVLRIAEMSGGNPFYALELAHT
HVNSGDSPPAAEPPLPATLADVVRRRVGLLDDATRTLLLGVACVADPTVE
LLARAHGASTDEITAGLERAEAAGIVVLEGNRVRFTHPLLAGGVYTDAGP
TARRAMHRAIASVESHPELRARHLALAASSGDDEIFAALDQAADSARARG
APAAAAELMDLALGLGAHDPMRRLKAAENHFLAGDTAKAAAALGEVGSIE
PPILRAMATSLLATVRMYDNEHRQAVDLLRSALDDAADNVPVQVQVLLRL
SFALNSIGELDDARRYARDAVKLAEELGFPGATSAALAWAVHVDFQCGRG
LDETALARAMKLYDSTFDVPIIFRAPFVHALAMSWTGRLEQAHQELTAVR
GVCLERGAESDMMAIAGFLAINHLWRGQITDAEAEAAEAVERAEQLGGDD
VLIIPMTVRGAIAAYAGRVDDARADARWVLAAVRNRKASHIADWPGMTLC
FLEESLGNHREALAALDDSFIAAGPPTTELMYAWHLPDAIEAMVGVGRLD
DAEILTAALERNGVEHDRRWMRAVGARCRAMLLAARGDVAAAEQMAHRAI
SEHDHLPMPFERARTRLLLGQLQRRLRQKATAAKNLTDALHTFEQLGTPL
WAQRARSELARAVVAPAEGLTPSEQKVAEMAAAGATNKDIAAAMFISSKT
VEHNLTRIYRKLGISSRAELGRRMDQPGL
315445449YP_004078328.1 Zn-dependent oxidoreductase [Mycobacterium gilvum Spyr1]MRAIQIAELSGPGAARLVEIDEPAADDGTVLVEVHAAGVAFPDALQSRGL
YQYKPEMPYTPGAEVAGVVRSAPAGAHVKAGDRVAGLTMLCGAMAEVVAL
QPERVFALPDSVSFEAGAGILFNDLTVQFALRTRGRLAAGETVLVHGAAG
GIGTSTLRLAPAFGASRTIAVVSTEEKADVARAAGATDVVLADGFKDAVK
ELTGGRGVDIVVDPVGGDRFTDSLRSLAPGGRLLVVGFTGGDIPTVKVNR
LLLNNVDAVGVGWGAWTMTHPGYLQEQWAELEPLLASGTVPAPEPVVYPL
ERAAEAIASLEDRSARGKVVVAVR
315445448YP_004078327.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMTALFGPIDAVERARALREAGAAGVFTFEGPHDVFTPLTLASTVGGLDLM
TNVAIAFPRNPIHLAHQAVDHQLLSGGRFTLGLGTQIRTQIEKRYGTDFD
RPVARMRDLVGALRAIFHTWSTGDRLAYRGEFYRHTLMTPTFTPRAPFDP
IPIYVGALGPRLTRMTAEVADGLLVMPFGSRRFLTEVTMPNVAEGLAAAG
RTRADLAVVPEIIVSVADQDPDHMSARRLLAFYGSTPAYRPVLEVHGWGD
LQPELNALSKQGRWEDMGRLIDDDVLHTIAACGTPADVAKHIRDRVDGVS
DRICLYQPGPIAVNSLAEIVDALRG
315445447YP_004078326.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MDQLYPETESTDVLIVGAGISGIGAAYRIQERNPQLTYTVLERRSRIGGT
WDLHRYPGIRSDSDIFTLSFPWEPWDRPENVADGEDIRQYLVDAARKHGI
DRHIHFDTRVLSADWDSTADVWTVRTECNGVPRTYRTRFLFFGTGYYDYD
NPYRPEFPCLESFEGPVVHPQHWPEDLDCTGKKVAVIGSGATAISMIPAL
AESAERVTMVQRSPTYLLSGQRINPVVNLLRRVPPRKLGYRLAWLYNVLF
IVAVYGVARKAPRISRRLIRAVAKHYLPEGYPVDTHFKPRYDPWDQRLCL
ILSGDFYDAIARGRAEVVTDEIDHIDAHGLVLKSGRRIDADVLVTATGLQ
LQALGGIEISIDGTEVKPADRFVYKEHLLEDVPNLAWCVGYINASWTLRA
DLTARAVAKLLAHMDSHGYTHAYPHLGGVPMEEKPAWNINAGYVHRAPHV
LPKSGTHRPWNVRHNYVLDAVDQRFDRIDESMVFGRVSPKLHSSSEMSSE
DLLERNFGA
315445446YP_004078325.1 hypothetical protein Mspyr1_38970 [Mycobacterium gilvum Spyr1]MLGPMDEFPVHQIPQPIAWPGSSDRNFYDRSYFNAHDRTGDIFVITGLGY
YPNLGVKDAFFLVRRGDTQTAVHLSDAMDQDRLNQHVGNYRVEVIEPLRK
LRIVLDETDGIAADLTWEGLFDAVQEQPHIMRRGTRVTLNAQRFAQVGSW
SGQLSIDGTDIAVDPAQWIGTRDRSWGIRPIGEAEPAGRPDDPPFEGMWW
LYIPMAFDDFGIVIIIQEDPLGFRSLNDCTRVWKDGRVEQLGWPRVKIQY
RSGTRIPTGATVEATALDGSPLHFDVESKLAVPIHVGGGYGGDSDWLHGV
WKGPNFTERLTYDMTDPAVIGRAGFGVIDHVGRAVCREADGTEREGWGLF
EHGALGRHDPSGFADWLTVAP
315445445YP_004078324.1 aminoglycoside phosphotransferase [Mycobacterium gilvum Spyr1]MTSEPAVDNVDRLQRSSRDLSDVPAALSRWLSTKLPGVTPDAPVDITVED
GIDANGMSSETILLRGRWSDGGDPVEHRWVARVAPTDADIPVFEHYRLDH
QHEVMRLVAESTDVAVPAVRWLEDTGDVLGRPFFLMDRVDGVVPPDVMPY
TFGDNWLYDASPEQQRALQDRTVEVLAALHSIPDAQRTFGFLQEIDPPGE
TALHRHFGWLTRWYAFSSADLGSSPLVERAISWLEEHFPHDVAASEPVLV
WGDSRIGNVIYRDFRPVAVLDWEMATIGPREFDLAWISFAHMVFQELTKL
AGLPGMPDFLREDDVRDTYRELTGVEVGDLHWFHVYSAVVWCCVFMRTGT
RRVHFGEIERPDDIESLFYHASLLKRLIGEAD
315445444YP_004078323.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MKTDSSAGGKATGAGRPRDPRIDAAILAATADLLVEIGYSNVTMAAVAER
AGTTKTALYRRWSSKAELVHEAAFPVTPTAIQSPPGDIAADLRAMIEVTR
DVFLSPVVRAALPGLIADMSANADLTGRIGARFTDLFAAVRARLQDAVER
GEVRESVDPDRLVSLVGGATLLALLQTPDALASPSWVDSTTDILLRGVVA
GA
315445443YP_004078322.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MTEDLVLTADHDGVRVITLNRPAARNALSRDLIRATYTALTSADDDDAVR
AVVLTGADPAFCAGVDLKEAARDGLSYFAEFRTQSCIAAVAAMRTPVVGA
INGATFTGGLEMALGCDFMIASERAVFADTHARVGILPGGGMTARLPQLV
GAAMARRLSMTGEVVDAARAERIGLVTEVVAHQHLLQRAIDLAHQIAEVP
RPTMRGLKEIYTAGASAVVDPALAAEERIAFAQHRDFDGLGDRFSAVSQR
NRDQIGGA
315445442YP_004078321.1 NADH dehydrogenase subunit N [Mycobacterium gilvum Spyr1]MNTLTPLPTPTVEYFFLSPMLVVLGAAVLGVLVEALLPRHLRYRAQAGLS
LAALLAAFVAVVMVARDLPADGAVSAVMGAVAVDMPALFLQGTILAVGVL
GVLLIGERQIGVVEDSENGRGLDAFTPQASAVAGSVAEKVAARAGNIQTE
VFPLTMFAVAGMLLFPAADDLLTMFIALEVLSLPLYLLCGLARRRRLLSQ
ESAVKYFLLGAFSSAFFLYGAAMLYGYAGTLSFPGIADAVADGTGTTSLG
LIGVALLLVGILFKIGAVPFHSWIPDVYQGAPTPITAFMAAATKIAAFGA
MLRLFYVALPGLRDDWRPVLWAIAILTMVVGTVTAVTQTDVKRMLGYSAV
AHTGFILTGVIAGNDAGVSSTLFYLFAYGFSTVGAFAVVGLVRNSDGEED
TVMARWAGLGKRYPLVGIVFSLFLLAFAGIPLTSGFVGKFAVFKAAGEGG
AIPLVVVGVVASAIAAYFYVRVIVLMFFTDSPDDAPAVVVPSVLTTAVVT
VTAAVTFMLGALPQPLLDLADSADRFF
315445441YP_004078320.1 NADH dehydrogenase subunit M [Mycobacterium gilvum Spyr1]MISFPLLTALWVVPMVGAVAVLLLPAAARHLAKWTALVVSLVVLAVTGVI
AVGFDPAGDQFQFVENYRWIPSFGTGYILGIDGIALALVVLTAVLLPLLI
IAGWNDAGDRLSWGGRSTHIYFALTLAVEGMVLISLVSLDILLFYVFFEA
MLIPMYFLIGGFGGEHRGRAAVKFLLYNLVGGLIMLAAVVGLYVATATSD
AFDAGTFDFRAIVAAVSSGEFAVDPVVMHLLFGGFMFAFAIKAPLWPLHR
WLPDSAVEATPASAVLMMAIMDKVGTFGMIRYCLPLFPDSATLFGPAIIT
LAVIGIVYGAVVAIGQTDVMRLIAYTSISHFGFIILGIFVMTSQGQSGST
LYMVNHGISTAALFLIAGFLVSRRGSRLISAYGGVQKVAPVLAGTFLIAG
LATLSLPGLAPFISEFLVLIGTFTRYPVFAVLAASALVLSAIYILWMYQR
MMTGPVPPSLSEGENRIRDLVPRELVVVTPLIALLLLLGIYPKPALDIID
PAVAHTLTTVEQTDPAPRMAEGPVR
315445440YP_004078319.1 NADH dehydrogenase subunit L [Mycobacterium gilvum Spyr1]MTLPVWLLIAVPLAGAAILLLAGRRCDAWGHLLGTAAALASFGCAAVMFT
GMLGRDPEQRAVHETLFSWVPVGELRVDFGLQLDQLSMCFALLITGVGSL
IHIYSIGYMASGAQPAERPDDPGRSRRLFFAYLNLFVAAMLLLVLADNYL
GLYMGWEGVGLASYLLIGFWSHKPSAATAAKKAFVVNRVGDVGLAVALMV
MFASVGAVGFDAVFEATPQLGDGTLTAIGLTLLLAACGKSAQVPLQSWLG
DAMEGPTPVSALIHAATMVTAGVYLIVRSGPVFDLAPHAQTAVVIVGAVT
LLFGAVIGCAKDDIKKALAASTMSQIGYMVLAAGLGPAGYAFAIMHLLTH
GFFKAGLFLGAGSVMHAMNDEVDMRRYGGLRTALPITFVTFGLGYLAIIG
IPPLAGFFSKDGIIEAALGAGGVKGVILGGVTILGAGITAFYMTRVMLMT
FFGTRRWEGSGAHPHEAPAVMTWPMILLAIGSVTAGAALAIGGTLEHWLE
PVVGVQEIHHVLPVWVVTVIVLSVVAVGVAIAYRMYGARPVPTDVPPGSA
LTVAARRDLYGDTVNERVLMRPGMTFTRRLVELDDEAVDGAGAGLGAGVS
RVSERLRQWQTGFARSYALSMLAGTALVVGMILAVNLW
315445439YP_004078318.1 NADH dehydrogenase subunit K [Mycobacterium gilvum Spyr1]MNPDNYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAGNLAFVTFAR
VHGNLDGQVVAFFTMVVAACEVVIGLAIIMTIFRTRRSANVDAASLLRH
315445438YP_004078317.1 NADH dehydrogenase subunit J [Mycobacterium gilvum Spyr1]MTETILFWVMAVVSVGGALGVIAAPKAVYSAMSLAATMIALAVLYIAQGA
PFLGVVQIVVYTGAVMMLFLFVLMMIGVDSSESLVETLRGQRIAALAVGL
GFGILLIAGIGSVSATGIVGLDQANGGGNVEGLAALIFTKYLWAFELTGA
LLITAALGAMVLAHRERFQRRKTQRELAVERFAPGGHPTTLPNPGVYARH
NAVDVPARLPDGSGSELSVSAILQVRPVPTDERSPGGEE
315445437YP_004078316.1 NADH dehydrogenase subunit I [Mycobacterium gilvum Spyr1]MPKFLDAVAGFGVTFGSMFKKPVTEEYPEMPGPVAKRYHGRHQLNRYADG
LEKCIGCELCAWACPADAIFVEGADNTEAERYSPGERYGRVYQINYLRCI
GCGLCIEACPTRALTMTNDYEMADDNRADLIYGKDKLLAPLEPGMEAPPH
AMAPGATDEDYYRGTVSPSAEADAR
315445436YP_004078315.1 NADH dehydrogenase subunit H [Mycobacterium gilvum Spyr1]MTYPDPTLFGHDPWWLILAKSLGVFVFLLLTVLAAILIERKILGRMQLRL
GPNRVGPRGLLQSLADGIKLALKEGLVPAGVDKWIYLAAPVISVIPAFMA
FAVIPLGPEVSVFGHRTALQLTDLPVAVLYILAVTSIGVYGIVLAGWASG
SVYPLLGGLRSSAQVISYEIAMALSFVAVFIYAGTMSTSGIVAAQNDVWF
IFLLLPSFLVYLTSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFM
LAEYVNMTTVSALATTLFLGGWHAPWPISIADGANSGWWPLLWFTAKVWL
FLFFFMWLRATLPRMRYDQFMGLGWKLLIPVSLAWIAIVATTRAMQNQGY
QGWVTALIGVTGVAAILASLLAWRALRARRRRTPHGPPAQSSDHGAFPVP
PLPVKEPADA
315445435YP_004078314.1 NADH dehydrogenase subunit G [Mycobacterium gilvum Spyr1]MTIAERASDAPPVEMVTLTIDDQPVTVPKGTLVIRAAELIGVQIPRFCDH
PLLDPVGACRQCLVEVEGQRKPLASCTTTVSPDMVVHTQHSSAVADKAQQ
GVMELLLINHPLDCPVCDKGGECPLQNQAMAHGRAETRFTDVKRTFPKPI
NISSQVLLDRERCVLCARCTRFSDQIAGDRFIDLLERGAQQQVGIAPGVP
FQSYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVCEHCASGCAQRT
DHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFTYATAGDRLATPLVRDEDG
TLRAASWSEALTVAGAGLAASRGRTGVLVGGRSTLEEAYAYAKFARIVLA
TNDIDFRSRSHSAEEAAFLAAYVAGRPKSVTYADLEKAPAVLLAGFEPEE
ESPIVYLRLRKAVRKHGVQVISVAPLRTRGSDKLSARLITAAPGAEAGVL
DGLAADELLTMPGAVILVGERLATSPGALSAAGRLATATGARLAWVPRRA
GDRGAVEAGALPHLLPGGRPVDDVGARAQTALAWHVDELPAQPGRDGTGI
LDAARAGELGALLVGGVELADLPDPDHAAAALDAVPFVVSLEVRRSAVTD
RADVVFPVAPVVEKGGAFVNWEGRIRPFEPSLHTNSVTDLRVLSLLADEI
GVDLGIPTSVAAAEEHARLGLWAGDRPAPPRAEEHRAPAAHGEAILAGWR
MLLDAGCLQDGEPHLAGTARTPTVRLSERTAADIGARGGDVVTVSTDRGA
VTLPLTVTDMADGVVWLPLNSPGSQVHQTLGVTTGARVSIGCAEQRGPA
315445434YP_004078313.1 NADH-quinone oxidoreductase subunit F [Mycobacterium gilvum Spyr1]MTSLTPVLSRFWDEPQPWTMDTYIRHGGYQALERALAMSPDEVIGTVKDS
GLRGRGGAGFPTGTKWSFIPQGGEGAAAKPHYLVINADESEPGTCKDIPL
MLTTPHFLVEGAIIAAYAIRAHHAFIYLRGEVVPVLRRLQAAVAEAYAAG
HLGHDIHGSGFDLELIVHAGAGAYICGEETALLDSLEGRRGQPRLRPPFP
AVAGLYACPTVVNNVESIASVPPILLNGVDWFRSMGSEKSPGFTLYSLSG
HVTTPGQYEAPLGITLRELLDYAGGVRAGHELKFWTPGGSSTPLLTADHL
DVPLDYEGMAGVGSMLGTKALQIFDDTTCVVRAVRRWTQFYAHESCGKCT
PCREGTYWLAQIYERLETGRGTEADLDKLLDISDNIFGKSFCALGDGAAS
PIMSSLKHFRDEYEAHLGNACPFDPYASMLTAPEGVGV
315445433YP_004078312.1 NADH dehydrogenase subunit E [Mycobacterium gilvum Spyr1]MFLELGQRPDEPGPPIHGPATYPAAVHERLTADAETIIARYPQTRSALLP
LLHLVQAQDGCLTPAGIAFCAHRLGLTDAEVTAVATFYSMYRRTPTGEYL
VGVCTNTLCAVMGGDAILESLEQHLDIAPGQTTADGRITLEHVECNAACD
FAPVVMVNWDFFDNQTPASARELVDGLRSGQTPAPSRGGSLCTFRETSRI
LAGLDGPDSATAGTVGEATLAGLRFAREHRMAAPAAGSPSDTTAGGGQEQ
AVAAESVKDEPAPAPEADVPARSGTAETDPEATDAP
315445432YP_004078311.1 NADH dehydrogenase subunit D [Mycobacterium gilvum Spyr1]MTTSAQRPERVIVVGGQDWDQVVTAARENAAEHAGERIVVNMGPQHPSTH
GVLRLILEIEGETIVEARCGIGYLHTGIEKNLEFRTWTQGVTFVTRMDYL
SPFFNETAYCLGVEKLLGVTDDIPERASVIRVMMMELNRISSHLVALATG
GMELGAMTAMFLGFRERELILSVFETITGLRMNSAYIRPGGVAADLPEEG
LPQIRELLTLLPTRLRDMENLLNENYIWKARTLGVGYLDLTGCMALGITG
PVLRSTGLPHDLRKSQPYCGYQTYDFDVITDDRCDSYGRYLIRVKEMRES
IRIVEQCVERLERSTGEPVMITDRKLAWPADLKVGPDGLGNSPEHIAKIM
GHSMEGLIHHFKLVTEGIRVPPGQVYVAVESPRGELGVHMVSDGGTRPYR
VHYRDPSFTNLQAVAAMCEGGMVADAITAVASIDPVMGGVDR
315445431YP_004078310.1 NADH dehydrogenase subunit C [Mycobacterium gilvum Spyr1]MTEPTGDQTPEIIGVRRGMFGAKGSGDTSGYGRLIRPVALPGSSPRPYGG
YFDEVVDRLAEAVGDDAFTESIERVVIHRDELTLEVHRDRLVEVAQALRD
DPALRFELCLGVSGVHYPDDTGRELHAAYPLMSITHNRRIRVEVAVPDDD
PHIPSLFGVYPTVDWHERETYDFFGIIFDGHPSLTRIEMPDDWVGHPQRK
DYPLGGIPVEYHGAEIPPPDQRRAYN
315445430YP_004078309.1 NADH dehydrogenase subunit B [Mycobacterium gilvum Spyr1]MGLEEKLPGGILLSTVEKVAGYVRKGSLWPATFGLACCAIEMMATAGPRF
DISRFGMERFSATPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLAM
GVCASSGGMFNNYAVVQGVDHVVPVDIYLPGCPPRPEMLLHAILKLHDKI
QQMPLGVNREEAIREAEQAAMALTPTIELKGLLR
315445429YP_004078308.1 NADH dehydrogenase subunit A [Mycobacterium gilvum Spyr1]MNLYTPILVLGAIAAVFAVGSVGIALLIGPRRFNRAKLEAYECGIEPMDA
SDPAVAATAQRFPMRYYLTAMLFIVFDIEIVFLYPWAVAFDSLGMFALIE
MLLFMVVVFVAYAYVWRRGGLQWD
315445428YP_004078307.1 hypothetical protein Mspyr1_38790 [Mycobacterium gilvum Spyr1]MVVPSAETRGVLRVLVYSDNPRTREQVRLALGRRIHPELPELDYVEVATG
PMVVRQMDAGGFDLAILDGEATPVGGMGIAKQLKDELDVCPPILVLTGRP
DDAWLARWSRAEAAVPHPIDPIRLGDAVVSLLRPAA
315445427YP_004078306.1 ATP-dependent transcriptional regulator [Mycobacterium gilvum Spyr1MTAGLGLARTQVESAIVASRLRAVLVGAAGVGKTSMARKLARDYARKHPR
LTSHWVSATASARDIPFAAFSHLIDVSGGEEPTTLLRAARESLRSAHGLL
LVVDDAHHLDTLSATLVHQLAVTDNAHIMLTVREGEPVPDAVTALWKDSI
LSRHDIAPFDRRESGLLLEQILGGTVEDVSTVRMFEISQGNPLYLRHLVD
AALGTGSLRQVEGVWQLRGEMTLSPQLTTLIDAHLTNLPEPVRSVLEFLA
IDDPLSVDDLAALTGIDAVDAAETCGVVTITDRAGALYAHPFHPIYTERV
RSSLGLLAMRRLRKLLAGRMSVRAPGNLSTRLRMAALAMGTDEPPSADEL
VGLSWEAMRLGDLALGERLARAALEQADGLAARLPLAHSLSWQGRGRDAD
DVLNPVDPDTLTQWDLMAWTLPKAANRFWMLSESEEAVEYLRQMRARITE
RGALHTIDALAATFAMNAGDPSEAVTVAKGILAADDAQDLAVAWASAAAT
LSSARMGRFAEVDGLAQRGLDAAHPGLLRFTIGLGQTLALIMNADVASAE
HLARHYLSFSEFQQPGRAIGEVLLGHTLLASGRFGDAVTLLRQAAAALTY
TGYSWGPLALTGLAQALGQQGRAADASAVLTRAEASHGMRSALYAPDLAL
ARAWTLAAARDLRGAVASARDAVHAAVQSGQDAVALRALQDCARLGDTHG
LATAVRLSDRIGCVTGPLCVAHLRALAAGDGAALDAVSADLETAGLPAAA
ADAAAQATFAHQRRGDRAGEVASRSRASRLSQVCGAPATPALEQVLNPMP
LTGREREVAVMVSQGLTNKAIAQRLSVSVRTVEGHVYRACMKIGVPDRAA
LASTVGGMHGREGTA
315445426YP_004078305.1 hypothetical protein Mspyr1_38770 [Mycobacterium gilvum Spyr1]MSVFSVSASLRQSGVSLRSPDGVTLPGVETVWFETEDRRRLNFRHLPPVP
GAEDKGPVMFVHGSGTRADLFCPPSTITLPALLSAAGFDVWLLNWRGSID
VEPTSYTFDDAAVFDFPAAVSEILQRTCSTVGGIKAVVHCQGSHAFMMSI
ASGLLPEITTVVANSTAMHPRVRWSASVKLPFALKTLGKTTEWFNPQHGL
YASSFSARVLDLLVRLFHHECDNAVCKHSSFIYGVGFPTLWSHHHLDEVT
HDWIKGEFAHVPVSLFRQTHRCLAAGRLVPVRGYPEIQPGVAIHEPKTDA
NFLFMCGSDNKTFHPSGMRKTFEHFTTRTRGTQEHWEITGYGHLDPFLGK
YAAEDVFPRVIAFLEGQ
315445425YP_004078304.1 hypothetical protein Mspyr1_38760 [Mycobacterium gilvum Spyr1]MPKVSLVCHVGLLLVLSILVFPGMFGGDVPRAVPLAVVALVLAVVLAVTE
VFSGLRWVALVALAAAVAGLIATVCDDPVSGAALWGWGLAWMAVVVWFAV
LASRARSNR
315445424YP_004078303.1 hypothetical protein Mspyr1_38750 [Mycobacterium gilvum Spyr1]MTGLRFRETMTGRIALRARDPVDGYGRVDGYAAVMHITIEIPDVAAFTAG
RVDAARLRADVLIPVLGGRFQTSGGEFVCFRSGEGPDGTPVQQMIYTATL
TNDDRVLEMSARKVLEPRGWRIWRVWPDTTTLLVTLVDVTPDDDKERPRH
LAGMLFITVRGFARQLTTMRPYGSRRWSEKLGALFGYLSFFAGRLIRIYL
SRRMAAE
315445423YP_004078302.1 choline dehydrogenase-like flavoprotein [Mycobacterium gilvum Spyr1MELQNGPCVDEVNYLIIGSGFGGSVMAAELATRRRGVCLFERGKAYPPGS
FPRRVNEIDDSIWAPGFGKHGMFDLWSFDGIDAVTASGLGGGSLIYANVM
LEKPAEWFTQPVPDGNGKTETWSFTHRDLRDHYRAVREVLQVQEIPQSLH
EEHSKKTTKFLDAGSVLAPLAVRFDGADGPAKGAPLPPADYPNIHGDDVE
RTACTMCGECDVGCNRGAKSSLDHTYLSVAAHHGAQICVRTEVREIAPCT
DDSDYLFEVAYVVHPECRNKSEPVEGVIRAKRVILAAGTLGSTYLMLRSK
KLGLSDCAALGKRFCGNGDLLGFALPDGDDDELLPSGGPVITTYRSYDEG
ERRILLQDGGLPNLATWGWGPDDLREALAKLSVPRFASAWLRRLRWPLPL
LGMGADIPDGQLCLKDSDDTKMTCTWKKHTSDNHFQDVARRMEALTKDLG
AGFLPNFLWDFINEVITVHPLGGCPADTSAEEGVVDSYGRVRGVPGLWIA
DGSVMPGPVGANPSLTIAAFARRAAHELRKEDLATPSLPAPFIPQPYGDS
DRSG
315445422YP_004078301.1 LuxR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPVTVLGAQPTKFADRHADPVSARALHVPVQQVWGYRSDRSAVSSDRPPA
VHRPMSEERGDEYVVSFVESMIRRPAALVIQGEPGIGKTTRWMDVCEEAR
RAGVRVLSTRSGVGESALDFVGVDDLLADVEPEVFDALPIAQRTALRQVL
VRSGADGTEIDRRAAIGAFRALVAELATRTPVLIGVDDVQWLDEATRDAL
VYTMRRVRGPVAVVVTERAVTGRGSAVSWLDLGEAGSVTRLVVRPMSVAE
LHRLVAGRTGRSLSRPAMARLAEMSGGNPYYALELAQAMDSVGWVWSAGL
PSSLVDATGLHRERLDADVNEVLLAAASVVGPTVDLLAAVLHRPVEQIVG
SLEKAENLGIASIEAGRVRFSHPLLPHIIYSQARPGERRRIHRAVAAVEP
SPQRQARHLALAATTGDPEILRALDSAAETARADAAPATAAELTEFAIGL
GGDTPVRRLHAARDHLLAGDIDRLLALLEPTAQGLPDGLMRAHARVLVGG
ALAVRGTFGRAVDELRVALADAAEDPGLTVQIQLALAMTLSAAGDHDGAD
DHVRQARMHAEGMADHVLTSQALAAQVLVRTANGEVADEVSLRRAADLEQ
RVHHTSELPAGVHTAAPFSARVVKALVSVWTGRLNEGRAQLAEAQARYAA
RGSDVDVLWIQFHSAMTDIWLGRHGDAARLAEDMLLGAEQLGGTAARALA
AEPRALLATLEGRESDARAEMDRVLEQVSDDVPPSNGLRTVLGFLELSLG
RHAAAVDVLSPLLARSRTGGSIEIATLRFLPDLLEAAFSVGCVDEFAAWV
DALEDAGTRLNRPWIVAVAARCRTMQLAARGELAAAQVTALRALDAHRGL
PMPFELARTQLIVGQLQRRLRQKRLARTTLTEALTIFEQLGTPLWAARAR
TELARTAESPQQHLLTATEQRVAELVASGLTNKDVAAALYISPKTVEHNL
GRVYRKLGIRNRTELGRQMDSLRDGPN
315445421YP_004078300.1 hypothetical protein Mspyr1_38720 [Mycobacterium gilvum Spyr1]MPTFLAEWQRSTFSDPTVSKFVTLLESCAAQIAAPESPVRLIMVLAVAAD
LGVCAVFEADSAQTVLRVCRNAGAMPQRLTPDVEARILASESASS
315445420YP_004078299.1 hypothetical protein Mspyr1_38710 [Mycobacterium gilvum Spyr1]MPDTAVVADRLFAAITRSDIDTVAQMFSPGVAVWHSGDDRDCDHRRAVKV
IDWFVRATVDRRYEITDRRFFDGGFVQQHILHATARSGEAIAMRVCIVII
VGDDGLITRIDEYFDPAEMQPLLVGGS
315445419YP_004078298.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMDQTPTLSRFDDFYKDEDQTPPWVIGEPQPAVVDIERAGLITGRVLDVGC
GTGEHTILLTAAGYDVLGVDGAPSAVEQARHNAKTRGIDARFDVADALDL
GDEPAYDTIIDSALFHIFDDADREKYVRSLGRATAPGSVVHLLALSDTGR
GFGPEVSEETIRAAFADPGWDIEALTTTYYRGVITAPHADAMGLDVGTVV
DEPAWLARIRRL
315445418YP_004078297.1 hypothetical protein Mspyr1_38690 [Mycobacterium gilvum Spyr1]MTALTGRPTTAELVAAVADFLDHDVRGVGGQVGFHARVAANVLRIVEREL
LDDTDDAVRDAISGLGADDESALAQSIREGRLDDRPEEVMTALRTLVRHR
LGIDHPGYADG
315445417YP_004078296.1 aminoglycoside phosphotransferase [Mycobacterium gilvum Spyr1]MSDDLARALEDVLRPVLGDTTVEDLQRLTGGASRTTWAFTSRSDGRSRHL
ILRTGARDDIHASMELEAKVQQRAAAAGAPVPHILAADNSPDAVGEPYLI
CDAIAGETIVRKIFRMLDDTGRARLLTQCATALAAIHRADPDGVGLAAPD
ELAGWRTRLDEIGDTTATFEWTFRRLADERPDPSPMRLVHGDFRMGNLIV
DDSGLAAVLDWELTHKGEIYEDLAWFCIRAWRFGAAESLGAGGLGSVETF
LQAYESAAQIVLDRSTFRWWLTVATLRWGVICRHQAERHLSGEARSVELA
AIGRRVSETEWDLLDLLSGKGPQ
315445416YP_004078295.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MDFTLPDYLPGLLAEMDAFIEAEIKPLEREHIQYFDHRREHARTDWDNGG
VPRREWEELLDEMRRRADAAGWLRYGLPSQFGGRDGSNLDMAVIREHLAA
KGLGLHNDLQDESSIVGNFPQVIMMDRFGTEEQKREWTDALVTGKRSMAF
GLTEPNHGSDATWLETTAVQDGDEWIINGAKRFNTGVHRATHDLVFARTS
GEAGQARGITAFLVPCDSPGFTVPYYWWTFNMPTDHGEVLLENVRVLSGA
ILGEVDRGLEVGQTFLHENRIRQAASSLGAAQYCIDRAVAYANDRKVFGK
PLATHQAVQWPLVELQTEAQMVRLLVRYAASELDRNHHMEVSDKVSMANY
RANRLVCEAADRAMQVFGGVGYSRHEPFEHIYRHHRRYRITEGAEEIQIR
RVAQRLFGFGRK
315445415YP_004078294.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPPGPSETLSAKGRQTRDALAQAARKLFAERGFHGTTLADITSAAGKSPA
AFYRYFNDKEDLLAALAESFLHDVVAPSGLRVPLPESPDDDAFFTAVVTG
YWTMFKQNIGIMIAVAQLAATQPRFTLVQNEFRRFGMDIVAASVRRAQEQ
GYGTELNPEHTAAAIALLFENFTTVFVGASGLGVQMTDQDAIATLSRIWK
KTLYGY
315445414YP_004078293.1 hydroxymethylglutaryl-CoA lyase [Mycobacterium gilvum Spyr1]MSGLPTHVDIRDVSLRDGLQIEEPIPLSAKLDMLAAIAATGVREMEATAF
VSPSKVPALADAAELAAELHNFPDIEFSALVASPNGAKRAIAAGLRSIEY
VVSAADGHSRANVGRSTAEATALIPEIVAIAHDSDVTVEVIVATAWDCPF
DGPTAPQRVLDVVAAATNDAVDRLAIADTIGTATPRRVTDLITLVRPLIG
DTPLGAHFHNTRGAGLASAYAAVGAGVTRLDASVGGLGGCPFAPGASGNI
ATEDLVYLLRDSGIHTDVDLAAAIDAARVAQHAVGHGLPSALLRAGDRIP
G
315445413YP_004078292.1 acyl-CoA transferase/carnitine dehydratase [Mycobacterium gilvum SpMTTGPLDGIRVIEVGTLISGPFAGRLLGDMGAEVIKIEPPGAPDPLRTWG
QAELDGHHFFWTVHARNKKAVTLNLRVPEGRDLFLDLVERSDVIVENFRP
GTLEKWGLGYDVLRERNRGIILVRVSGYGQTGPDAHKAGYASVAEAASGL
RHMNGFPGGPPPRLALSLGDSLAGMFAAQGALAALYRRSVTGEGQIVDAA
LTESCLAVQESTIPDYDVGGVVRGPSGTRLEGIAPSNIYPTADGSWVVIA
ANQDTVFRRLCSAMGQPELATDERFVNHVARGRNQDELDAIIGAWAAERQ
PADVIATLSEAGVISGPINTVAEVVEDPQLQARGMIADHWDERIGRNVKG
PGVVPVLSETPGTIRTAGSARPGQHNDEIYRDLLGRSESDLEKLREGGVL
315445412YP_004078291.1 hypothetical protein Mspyr1_38630 [Mycobacterium gilvum Spyr1]MTKYEYDRIPYLVAYQNNSAVRDVYGGVAELVVLESYLLKPKTFESDTVL
VFMHPIGGGAYLPMINALARAGHHVIYCNSRFRGTDSALLMEKVVEDLGE
CIKDAKNRLGYRKVVLAGWSGGGSLSVFYQQQAQHPTVTASPSGDGPDLT
KLGLIPADGIMLLAAHISRHGTMTEWMDASILDESDPSKRDPELDLYNPD
NPHQPPYTQEFLERYHQAQIARNRRITKWVKEKLAELKAAGRPEDEFAFV
VHGTMADPRWLDPTVDPNERAPGTCYLGDPQEVNMSPVGLARFCTLRSWL
SQWSYDDANGDAVKAGPDIAVPALAIGNLADDACTPSHTRRIFEAIGHED
KEMHEIAGANHYYAGADQRDKLREAVGIVTDWLQRHDFAGVR
315445411YP_004078290.1 homogentisate 1-2-dioxygenase [Mycobacterium gilvum Spyr1]MESFVHLRKGRTPKRIHADLDGLKDDELGRGGFVGRTANMYRRNDPTAYR
TVGPLRPTDVLSSELKPSDATDPRGGPLLMFSNADCQVLLSRRAEEMPFF
VRYVDGDLLSFVHRGSGSLETEFGPLTYRQGDWIYIPKACTWRQIPDPGP
TGTTTLLMVQATEEFRVPPAGTLGRHFPFDPAQAVIPEPQPIDDDGRDEY
EVRLIHQGGPTSLFYKHHPLDVEGWRGDNFPFTFNIDDYTVITSDSVHLP
PTVHLFMQATGVYIMNFLPKPAESVPGTERTPWYHRNVDYDEIAFFHDGS
LYGIPMPPGLVSHAPQGVHHGAPEKARERARRKFDDYDRVDWSVIAVDTR
RRLIPSPEILANDLGQH
315445410YP_004078289.1 hypothetical protein Mspyr1_38610 [Mycobacterium gilvum Spyr1]MAETTRDRVTKFFQKNIANRVMRHIPIQTLLETTGRKSGLPRTTPLGGRR
IGDEFWFVSEFGDRSQYVRNIMTDPNVRLRLRGRWHRGIAHLLPEDDAQA
RMRMLPRYNNVGVRTFGTNLLTIRVDLID
315445409YP_004078288.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MSSKVTAPAAVTDQFIADLSDRAADAERLRRLPAETLADASASGLFDLLV
PSRYGGQEAPFPAILEPVRRMARGCASSAWTLGFYTLHNWMLALFSEEAQ
QEGFAARPFLAPAPLAPTGHGVACEGGIRVTGRWSWATGVMDGNWIMVGA
LCERTAGDPSSLYPVLALLPIGDARIDDVWHTDGMRATGSNDVVIDGAFV
PAHRIVKVTDIYTGAAPGAALHDADTYRWPMVPALALLAAMPALGSAERA
VEIYTERLSQRFLAYEGVMQKDKPVASIHLGSASVRLRALDALLADTVGE
IEDIIAAGDPVERPVRAHARLAAAHIVHESRAVIAELLGASGASAHFLGN
PLQRVKRDVDVIAGHVVFDYDTSRELAGAVTMGAPIPRTAMV
315445408YP_004078287.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAKSGESAGRLSVDDWIQAGYAIIADEGRSALKIDRLCTRLGVTKGSFYW
HFRDMAAYRAALVQAWAELRDSDRSHFGDLGDLTPRERLTRMMASLLGER
QWTLERAMREWARTDPVVADSVHNADLLVLGAVRDAYLAAGFDDDDADVR
ANATFAAGIGFLHLSAAAPDARLTEQRERFLDLMLSR
315445407YP_004078286.1 esterase [Mycobacterium gilvum Spyr1]MRLLDRIRGPWARRLGIATLAALLLPGVVGLTGGSVTAGAFSRPGLPVEY
LMVPSPSMGRDIKVQFQSGGPNSPALYLLDGLRAQDDFNGWDINTQAFEW
YLDSGISVVMPVGGQSSFYSNWYKPACGKNGCLTYNWETFLTQELPAWLQ
ANRDVRPTNNAAVGLSMAGGSSLVLAAHHPGQFSYAGSMSGFLNPSEGWW
PGLINISMGDAGGYKANDMWGPAETDPAWQYNDPMVQIPNLVANNSRIWV
YCGNGTPNELGGGDLPATFLEGLTIRTNRTFQDNYLAAGGKNGVFNFPNN
GTHNWAYWGRELQAMKPDLQAHLLG
315445406YP_004078285.1 YhdH/YhfP family quinone oxidoreductase [Mycobacterium gilvum Spyr1MTQINAMVAHEDAEGGIVLRREILDESALPDGDVEIHVEFSSVNYKDALA
VTPKGGVARSYPLVPGIDVAGTVTSSSSPDFAVGDRVIAHGQDIGTGRHG
GYAQTARYPADYLVKLATLSTADAAAIGTAGFTAAMSVLALRTHGVEPSD
GPVLVTGATGGVGAVSVDLLAGLGYEVVASTGKSQAHDLLRDLGAAEVID
RVPGPDEKVRALGKAHWAGVVDCVGGKTLAYALSTLKYGGVAAISGLAGS
PELPTTVMPFILRGATLAGIDSVLLPIESRREIWTQIESDLAPRHLARIT
RDVPVRDVADVLGTIIGGGVTGRTRVVVHDGF
315445405YP_004078284.1 anaerobic dehydrogenase- typically selenocysteine-containing [MycobMEHRVTCPLCEAMCGLKITVSDGVATSARGNADDVWSRGHLCPKGASLQQ
IHHDPDRLRLPLVRWRSGEHVQVSWDDAFTETERVLRPVIDRYGARAVTV
YIGNPVAHNLGLQTYIGALVGMAGAVGMPAYYTPGTVDQWPLNVVSALLF
GGMWNAPIPDLDRTDHLMMLGANPSASQGSMLSAPDIMGRLAAIRARGGT
VVVVDPRRTPTARRASEWVPVHPGTDALLLFAILHTLAERGWIRRPPHLQ
DLVAGLDDVVGLAARFSPERVEVATGVPAVTVRRLAADLAAAERPVLYSR
IGACTQEFGTLATWLVFVLNVALGSVDAPGGALFPKAAVWSPMFMKPPDQ
DGPGWRFGRFHSRVRRVPEVLGQFPVSCLAEEIDTPGDGQIRGLITVAGN
PVISAPGSRRLDAALSGLDAMISVDNWLNETSRHAHVVLPGLSPLERAHC
DDLYWMYSVASCVKWTEPVFPTRPDRPQEWEILLRLAGAVLGTAVPDVDV
RAMDDLYTQGIIHTACQADDTPLSGRDPGEVFEALDGVGPERMTDLGIRV
GPWGDDLGRRPGGLTLDEVRRHPDGLRLAELEGGRLPDVLTTPSRRIELL
HPLLEADIPRLVSRIDRGRDDLVLTSRRHLRSNNSWMHNVAALMRGKDRC
TLLIHPDDALRHDVADGGQVEVSTIEGSIVVVAEVSDEMMPGVVCLPHGW
GHGIDGTRLAVANAHPGVNSNLLSPPALVDVPSNTQVVNGVPCRLRSRRE
PPHASAR
315445404YP_004078283.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MAINLELPKKLRAVIEKGHQGAAEILRPISRKYDEKEHAYPVELDTVATL
FEGISEAKTISFAGAEAFRDGDDGPKGNINGGNMSAVLNIIEVSWGDVAL
VLSIPFQGLGNAAISGVATDEQLERLGKVWAAMAITEPGFGSDSAAVSTT
AKLDGDEYVINGEKIYVTAGSRATHIVVWASLDKSKGRAAIKSFIVPREH
PGVTIERLEHKLGIKASDTAAIRFDNVRIPRENLLGSPDINVEKGFAGVM
ETFDNTRPVVAGMAVGVARAALEELRKILTDAGIEISYDKPAHAQSAAAA
EFLRMEADWESGYLLTLRSAWQADNRIPNSKEASMGKAKAARVASDITLK
TVELAGTTGYSEQALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSA
ELK
315445403YP_004078282.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MTNTLPPKRGDRESAVGLQKHRRTAIDVGMALLTPLMGQEFLDKYNLRDP
LNRGLKYGVKHGFSAAGAATRQFKRVQGIGKPATRLTENRPKGSDYFDLT
PDDDQKMIVQTVEEFAEEILRPAAYDADDAATYPPDLIAKAAELGITAIN
IPEDFDGIAEHRSTVTNALVAEALAYGDMGLALPILAPGGVASALTHWGS
ADQQATYLKEFAGEHVPQACLTIAEPHPLFDPTALRTTAVRTPSGYRLDG
VKSLVPAAADAELFIIAAQLDGRPTLFLVEASTSGLTVTADPSMGIRAAA
LGRVELAKVTVPLSARLGEEDASTSDAARIYSEAIALSRLGWAALAVGTS
HAVLDYVIPYVKEREAFGEPIARRQSVAFMCANIAIELDGLRLITWRGAS
RAEQGLSFAREAALAKKLGTDKGMQIGLDGVQLLGGHGYTKEHPVERWYR
DLRAIGVAEGVVVL
315445402YP_004078281.1 histidinol-phosphate phosphatase [Mycobacterium gilvum Spyr1]MSTLADDVTLALQLADEADVLTMQRFGAVDLRVETKPDLTPATDADLDAE
RLLRARLGEARPQDSVFGEEFGGTKEFTGRQWVVDPIDGTKNFVRGVPVW
STLIALLVDGVPVVGVVSAPALGRRWWAGQGQGAFTSFAGTTRRISVSGV
GDLASASLSYSDLTTGWDDKRARFVELLDAVWRVRGYGDFWSYCLVAEGA
VDIAVEPEVKLWDLAPLDVLVREAGGRFTDLSGGAGPHGGSAVATNGRVH
DAVLAALDV
315445401YP_004078280.1 hypothetical protein Mspyr1_38520 [Mycobacterium gilvum Spyr1]MILLLVGALVLLARPLLARRRGVGNGWVPGTLLVTGVSPRPDGVSGEQFV
TITGVINGPTVNEYTVYTRMTSDVNSWPTMGQLIDVMYDPGNPEKWAFGS
RPEPLPPTDPPPPAPPAPYN
315445400YP_004078279.1 NADPH-dependent glutamate synthase subunit beta-like oxidoreductaseMPPLRPYYVAIVGSGPSGYFAAASLLKSGGADGNRDVCVDMLEMLPTPWG
LVRSGVAPDHPKIKSISAQFDKTSADPRFRFFGNVVIGEHVHPDELAERY
DAVIYAIGAQSDRALGIPGEDLPGSVPAVDFVGWYNAHPHFVDMAPDVSG
GRAVVVGNGNVAIDVARILVSDPDVLAETDIADHALESLHARGVEEVLII
GRRGPLQAPFTTLELRELGDLEALGDVDVIVDPGDFADITDEDLEAAGKT
VRNNIKVLRGYAETTPKGAKRRIVFRFRTSPIEIRGDGKVESIVLGRNEL
IRGDDGRISAKDTGERDEVAAQLVVRAVGYRGLPTPGLPFDDRAGTIPHV
DGKVEGRRNDYVVGWIKRGPTGVIGSNKKDSADTVATLLNDLSSAELADF
GSDHPDKVQQWLQERQPKLITSEHWKLIDTHERTAGEGSGRPRVKVTSVE
DLLRIGHA
315445399YP_004078278.1 peptide chain release factor 2 (bRF-2) [Mycobacterium gilvum Spyr1]MDPDRQSDIAALDTTLTTVERVVDVDGLRGRIQQLESDASDPKLWDDQAR
AQKVTSDLSHAQNELRRVEELRSRLDDLPVLYELAAEEEGAGSSEAFAEA
DAELAKLREDIAGMEVRTLLSGEYDEREALVNIRSGAGGVDAADWAEMLM
RMYIRWAEQHDYPVEVFDTSYAEEAGIKSATFAVHAPYAYGNLSVEQGTH
RLVRISPFDNQSRRQTSFADVEVLPVVETTDHIDIPEGDVRVDVYRSSGP
GGQSVNTTDSAVRLTHIPTGIVVTCQNEKSQLQNKVSAMRVLQAKLLERK
RLEERAEMDALKGDGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPAAVL
DGDIDGFLEAGIRWRNQKVDDE
315445398YP_004078277.1 small-conductance mechanosensitive channel [Mycobacterium gilvum SpMNTTVLAFDMAGAWRGFWQGDTGVWILGRGVPIALLLIGGLLAARFINWS
ARRITRRIDAQYLESDQLVRTESAKHRQAVASVISWVSVALLFVMVAVQI
TDILAIPIGSLVAPAAVIGAALGFGAQKLVQDLLAGFFIITERQYGFGDL
VELNMVGAPQAAQGTVEEVTLRVTKLRTSEGEVFTVPNGNIVQSLNMSKD
WARAVVDIPVPTTVDLNRVNEVLHRVGETAMQDDELRALLLDTPQLMGVE
SIEVDTVNLRMVARTLPGKQFEVGRRLRILIIAALAGAGISTQEHTPVVS
NISADGDTASSEADARSRAEQKS
315445397YP_004078276.1 hypothetical protein Mspyr1_38480 [Mycobacterium gilvum Spyr1]MTLPSFLQRLQPKNRHSRAYLFGGRMRVSTVGLVLVFFALYWVNQNYQPE
PPAPAMDPAQQVVPPGFVPDPNYTWVPRTNVETRAPEPTTTTTTTTTTPT
TTTTTTPSPTPDTPTTSPETSTPPPAGPLFPSEPTTTVIDPDGPGPLAPQ
TFTQAPPVLTPTTVAPPGPVLPPTPPQP
315445396YP_004078275.1 cell division ATP-binding protein FtsE [Mycobacterium gilvum Spyr1]MITLDRVSKQYKSSARPALDNVSVKIDKGEFVFLIGPSGSGKSTFMRLLL
AEENPSSGDIRVSKFHVNKLSGRHIPGLRQVIGCVFQDFRLLQQKTVFEN
VAFALEVIGKRADTINRVVPDVLEMVGLSGKANRLPGELSGGEQQRVAIA
RAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVVMATHDHHI
VDSMRQRVVELELGRLIRDEQRGVYGMDR
315445395YP_004078274.1 cell division protein FtsX [Mycobacterium gilvum Spyr1]MRFGFLVNEVLTGLRRNVTMTVAMILTTAISIGLFGGGMLVVRLADQSRA
IYLDRVESQVFLTPDASADDPTCDNDPCKALRQTIEDRDDVRSVRFLNRD
EAYEDAIRKFPQYKDVAGRDAFPASFVVKLDDPEQHQNFDEAMVGQPGVQ
SVLNQKDLIDRLFAVLDGISNVAFAVALVQAIGAVLLIANMVQVAAYTRR
TEIGIMRLVGATRWYTQLPFLVEAMLAAFIGVVLAIVGLILVRALFLEKA
LDQFYQANLIAQVDYADILYYSAPWMLFLGLAMSGITAYVTLRLYVRR
315445394YP_004078273.1 SsrA-binding protein [Mycobacterium gilvum Spyr1]MAKKPKSVKDTNNMVVASNRKARHNYSILETYEAGVALVGTEVKSLRDGT
ASLADAFATVDDGEIWLRNLHIPEYHHGSWTNHAPRRNRKLLMHRREIDN
LVGKIRDGNLTLVPLSLYFTGGKVKVELALARGKQAHDKRQDMARRDAQR
EVTRELGRRVKGMTN
315445393YP_004078272.1 integral membrane protein [Mycobacterium gilvum Spyr1]MAALGYGVSDFVGGIASRRVAALRVVVISYPVALLLLVLAAVPFGGQLST
AAILWGLSAGIVQAFGVWWFYAALGSGPISVVSPLTAILVAGIPVLAGLA
FGERPGTLAGVGVVLALIAVVLVSRDSAGDAEAARTGARFTAKVAWLTVG
AGVAFGLNFVILHRIPKEAQLWPLVFGRAAAVVVVLIAAVATANLVIERG
VPLRLAVLAGGLDTVANIATLVALQSSLLSLAGVLIALYPAATVVLAIAV
LRERVSRSQCVGMVLALAAVGMIAAG
315445392YP_004078271.1 diguanylate cyclase/phosphodiesterase [Mycobacterium gilvum Spyr1]MTGYRIRASVVLAATLLVLVNGFAPWGQAAALRVDAILQVCTAAVAVVYG
LWVARRVHGVSRTWRLLAVGAVAGLLVGELVWWEPTEALPVAWVIPYWLF
LILALASMVVLARAGRGMSIPADGSLRHTAVITVLDAGVAAASFAILVFL
GRYGAFSVSSWPHSTDPSVEIGYAVFQLVVVVIAAVVGMMYAADRPFRSN
FLQLACGVVMAISSDRVIAYFDSVGNEGAQIWAGVGVVLGPLLIAFSFRE
RTDGIRGPTDTMRPMDWAQMTLPYAGFIGITNLLSYHVLTGNTLDPAVVM
TTLVMVILVAARQVVAMGAQRRLTQRLYEAQRGLAHQVHHDALTGLPNRL
MFAQRLEAAVQHGDFVLIFVDLDDFKEVNDRFGHAAGDELLCAVGERLRR
HVRSEDTLARIGGDEFAILIDGVRDIPELIADRLRVALRDPFPVHGSSLR
VRASMGLVRSGGEGGLQTPDDLLRQADISMYAGKRLGKDTAVVYQPSAGV
RAEFPAALREAQGGVPDGFALAYQPVVHLPDQTPAALEALARWTAPNGIL
IAPETFVAVAEASGLGATLDAMVLGLACREVKDAGLDVDIHVNVGAARLG
NPTFEEQVHRTFDECGMEPSRLVLEITETVPIVDLADAAAQIERFKALGI
RIALDDFGAGYNSLTYLHALPVDIVKLDRSLAVGADPERDLALYRSVIGL
CTDLGMDVVAEGIETQLQADTVYAAGCAFAQGHLFGKPVAISELTRGWHE
PSGQIGGGGREVNQPTNQPT
315445391YP_004078270.1 hypothetical protein Mspyr1_38410 [Mycobacterium gilvum Spyr1]MTESGASRVAVYLDFDNIVLSRYDQVNGRNSFQRDKAKGFDEVRDKLDRA
TVDVGAIIDFASSFGTLVLTRAYADWSAEINARYRGQLVGRAVDLVQLFP
AAAYGKNGADIRLAVDAVEDMFRLPDLTHVVIVAGDSDYIALAQRCKRLG
RYVVGIGVAGSSSRMLAAACDEFVTYDTLPGVPVFEPEPVADEKPAPKRR
STRTKSTAEEPSTETPEEPEQPDPQASATGLLTRALRIGLEKDDADWLHN
SAVKAQMKRMDPSFSEKSLGFKSFSDFLRSRSDVVELDESSTIRMVRLRE
NA
315445390YP_004078269.1 hypothetical protein Mspyr1_38400 [Mycobacterium gilvum Spyr1]MEAVSSVGQGREPLRHTVLADADSAAYHSLRQRPVTRAERYALGKSLRKR
VPRKSLADWAPRADRPDPVRLIEVNHRGRLGQLVPVRVGRMIASPYGFLR
GTAVVMADDVARLPSTGIMPVVCGDSHLGNFGFYASPERDLVIDLNDFDE
AHPGGWEWDLRRLVASIWVAGRHNGASEDDCEAAVRSCVSAYRLEVRRLA
DEPLFSRSFTRIDVDRLAGEAAGPLADEVRRSAARARNRTSDRALPRFTQ
EVDGVRRIIEEPPLITRLPAQEADALAEALDAYLPTLASHWRRVLGGYTL
LDVAHKVVGVGSVGLRAYVALLEGSSPEDVVFLQLKQARRSVLARYVHGE
SAWHAHQGQRVVEYQQALQTVSDPLLGWTTVNGLQFYVRQFRNMKGTIPL
DAMHPKALIDYTGVVGQLLAKGHARTSGASMIAGYLGRSEKVDIALSTFA
RRYADQTEADHAALVAAVEDGRLPVERGV
315445389YP_004078268.1 hypothetical protein Mspyr1_38390 [Mycobacterium gilvum Spyr1]MSAIDPDKLRTCLQVLADIEALPPEHPDAVAVRRATASIFKSVRKARRHA
KRDAVAAADRAVIAATATGAPGRIDDETAGLPLVSTADGATAGTLQRSRA
CYVCKTHHTVVDAFYHQLCPSCAALNRAKRDARTDLTGRRALLTGGRAKI
GMYIALRLLRDGAHTTITTRFPNDAVRRFAAMPDSADWLHRLRIVGIDLR
DPAQVVALADTVAAQGPLDILINNAAQTVRRSPGSYAALVEAERAAPAEL
DLVDVISFDRVSDAHPAALAGSLAEQHTPHAVTELALAARSASPERIAAG
TAIDAGGLLPDTAPVNSWTQRVHEVDAMELLEVQLCNQTAPFILVSRLRP
AMAASSARRKYVVNVSAMEGQFSRAYKGPGHPHTNMAKAALNMLTRTSAG
EMLEQDGILMTAVDTGWITDERPHPTKLRLADEGFHAPLDLVDGAARVYD
PIVRGEAGEDLYGCFLKDYSPGNW
315445388YP_004078267.1 hypothetical protein Mspyr1_38380 [Mycobacterium gilvum Spyr1]MGSARLAAVLWILGATVYLVCETVAAAAVPGYSYITDYISELGVREVMNV
GAFMVHGILFGLAAVVLVRGCPLMGARVFLIAAVANTAGNILVGTFQSGT
PNAHWHVIGAGLAIVGGNVALITAGIAGRAVRAPTWFRRASVTLGGFGLV
CLIALITDGANGSRALPAGMVERGSVYPIIIWELLAGITLLRRR
315445387YP_004078266.1 Cutinase [Mycobacterium gilvum Spyr1]MDLAAGADPWHLCDHRTVGLSECLAGVTGPALALAAGLLLAPHAFAQPAL
PPAPGPAPAPVAAPAPEPLAAAAPGCPDVEIVFARGTTEAPGLGAMGQAF
VEDLRSRLGGKTVGVNAVDYPASPDFPTAVEGIADASTHVQQIAMNCPDT
KLVLGGYSQGAAVMGFVTTELIPDGVSLSEVPAPMPPDIADHVAAVALLG
APSDRFMDMIKQPPVTIGALYQPKTLELCVPGDFVCSPGNDLGAHARYIS
DGLVVQAADFAVGKLAETPAESGGAPA
315445386YP_004078265.1 thioesterase [Mycobacterium gilvum Spyr1]MESGSPPIVSTVARPHPARLDAACYPVHRAVDTRFGDMDANGHLNNVALE
SLHENTRAMLNRQVFPNVYDRTTRSLRIVTSTIVVHYLREAPWPSVIDTA
IGIGRVGRTSYVASTALFHDGGCVSLCDTVLVVLGDDGPTPIPDENRDRL
ESLALRVA
315445385YP_004078264.1 hypothetical protein Mspyr1_38350 [Mycobacterium gilvum Spyr1]MTNPRDPETRRLPRPGGPDAPTERIRRPPLPPRPSLPRTSPPPTAPASGD
NRGGRGFFTRRTSTLLAVIAVAALAGGLAGAELYARHRADAVLVGIAECV
VEDGTTISYGVNPPFLWQHITGRYTNISVRTAGDRVQSADGMTADVTLED
VRLSGSGDSKGAIGALDATLTWTAAGIKDTVAANLPGVGALVTDVTTDPS
AGTLEMAAGSASVIAKPVVVKGNLNVEVLDVTGPFPKDAVQSALDDLTRK
LNDNYPLGIRADSVEVTDAAVVGSFSSRDASIPDGESDPCFARL
315445384YP_004078263.1 AsnC family transcriptional regulator [Mycobacterium gilvum Spyr1]MTRLDRTDARLLLALCDAPRATGVQLAAMLNLARNTVQARLARWDQDNVL
APIDRCVSPRDLGYPLKAFITVVVDQHKLEDVIAELATVSQITQVTGLSG
AADLLIAVVATDADDLYRVAGLVLAVPGVERTTMSIAMHEVIAYRTRPLI
EELARGR
315445383YP_004078262.1 indolepyruvate ferredoxin oxidreductase- alpha/beta subunit [MycobaMTDLDVRPPDPHPYDLDNRYRAGSDAVLLTGVQAIARALVEQHERDARAG
RRVATFVSGYQGSPLGGVDRMLSGMPDVLQAHDIVFVPGLNEELAATSVW
GSQAELPAGTPTHDGVVGVWYGKGPGLDRATDALRHANMYGANARGGMVL
LVGDDPASKSSTVPAVSERSLAALGIPVLFPRNAREIVTLFLHGVALSRA
SGCVVAVKIVADVADGAWTVDADDLDLEIVDPEVEWQGKPFVYRQRPMAA
PADSLLAEADLYGPRAEMVQAYSSANRLDVVEIDPPDARIGIAAAGTTFD
SLRQALTDLGADDSALRAAGVRLLRIGMVSPLCADTVLGFASGLDEILVV
EDKTAFVEAQMREILYGATNPPRMMGKKDAAGRSLIPADGELTAGRLLAP
LRRVLGDRLELRKPPPPALPLEVLPTRRTAYFCSGCPHNRSTAVPEGSLA
GGGIGCHTMVTMSGRADSAVTGLTQMGGEGSQWIGQAPFTDIAHLFQNIG
DGTYFHSGQLAVQACVAAGVNITFKLLYNEVVAMTGAQHAEGALGVASLT
HKLKLEGVAQVIVCADEPRRHRRRDLAAGTLLWHRDRLDEAQRRLRDVPG
VTVLIYDQHCAADARRQRSRGTLPSRTTRVLINEAVCEGCGDCGVKSNCL
SVQPVDTEFGRKTRIDQTSCNTDYSCLDGDCPSFVTVEVTPGRARKPGSA
PTPPPVPDVCVEPVTSTHNVLLAGIGGTGIVTANQVLATAALRAGYDVES
LDQIGLSQKAGPVVSHLRFAADRLEPANRLTPGTADCILAFDLLAAADEK
NLGYGDPATTVSIASTSRTPTGEMVYDASVAYPDTSSLLHRLGRASRRVQ
EFDASAAAKTLFGNTAAANFLLIGAAYQAGALRIPAAAIEEAIGINGVAV
ATNVAAFRWGRVAIADPAHFHDVAVPVPAGPVGTAPVHLLAGTGISGRVG
DLIARRAADLIAFHSEAVARRYVSVLQRVWTAERRIGSRTEFSEAAAKGL
YKFTAYKDEYEVARLLTHPRFLAQVRAEFPAGENLTYKVHPPTLRALGRR
KKIGLGPRSHVVLRALAAGKRLRGTVFDPFGYAHVRRVERRLLAEYTDLI
TGVADTLDEHNYDRAVQVAGLADTVRGYEGVKLASVEVYRARLREMGF
315445382YP_004078261.1 Cutinase [Mycobacterium gilvum Spyr1]MTARTMSAHAQKTLLAALSAFTVLFAGSAVGTPTASAAPRCSDIELVFAR
GTDEPPGLGVVGKSLFDSLKPMVRGKSIGTYAVKYPATWDFAQVAVGAND
ASRRIQTIAAACPDTKIVLGGYSQGAAVIDVVTTAPIAGLGYTAPLPRAV
VPHVAAVAVFGNPSARIGRPLTLLSPDFGSRTADLCNTNDPVCSRGTDFD
AHVRYPQSGLVKLAAQWITKHVEQRV
315445381YP_004078260.1 hypothetical protein Mspyr1_38310 [Mycobacterium gilvum Spyr1]MTWDDPDAASLRNLLDEHRLRALVHRYCRAVDRGDVEALRTLYHDDADDA
HGDFSSGSVRDFIAGIAAARPYLRSMQHHVTTTNFAIAGNVAEGEIYMIA
THTLIADGRDVDVVVGGRYLDRYEKRDGTWKFVARAIVTDTAHVLDPSTR
DPVTRGTPLGSMGDDDPAHAFFTLLKLLQE
315445380YP_004078259.1 streptomycin 6-kinase [Mycobacterium gilvum Spyr1]MPEVDSPAADDPAGDASAVMAAWSLQADGQEYARTRAYVAPVRTSDGQAA
TLKIAAPGPGTAHEHLVLRRWDGHGAVRLLRADPHRRAILVERAGRDDLT
AAPDRRACEIVAQLYRRLHVPAMPQLSSLTEDVRRRTLALADLPRSAPLP
RRLVEQAITLGRELTVEPAERVVLHGNLHYRNALAADREPWLAISPRPCN
GDPPYELAPMLWHRFDDLAGNVRDGVRQRFHRLVDGAGFDEDRARAWTLV
RVVHAAADDLRTEPASATTQLTRYVAIAKAIQD
315445379YP_004078258.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMRFGNFMAPFHPVGQNPTLALERDLDLIVAMDRLGFHEAWVGEHHSAGFE
IIASPEVFLGVAAERTKHIRLGTGVSSLPYHHPLMLADRMVLLDHLTRGR
VMLGCGPGQLTSDAHMLGIPADEQRPRMEQCLDAIVRLLRGETVTMHTDG
FTLQDARLQLKPYSEPCFDIAVAASFSPTGPRGAGRHGIGMLSIAATARQ
GMDLLAQHWNTWDEVAREHGHQADRSKWRLVGPMHLAETREQAERDVEYG
IAEFSRYFTHILPSGPVQGDTPEEIIANNRQSGFAVIGTPDDAIAKISEL
VEASDGGFGAFLLFDHDWAPPAAKLRSYELFAQYVIPHFTGQLAAPIASR
DWVTESGRVFVDQATHAIGRAIESHAAEQQAKHNPTSG
315445378YP_004078257.1 hypothetical protein Mspyr1_38280 [Mycobacterium gilvum Spyr1]MYRRSGADLPFGDPLPTHGTEMEGWFWRLSDAASGRVAIALCSANRHPDG
DWSTAAIAVHPGGTVRSAAIDGVRAARDRFLVTADSGGHCLHADRDRLHM
VIDDCEIDMTMRESVDWPKAFGGGGVFSSVPFLNQYWHPYRLGGRAIGTV
RTGAQTWTFTDATLYCERNWGAGFPRRWWWGQAHDFGDADVSVAFSGGLL
ELGPLRRDVTGVVVRLGDRVIRITPPAPVRSDCDVDRWRITARTPRFHVE
LDGQAVPGGPHVLPVPLPGERRNIDTDYEYLAGRLRCTVRERGRTLFDGI
SELAGLEVGSRAS
315445377YP_004078256.1 amino acid transporter [Mycobacterium gilvum Spyr1]MSVDTAEGTAEPTRLARRITGPLLFLFILGDVLGAGIYALMGELSSEVGG
VLWAPMTVALGLALLTAGSYAELVTKYPRAGGAAVFAERAFGKPLISFLV
GFSMLAAGVTSAAGLALAFSGDYLATFVDVPVALAAVVFLALVACLNARG
ISESLKTNVVMTAIELSGLVLVIAVVAMMVGRGDGEVSRVTEFPDGTTPA
LAILGGAILAYYSFVGFETSANVVEEIRDPRRVYPRALFGALITAGVVYA
LVGLASAIAVPTDELSQSSGPLLDVVAASGAAVPDWLFSLIALIAVANGA
LLTMIMASRLTFGMSDQGLLPSVFARVLPNRRTPWVAIVATTAVAMALTL
VGDLSMLAETVVLLLLVVFLSANVSVLVLRRDHVEQDHFRVWTFVPVLGI
ASCLLLLTQQTAKVWLLAAALLAVGVVLYLLAKRFGGHGVQDTGDAAPSR
SE
315445376YP_004078255.1 esterase/lipase [Mycobacterium gilvum Spyr1]MTVRRIRPSIGRVSARAGAWTLAVGAGAVIACTATAPAWASEDGTSAEPR
SAAAAPSKPAQDRPSRASAERRADADTGADASETRVSSRPSRTRATDGDD
PDTDTTTVEVADAPEPSDPGDVEEPAPESPVAAPALWSLVGSARPQDSDD
TATAAVPGTATEAAPTADTTDPTDTVPAAADVPVVDQPVYTGRPSFVQQV
VIAGLNVLKVVLKPFGGLLAFTSLKIPFFTDGVPPFFLTPGLDVERTEFD
GMKVWSLTPRRDQTDQIVVALHGGAYVATASIFHWWTYADMARDTGATVV
VPLQTLVPRGGTAATEVPRTADFLTEMIDAHGAHNVSVFGDSAGGGLALA
AVQELNRRSAATPSRLVLLAPWLDVSMSDPRSAEIRDPLLDIPNLVRSGA
KWAGSAGVTDPLASPLFGSLEGLPPTYVYSSSRDLLTVDTLRLRERVGAE
GIPNVEFRLRAGLIHDWFTFPFLPDAHEDRAGVYSDLLGAASPVS
315445375YP_004078254.1 RNA-binding protein with PAS domain [Mycobacterium gilvum Spyr1]MRLKRALKWNNAEMPHTGRVVGSELDEMVRTHGNLRLGSFRFWFVGQRWE
WSDEVARMHGYEPGTVTPTTELLLAHKHPEDRQHVQELLDRALHSGGSFS
SRHRFIDTRGGEHTVLVLADRMTDADGAVVGTEGYYIDLTDTLDEARRDA
LNSTLPDLFAARASIEQAKGALMLVYGVGPDQAFELLQWRSQQTNTKLRT
LADRIVADFPNLRAPRDELRRQFDHLLLTVHQRVE
315445374YP_004078253.1 anti-sigma-factor antagonist [Mycobacterium gilvum Spyr1]MAERVGLLEIGQEVQDVAVVVRAGGEVDSGTVETLAAALDSAVADAAAHP
ARTVVVDLDGITYFGSAGLNALLTCREQGEGRGVAVRLVATTAEVTRPIE
VTRLARILRPYPSVGEAVAAPEDPR
315445373YP_004078252.1 PAS/PAC sensor hybrid histidine kinase [Mycobacterium gilvum Spyr1]MSGVDGVPAGGVFAGGGVVGHDHAQVNWAATPLGPTSEWPQSLQTAANIL
LSSRFPMWMAWGPDLTFFCNDAYRNVTLGRKYPWALGRPASEVWAEIWDD
IGPRIDRVLSTGVATWDTSLLLFLERSGYTEESYHTFSYSPLRDDDGTVV
GMLCVVSEDTLQVIGERRMATLRDLGSDPSVVRTEKEILSFVDRQLAQNL
RDLPFTLTYLFDDDGSAHLAGMSGITGDHPAAPAVLTGADGELWPVGPPA
GGETVLLEVDTAPYPAMPTGDWREPPRQVLIVPLLQQGAAPTGFLVAGLN
RYRVLDDAYRGFVALVAGHIAAGIGLSRSYRTQQLRAEELAELDRAKTTF
FSNISHEFRTPLTLILDPVSELRRADTLGDAARQELDVVWRNGLRLTKLV
NTLLDFSRIEAGRSQAHYQPVDLGAVTAELASVFRSAIERAGLVFDVDCP
PLGEQVYVDLDMWEKVIFNLLSNALKFTFEGSVSVTARRDGRGAVITVSD
TGTGVPADEMPRLFERFHRIENTRARSNEGSGIGLALVKELVGLHGGTID
ADSAESRGTTFTIRLPWGAAHLPADAVVSQPRERRPGNTVDAYVEEALRW
TPDGVREYVAESAQPTTGPEKPIGTGTLARVLVADDNADMREYLGRLLRS
DGYAVEAVVDGRQALEAIRAEPPDLVISDVMMPRLDGLGLVSELRADRRT
AAVPVLLLSARAGQEASISGLQAGADDYLVKPFAAAELLARVRANIQLAR
LREGHARWRTALVDSLQEAFFVCDEHGAVVEINPAFTEILGYDSTGLPYP
LMHPWWPLKGSDAEANRRVEEAFGSFMRDPHGTLTEVPVTHRHGHRLYVT
VTFSHADDPETGRDVIVGTLRDVTAERYIVQRESALASLNEKLAQADTLD
DAVLAAAEEFSSIWSARRVVAATWPDEPDGEHESDAPSLTVVGAPATWDG
LPGNARELILTLRRDHLLAPHTSDAGAAGVALRHPRGVLVLYVELPEQRL
FTAEDDTLLTVLAGRLGQGLQRVHQIDQQRETALALQHAILGPSLSSAFA
VRYQPATRPLQVGGDWYDVVDLEDGRIGLIVGDCVGHGLAAATVMGQLRS
ACRALLLEHPSPAAALSALDRFAARLPGARCTTAFCAVLDPRIGEVVYSC
AGHPPPIMVTADRTTELLEGARATPLGLKNPPHRTEARVTMPARATLLLY
TDGLVERRRESIDDGIARATDVVQSNRATDLDQLANVIMARLAPADGYHD
DVALLLYRQPEPLDLDFPADVAELAGSRTVLRGWLDSAGVPQDQALDVLI
AVGEALANAIEHGHRDDPGGRVRLRAVALPDRVQLTIIDTGSWKAPDDVP
ALHRGRGIALMKALMQDVTIDSQTTGTTVHMNTRIA
315445372YP_004078251.1 STAS domain-containing protein [Mycobacterium gilvum Spyr1]MATPLQLRTERHDGELVLVAVGELDLSNIHTFAGAIGSAVAGTDGAPLHV
DLSEVEYLDSGAINVLFDHAESIDLVVNPMLLPVLSVSGLTDVVTVKPAA
VS
315445371YP_004078250.1 DNA primase [Mycobacterium gilvum Spyr1]MGTSENRDGVDLTNLDQPLSDDADATKRDLVDYLDAVADRILPVLAGRPL
TVLRALRGRAPFMQKNVPKYTPDWVRTVPIWAEASRREIRYAVCDDRRTL
LWLANQRAVEYHPALGPADDVYRPTHLILDLDPPDDGDFASVVAVAHLVR
RALADCGLDGAVKTSGSRGLHVFVPIDDSAPVDDVAAATRALAARTEALD
PTVATTAFIVADRAGKVFVDATRAGGATVAAAYSPRLRPGTPVSFPVAWD
ALDRIHPSDFTVRTAVSALAGGDPWADAMPAPTRLPADLIEQGRAIPVAR
VAAMHEGKRRARARRKDDEAGADQTG
315445370YP_004078249.1 TRAP transporter 4TM/12TM fusion protein [Mycobacterium gilvum SpyrMDRTTASTVESTALGQVDDQDKPGRELRGWTYGLVAVVAFAVAVLTIWQV
FRPLSQGSQYYLIVFLSGTLPLVYLVYRSGWRWSDPEDRPGVLDWALAFV
AVLVCLYPVLAPAIGAAGGGYNAFLDRQGMLDPLDVVMGALLLVLIIEAC
RRTTGWALPIVCAAFLAYGYYGGLMPQGWAIAHAGLDFDQIVDALYNSGS
GFFGTPLDVAATYIVLFTIYGAVLELSGGARFFVNLSVAAFRRSRSAAGR
TAVASGFLLGTVSGSGTATAVSVGAVTWPIMRRAGYTPERAGGVLAAAGV
GALLSPPTLGAAAFIVAEYLEVSYLTVLGWAMIPTGLYYLGILLAVEIDA
RRFGMKAANLDAASPWKLLGRFGYHFSSLIAIVVLLAVGMSATRAVVFAT
VLAFVLSFADRRFRLTPRRLFDALSAGVRGVLPVVAVCAAAGVITAMTTK
TGLGAQFSSVLVGGVDAITDNRTVMLALTAVFSAVALALLGLAIPVTASF
VIGWVIIGPALLALDVPAPAAAMFVFYYSVLSEVTPPTALAAVGASAVTG
GQAIPTMWQALRYAAPAFLVPIAFVLTDPGEYLLARGPVLGVLWASAVAC
VGIVALSFAAGGWVLGVGAMGPAARVLTASAALLLLFLDPVSIAAGFACL
LGAVAFTFITDKRRQI
315445369YP_004078248.1 TRAP transporter solute receptor- TAXI family [Mycobacterium gilvumMKRTVTVFATLVLTATAAGACGGRQDSPTADSGGKITCEVGTETRVSIAT
GNSTGVYFSLGNAFAEQVSAATGGTVKATAAETGASVQNIQQLVAGSYQV
AFSLADTASDAIEGKGSFEGEEQPIQAMSRIYPNYTQVIARTDSGITSIA
DMRGKRVSTGSPGSGTEVIANRLLESAGLNPQTDVAAQRLDLTKTVDGMK
DGSIDALFWSGGLPTPGITDLFTSARGDVTFIDVTPQLGRMAEISPAYKQ
GLIPAATYQLPSDVATIVVPNMLLVRDDLDANLACVLTRTLFEKQPEMAQ
VVGAATGITLDNARDTDPVPLNRGAEYALDELNAPR
315445368YP_004078247.1 transporter [Mycobacterium gilvum Spyr1]MADAGRSGIGRIIRVLAVPIVLGWVLLTVLTNVAVPSLEKVGEEHTVGMS
AGDAPSMMSMKRVGANFEEFDSDSSAMVVLEGEQPLGDAAHRYYDQLIDE
LEADTANVQHIADFWGDPLTASGAQSTDGKAAYVQVYLQGNQGEPRANEA
VAAVREIVDRTPAPPGIKAYVTGGAPLVADQHSAGDTSVLRVTLITIGVI
AVMLLIVFRSVATMVLILFMVFAELGAARGIVAFLADAEIIGLSTFATSL
LTLMVIAAGTDYAIFAIGRYQEARGAGEDRETAYYTMFRGTAHVVLGSGL
TIAGAMLCLSFTRLPYFQTMGVPCAVGTFVAVIAALTLGPAVIVIGSRFG
LFDPKRAISSRGWRRIGVSVVRWPGPVLAATLALALVGLVTLPGYKTNYD
ARDYLPEDIPANVGYAVADQHFGSARMNPELLMVESDHDLRNPADFLVID
KIAKSVFRVPGVARVQTITRPDGKPIKHTTIPFQMSMRGTTQRLNEKYLQ
DRMADMLVQADAMQTNIDTMTKMQSLMTQMSATTHQMVTKTKAMTADIIE
VRDNLADFDDFFRPVRNYFYWEPHCYDIPVCWTMRSVFDTLDGINPLTDD
ISELIPDLERLDELMPQLIALLPSQIETMRSMQAMMLRQYQTQKGQLDQN
AAMSEDADAMGEAFDDSMNDDSFYLPPEAFDNDDFKRGMENFISPDGRSV
RFIISHEGDPATVEGISEVVPIKTAAKEAIKGTPLEGSTVYLAGTAATYK
DMSDGAFYDLLIAGIAAVTLIFVIMLVITRSVVAAAVIVGTVLLSLGASF
GLSVLLWQHIIGLALHWMVLPMAVILLLAVGSDYNLLLVSRFKEELSGGL
KTGIIRAMAGTGSVVTSAGLVFAFTMASFAFSDLKMMAQVGTTIALGLLF
DTLIVRSFMTPAVAALLGRWFWWPQKFRSAASERRLARIGVQPATAGR
315445367YP_004078246.1 haloacid dehalogenase superfamily protein [Mycobacterium gilvum SpyMSTQSVSPAVLFDIDGTLVDSNYLHVHAWMRAFDDENLPVSAWRIHRCIG
MDGTTLVRTLSGDAGQGVLDRLKDAHSRYYKEDSSLLAPLPGARDLLRRV
AATGLQVVLATSAPDDELTLLREVLDCDDVVAAVTSSADVDTAKPKPDIV
QVALDRAGVGAQDAVFVGDAVWDCEAAGRAGVTSIGLLSGGVSRGELREA
GAAGVFEDAGDLLAKLDSTVIGDLAARVSDPR
315445366YP_004078245.1 hypothetical protein Mspyr1_38160 [Mycobacterium gilvum Spyr1]MNSPLRKTLIAAGGTTVLMLAVGCGGSDGGEETTTSTTTESSVTTTTTTA
PSTPETTMAPETTGAPAPGDPSQPGGGGSIPGGPTGSGGPEGGGGSIPGG
PTGSGGPDGGGGSIPGGPTITGGPGGGSGSIPGGPTINIPVP
315445365YP_004078244.1 hypothetical protein Mspyr1_38150 [Mycobacterium gilvum Spyr1]MSGGLFALLDDVAVLAKLAAASVDDIGAAAGRATAKAAGVVIDDTAVTPQ
YVHGIAAERELPIIKRIAKGSLRNKVLIILPVALLLSQFVPWLLTPILML
GATYLCFEGAEKVWGMIRGHKSHGTLVAGSGEAAEKAMVAGAVRTDFILS
AEIMVIALNEVADQSFLPRLIILLVVAVVITIAVYGVVAAIVKMDDIGLS
LTQRSSGFAQKIGRGLVAGMPKLLSALSVIGTVAMLWVGGHILLIGADEL
GWHAPYALVHHAEELVHHVAGVGGVLGWLVNTAASAVIGLIVGAIVVAIV
HALPFGKKKDAHA
315445364YP_004078243.1 hypothetical protein Mspyr1_38140 [Mycobacterium gilvum Spyr1]MAATHGRFIGRVGGLAVALGIGAAIAAASPTAAAEDTPSSAASTGTEASG
TEASSSPSSDSESPARQRKPSRSEVETAGEDRDARASERSDGDADDAGAD
RLRADEGPDDEDPADDERETPEPADEEPATAVAAATAPTATTSTAATPAK
PSDPDRSPAAPVSPLATPQQLEAERIATETVGTWPVRLMKQVLSAGWRAT
AAREYRQISGPDPENLVTLRRAVDEYALAAAFQQQLLNSMTPTVVAQVAP
PHTWYRQSVGGSRILYDNPDTVYRFMGVNMTSTYVIRGRFTDAHPADTNF
SVLTGLSGITADNLSGRQIDIGPDGSFTITVSGEAAAPGQRNHLQLTPDS
TLVAVRNTLSDWNTQSPMTLSIERLTGPRNSLFSQLGGFAIPGLGPLVTR
SPLLTSLVSSIPPMKEPPPVLRGVFTAVIMALGLGQESKYIKVATTDAET
GERVPPNVLRDPSRNAEFLATQLQSAGYFHLADDQALVVTIAPANARYFI
VPVTDLWTITGDYWHQQTSLNNAQAVPDPDGRYTFVISPTDPGVHNWVST
GGMNKGTVSIRFQDLDLASSQTPTLTSAVVAVSDLDSVLPPTTVFVTPAQ
RATQLTERATGFARRFGVPS
315445363YP_004078242.1 transposase [Mycobacterium gilvum Spyr1]MIDLSRSTWHYRTNPRPPVSDPLPQKHRAYPSRIDEADRAVIRDKILAGW
EAGSSVDHAFAASWDEGVMLASRRSWWRIAAAIEDQSARPVAPTRSTSKT
PRQAPVLKATGPQQIWSWDITDLRSPWRGVAFKAYSILDIYSRKIVGWRV
EERECDDLAVDMFEAAFAGHGLPAVVHADSGPAMRSTVLKDLLAGLKIGQ
THNRPRVSNDNPFSESEFRTMKYRPNYPGVFTDLDSARAWVSAYVSWYNQ
HHRHSGVELFTPDSVHDGTWAQLWDRRDTALQAYYDAHPERFRNRPRTKS
PSPVVGINLPTENDPDRLQAA
315445362YP_004078241.1 transposase [Mycobacterium gilvum Spyr1]MTTGKDVDSSLVEAGSTVEMAEALRASGAVDELLAQVDSGEVALTGEGGL
LPGLIKLALERGLAAELTEHLGYEKGDPIGRAMPNARNGHSPKTVQSEAG
PVALEVPRDRDGSFTPTLVPKGARRIGGLDDMIISLYAGGMTLRDIQFHL
ASTIGTEVSHETISKIVDEISDEVLSWQRRPLEPLYPVIYLDAMIVKVKD
GGHTRNKAAHIAVGVDMDGVKHVLGIWVQPTEGASFWASVCSDLANRGIK
DVLIVCCDGLTGFPEAIAATWSQAAVQTCVVHLIRNALRFVSYGDRKAVA
AALKPIYTAPSADAAHAELQAFTTSELGKKNPTVTKAFERAWEQFIPFLA
FPPELRRVIYTTNSIESLNYQMRKVIKNRGQFPNDASVVKLLWLAICNIE
DKRAAERAKERGKKLCRTAPGRLVEGQVVTNWKKALEQLSLVYPDRIERY
L
315445361YP_004078240.1 hypothetical protein Mspyr1_38100 [Mycobacterium gilvum Spyr1]MDTDRVTELRRWEDSGAVWRVVGRTSSTVTVALFSCDGGEQVGVFTSEDP
RLLQFVGDRDTNAD
315445360YP_004078239.1 hypothetical protein Mspyr1_38090 [Mycobacterium gilvum Spyr1]MDAAHAVATAAIFVWLGMVLAISFLEAPLKFRAPGVTLPIGLGIGRLVFR
ALNTCEVVLGVAAVAALVSGEGSTAALIASIVAVAMLLSQIVFVRPALTR
RSDQVLAGADGPRSRAHYVYVALELVKVVALIVAGVLLLTHSA
315445359YP_004078238.1 Siderophore biosynthesis protein domain [Mycobacterium gilvum Spyr1MTDALPLLARELTDLSDAVRAVPAPPIPHLDAPYAMRLVDPDTDAAMISE
WMNRPHLAEAWEYDRPVEWWDGYLRAQLAGEYSRPLIGTFHGEPQGYVEV
YRAAKDSIAPRYDADPYDLGLHAAIADLGLVNRGFGPLLLPRLAANLFEI
EPRCRRILFDPDHRNAGARRLCEYARCEFLGEHEMSNRRMALYALHRPA
315445358YP_004078237.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MSVLATALSEAMTASTRDLVLLDRASGLWVRHPWQELHTRAENIAEHILN
DRDGAVGLVGEPTAELVSAIQGTWLAGRTLAILPGPIRGADEREWAAATA
QRFAGIGVGQILTYGEHLELLRPNDFGITVHDLAVVGHAQRSTTLASAPA
APGTPAVLQGTAGSTGTPRTALLSPDALKHNVAGMLRHTDVDPGRDRGLT
WLPLYHDMGLTFLLTGFMSGSEMWLAPTASFAASPFRWLTWLSESRAGLT
AAPNFAYSVIGKYARRVPDVDLSDLRFALNGGEPVDCDGFGLFLRELARF
GLDPGVAAPSYGLAESTCAVTSPRPGTGLLVDEITDPDTDTRRRHAVLGE
PIPGMELRIGPSADSRSGSREIGEIEIRGTSMMSGYLGAEPLAPGQWFPT
GDLGYLTDRGLVVCGRVKELITIAGRNIFPTEVERVAAGVRGVREGAVVA
VSTDSGSARQGLVIAAEFRGADESGAKSEVVQRVASQCGVVPSEVVFLKP
GSLPRTSSGKLRRLAVKNDLDGLRAPVS
315445357YP_004078236.1 acyl carrier protein [Mycobacterium gilvum Spyr1]MSTSPAPAAPSPDGIDAALADILRDDLNVDISRVTRDSRLIDDVGLDSVA
FAIGMIAIQDKLGVTLDEEDLLSCDTVGDLETAVLAKVPESR
315445356YP_004078235.1 hypothetical protein Mspyr1_38050 [Mycobacterium gilvum Spyr1]MTDIVTLTAYFAERHRSGDGFLADAILDLCDERQIATSVMLRGIASFGPT
QVIRSDRSLSLSEDPPVTVTAVDTAARIGSLAEQVSALVDRGVLTLERGR
ALPDGGRPDDTVRLSLHLGRRHRICGLPGYVAVCDLLHRHGFVGAQAYLG
VDGTVAGRRCRARFFGRNADVPLTIMGVGTNAQAAAAVDELGNSLPEARF
AVAPVAVCKNDGRDVQGPPAADSAFQALVVHADESSLSDGRPIHRALIER
LKESDHASGATVLRAIWGFRAPGRPHGDRFIQLTRHVPVTTVMIDTASNI
EATYPIVDELTRGEGLVTVSALTGMLEVHSGRRHGALDLGDSNPTQGG
315445355YP_004078234.1 camphor resistance protein CrcB [Mycobacterium gilvum Spyr1]MTDALVWVGVFLVGGLGAVCRLTVDKAVSHRTRGSFPYGTLVVNISGAAL
LGFLAGLTLPAHVALLAGTAFVGSYTTFSTWMLETHRLAEERQIRSALGN
LGLSVVLGLAAAFAGQTVGSML
315445354YP_004078233.1 camphor resistance protein CrcB [Mycobacterium gilvum Spyr1]MTLDRRELAAVFAGGAVGTLARAAFEELAAADPGRWPWPTFTVNIVGAFL
LGVFVTRLLERLPVSSYRRPFLGTGLCGGLTTFSTMQVETIRMLEHGHHW
LALGYVAASIAVGLVAVYLGTVLTRRVRVRS
315445353YP_004078232.1 phosphoglucomutase- alpha-D-glucose phosphate-specific [MycobacteriMAANPRAGQPAQPEDLIDVASVVTAYYTVSPDPDNVDQQVTFGTSGHRGA
SLDAAFNEAHILATTQAIVEYRAAQGITGPLFIGRDTHALSEPAWVSALE
VLAANDVVAHIDSADRFTPTPAVSHAILAYNRGREGNLADGIVVTPSHNP
PRDGGFKYNPPNGGPADTDATGAIAKRANEILRDGLKGVHRVPLARAMRS
VHRHDYLNAYVDDLPNVVDLHAISAEKIRIGADPLGGASVDYWGAIAERH
NLELTVVNPLVDATWRFMTLDTDGKIRMDCSSPNAMASLIANRESFQIAT
GNDADSDRHGIVTPDGGLLNPNHFLAVAIDYLFAHRPEWAAETAVGKTAV
SSSIIDRVVAGLGRTLVEVPVGFKWFVGGLLDGTIGFGGEESAGASFLRR
DGSVWTTDKDGIILALLASEILAVTGSTPSQRYAELAETYGAPTYARIDA
PADREQKARLAKLSPEQVTATELAGEPITAKLTAAPGNGAPLGGLKVTTE
NAWFAARPSGTEDVYKIYAESFRGPEHLAEVQEAARDVVSKVIS
315445352YP_004078231.1 arabinose efflux permease family protein [Mycobacterium gilvum SpyrMSSTKEGDCPTTKQRLPREVWVLVVANVVVALGYGVVAPVLPQYARHFGV
SIAAATFVITAFAVMRLVGAPPAGFLVQRLGERRVYTSGLIIVAVSTGAC
AFAETYWQLLLFRSLGGVGSAMFTVSALGLMIRISPADARGRVAGLFSSG
FMIGSVGGPILGSLTAGFGLAAPFLIYGAALLVAATVVFVSLRNSAVVGQ
ADDEVQVPIPFRTVFRHRAYKAALFSNFATGWASFGLRIALVPLFVVEVL
GEGPGAAGLALTAFAVGNIAVVIPSGHLSDRLGRRKLLIFGLMLAAVSTA
LVGFTTSLPVFLVAAVIAGAATGIFVSPQQAAVADVVGNKSRGGPAVATF
QMMADFGSIGGSLLVGLIAQYTSYGWAFLVSGIILAVAAIGWFFAPETRP
TPSTEHTPGRPLGPEAGGEVP
315445351YP_004078230.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MTPDQTVKLINLLKARRSELHLSVNEVARRADVDPGTAWRIEQGQIGKPR
AESLIAIGSVLGISAMDLFATVGWLTADELPSLGAYLDAKYPNLPEPVSK
HIEHHVEQILHAYSHSTGDRHHTDTPSTCPWCTDHQRHPSHQPKEQPHEP
315445350YP_004078229.1 transposase [Mycobacterium gilvum Spyr1]MSRFQFVADHLHAFEVKWLCAVVEVARSSFYAWLAGADGRAARRAADEAL
AERIRAVHDEDNTYGAPRITAELNDGAPEGQRVNHKRVARVMRGAGIAGY
RRRRRVKTTVADPANQKVPDLLKRDFTAAQVNTRYVGDITYLPLATGANL
YLATVIDCCSRRVAGWAIADHMRTELVIDALKAAAALRGSLAGAIFHADH
GSQYTSRDFANLCRDLGVVQSMGAVGSSADNALAESFNAALKREILQDRA
CWPDAAICRREVFRWLARYNTTRRHSYCRHSSPATYERNLTPATLPEAA
315445349YP_004078228.1 transposase [Mycobacterium gilvum Spyr1]MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCKSAGVP
IRHRRGVVVAEPVPGAESPEQELARLRSEVKALRATAARLSTERDILRSA
AKYFAGETNW
315445348YP_004078227.1 antirestriction protein [Mycobacterium gilvum Spyr1]MNETHHEPTQPEPQPETEHPHEAEPTPSPAIYVASLADYNNGRLHGAWID
AARDPDEIYADIKAMLASSHEPAAEEWAIHDYEQFGRWKVSEYDAVEQVS
RIAKGIAEHGYAYSAWADVLDGGDASFDTDSFREAFLGHYDSVTEYVEQM
ADDLGYEAELDNLPEHLPDFYQEFGGGGRVGL
315445347YP_004078226.1 hypothetical protein Mspyr1_37920 [Mycobacterium gilvum Spyr1]MSTPDEPTKGIKTLGIRLKPDVHAQLSFIAQLRDGTITDEIQIAIAAHIA
AAKDDPELASKAAEARAEIEREAAARQQAIATLFADGGVPTSARPRRSTK
GGDTSPEN
315445346YP_004078225.1 DNA modification methylase [Mycobacterium gilvum Spyr1]MSALNILHRNRIIVGDALKKLSGLPDASVDCVITSPPYFSLRNYGADGQI
GLERHVDQWVDHLAAISGQVARVLVPTGTYWLNLGDTYSAHQAQGAARKS
LLMAPERLALRLQRDGWIIRNKIIWAKPNPMPTSIPDRLNTAHEVIYVMA
RQPQYFFDLDAIRVPHVSVRTTVSGSGSGSGRNHTPLHREPWRGPNSDTV
TGLAALKASGQVGHPLGKNPGDVWTITPGGYRSAHHAIYPLTLAERMIAA
GCPEARCARCRLPWRRKVIRGLGRTATRAALTPTCTCTTGSEAGLVLDPF
MGSGTTAVAAQNYGRDWLGIELNPDFAATARQRIVEERRKPPRAPSPERT
AA
315445345YP_004078224.1 hypothetical protein Mspyr1_37900 [Mycobacterium gilvum Spyr1]MNDASKPTNMSVDGYPLAYPFASNPDVTPPLVDSRNQLTGLGNSGAPQGT
TTPAKRPSCRRISATGIDVIADQLTDRDRAILRSVYDHRFLTVHQIRTLH
FADLAPTSARRTVKRVLARLRGLQVLGALTQRIGGVHGGSYGLIHYVDSA
GDRILRNRSGRQSRRIYEPSARFVAHRLAVADAHVALIDANRESHIGLID
SAVEPATWRTFTGSGAARRTLKPDLFAETATADDLVRAWFIEIDLGTEHI
PTLLTKCREYETYRQTGIEQERHGSFPIVIWSIAHRNPAKAERRRQSLTD
AIAADRTLPSALFRIVAPEELLPLIQNGGQQ
315445344YP_004078223.1 hypothetical protein Mspyr1_37890 [Mycobacterium gilvum Spyr1]MTEPSDATTSAGSLVWQQLFWPQPLSEATALGLLRYFAARTHAPQLILEA
RADDRGVEYLVGCQLRHHAAIRRAVEQLVDGAIVTSFAAADRDHVATARR
IQLSTTSRQLEPADAVASQRSILHALTAVRKGERLTIQLVLGPRHHPKAP
PREPKRDNQIVVSKLLHGIQTDTRPGARQALAHKLGQHAFTAAVRLGVQA
PTAERRRSLLLSLASAIGTAESPDVRITLKNEKPDRMNTPRASWSVFTPS
QRLTVTEIARLSGWPIADKDERFPGQPPLHPRPVRPSSAVHSGSRVVADA
SAPGAGGTIGYDTTDALRHTWVIGPNGVGKSTLLLNLILQDLDADRPIVV
IEPKDLIADLLARIPKKRRDDIVVLDVFDEAPVGINPLDAAHRHGRSPEV
VADSLFGTFKAIWGDSLGPRSSDILRNCLDLLARRDDASLVMLPLLLTNP
GFRRRLTRGVMQNDPFASGPFWQWFDSLSPEATATTIAPLSNKLRPLLSK
PLRDVLAQQHPKFNVRQVLRERKVLLVPLQKGVIGPENAQLLGALVVAEL
WQAIRERAGTPEKTRDPVMVYIDEVQDYLRLPTDLGDALATARSLGAGFH
LAHQYEKQLPSSMLDAFRNNARSRVCFQLQAGDAKEMTAGQSVLTIEDFT
RLPAHHVYASLVRDNAVQPWASGVTKPAPAPSSDPAVIRRSSRERYGRPI
ADIEASFTALIEGAASGDSTDDIGAPRTRRRQP
315445343YP_004078222.1 hypothetical protein Mspyr1_37880 [Mycobacterium gilvum Spyr1]MSKTGRTNHRRGARGTPKPERQIVVRSVRRDPPDLRKLSRAVIAMALRDA
EAEAEAREALKTASTDAESVSGTDTNHLESVDD
315445342YP_004078221.1 hypothetical protein Mspyr1_37870 [Mycobacterium gilvum Spyr1]MNQDPGSWVDRMIGWCFGILLSVIALYCAVSLIESILPTLIVIIGLLALI
GLVVGVVVVINTWRNRW
315445341YP_004078220.1 hypothetical protein Mspyr1_37860 [Mycobacterium gilvum Spyr1]MTILNDLRDRLGDDLLDAADTLSAFIERAAAQTAENVGFGYALVPDAPNT
FPTLTEAYAHSVATGAPLPISSEDSDDVIYTPPSVNAALRFWHDVHHVRR
RLNFGLVDELELSLWHLGELEKAGHQPGSLVWRLLHADLTGQAYVQAFAH
RFPFDQRRFVIGCVTAGFDHGLLAELKRQKGT
315445340YP_004078219.1 hypothetical protein Mspyr1_37850 [Mycobacterium gilvum Spyr1]MTATTPGIVSPLPAGLLDGQRLPPRILDVAAGPVSNPHMVSAGPEPIVLG
DPGSCPPGGSQTFVIIDSSPSVDDSDGNDPLSRRYDETALAIRHVAEACR
CGRDRIALVPFDNGSPGHVAPQPLTPRGVRRLDRGLQRLAATYGMSSQLG
PALDRVDTQTVRRGAQTGVVVFSDFLLTDQNPTNVLSRLRAFPGHVHVVV
LGALPPGVLVADPNVPSPV
315445339YP_004078218.1 hypothetical protein Mspyr1_37840 [Mycobacterium gilvum Spyr1]MPRIPSITRKRRSRARRPAARVGTSHPEGLRLIPVEAATATARPATIDKT
YLELGHDALTLEQQHLFAAEGEVRSRSVSSTAKSLAFAVGETTASVGRAK
SAAEKASVRHEQIRELLSPYVRRKATSSRGYMLRTAALLLGDTAGLAGAA
IALGEYPALAVAQAISAGTATVTAGLAAAQLRHAQQAAERQTEDLPEALT
PYRHLFNGPPKNMRLPGVAFLVAALIVLLVSVGIFALRSAIEGTISGLTF
GGLAAAIALASFINSWYHADAVADVLESAQHDALVADRRHRRLAGSRLIR
KAEQAGAQEKSIVAEHTHRGVAAGAHIEADKYRALLVSPDVIGHGPAPDA
VPAPVTGAQPIKRVRPA
315445338YP_004078217.1 hypothetical protein Mspyr1_37830 [Mycobacterium gilvum Spyr1]MHVHNTICSLATSATAIGLLTGCLTGAPNSLAHAEQIATTCPAGGARIAA
LVQVDRSGSRHSPAAAPAEEQVIRGAAERTVICSGRLRVTLFSGSMFGIT
VFDDDLQLDGATTNARLRKAPKVVDAVMEQIDATLPNAATQLGDGATDIV
GQYQLGAEYAAQLTATGSFHLEQTIITDGIQTAGQDLSDLDLTTEQAQAL
AATFTVPSLNSATVRVIGIGRQADDAPLPTPYVSALRAFHTTVCENTGAA
CTLVTDAAGA
315445337YP_004078216.1 hypothetical protein Mspyr1_37820 [Mycobacterium gilvum Spyr1]MTATDLFFQSESLDVALADYADATLAAARLVGDLLGVTVSSSGSVAATLP
ELRRQIAPRLRHRDTSVGVITTPAFDAEADVFADPQAAAARFALRSAIRL
VHGLGFTPQAEIAIGELAVASLRSAQGDLSHLAFRIAEADHVETVRAALT
LGRPVRVQRNFVVRCAVLGLGEALNAEHDPDVSTSIAVETWLAEQRAARR
QRR
315445336YP_004078215.1 hypothetical protein Mspyr1_37810 [Mycobacterium gilvum Spyr1]MTFNSGEYFLRHATETATAACEEFYEWVSHFSGDFSQDREVEFGTLFDYF
DCWITHKEETLTRAFADGSGNPTWEAFKPLLPFIYIGIIDHLLVNPGRLD
YEHNDPILQTSITICRPMRRVVFLGGKEFEQDMDILLNWVRPPEADETSW
FK
315445335YP_004078214.1 hypothetical protein Mspyr1_37800 [Mycobacterium gilvum Spyr1]MAVQPSAEKVAVDLRALMVRGEGACDEKQLRARSALMSLAARHRERNAAA
RGDDVDILRKLLLDFTALHGNDDDDPTMGKKGMTDANQIAVVSRAIRLYG
GLPQGITARRKAATAGTKVSEGIFKSHGRNPTNTIGHYCMTFAKSFLAYV
DGLTAEPGGHGGPSPLKAAGLDEHASDAWRRLQAMSQRLAAEIDRSAEAD
KQGALRLSQGGYVERDVEDPILQRLRSDGDIDPEIVIGEAGDGKTTLLWS
LHRKLGHDRNPILLSAAWFQPDEYGNQALTADDVVGAVAAIDEVVVLLDT
ADLLLHSVFSTEQTVTLIERLSSLGVAVVVATRPREAMSLPGDLGRRTDL
GAYSEGELAAAVPKLVASYCPDDDAAPSDPSAALKHARARGLVVERVCIS
PLLLRLLFELAGPKFPRLEVDVTGLYRQYWERRVTADLRSHARGTARGKE
ADLSTVAGLVGIAMVAAGRPEIKLEAAVRRCADIASHANLRSTAEEIRRA
IDTLCHRGVLIETAGSIRFLHQTLFEFAAAQGLAQRGSERELPRLLARLE
ESPDDLFLGAVVEQLLIVLADDNLSEEAVAAAVRRLSRTKLPSLVEIAML
VWAHHPALPGVTPQDLETVDAQAVERFIRVVPTVHSSADDIIGHLFWIWN
EREPLRPKVVDACAYLARRSPKPVGDFVAAVDMFGELAVKHRQMVRTNAT
PLLLLEAVLSINPEYLRPAVLRLMKRLASDAGGRTAIATCLRLVAAHWTA
IGTPEFLAQVEDTVETMQKGSNDSDAKVVRDALAEVVAAHWALSIATLPA
QAQPTHWAALVRELCTALEDIRIRTPKMTGSAATDTADGEPEVDTAMRGD
QSPVLGARLIAVARIMAAMSGDDPQIGATFDQLFGLTGPAATRQLTRGSV
AYLLVNTCAATETAMERLSQCLATRLPADYHAFETGPELWATVARSCLMD
SRIPADRVVAVTAEAQQKYPDSTALWTRRDMLLALAPAAIVAGDQDATSV
FSRIRDGAIALPDIERNIFLDNAVDRVTQAPDTLAPLMIDLAHTVNRAST
VRVLSEFESVRPALRDHASRIDGWITELLNGSNDNQGDGARLLLSLVRTG
ILQPDFDELVARYKSLTHPEAKADVVRAIGGVTLKTPRNDDAIAFLRTII
RATRHPTPRVEPTPGRRLANPVIVDAARDALLEAFGFQKEPSPLDWDTVF
TLTFAPRVSGLRAVEMTGAGNLSLYLTHIADAGHIEDASRFLGEVIDSLA
QLPATRQARLGSNRLRVAVGTIVRKAATHDLDALLAKVEVAPPTLSGLLI
RAAVRERYADTHETIDRLAEHPKLGHEINKALNLRIRVAGRQTFAEVLSP
A
315445334YP_004078213.1 hypothetical protein Mspyr1_37790 [Mycobacterium gilvum Spyr1]MADQHSRRLVDEAADLDPEVALAPSAFLTLGHVLTGIGAEQVPPIGLEEI
HLIRHSFKTGDLNGLQGPEDLTEERVREYTRSQGISTRRFPADPARYWVV
LIADGRRRSRLYGTFENFGEVVAERTSTHRFWDLRPCSFLAPLVGRLVVE
CGNPRTWHRRAASAAHLPVLEIADRDKVPFPGFDRVLLTHHELGEMITDH
RYADWRVALSEVQGIYLITDSSNGKQYVGKADGAERILGRWMDYARDGHG
GNLALRELAFASVGDEGAKAKTDHARHFVFSILRVFGPSTSSSEVDAAEA
HYKRALMTREFGLNRN
315445333YP_004078212.1 hypothetical protein Mspyr1_37780 [Mycobacterium gilvum Spyr1]MVAAGDTEAAARAAIGVPSIGDLAGKQALMTTIAAITTNSPPAAGVITPY
NASSGALLVALPALSGLAAGTVLGVQKAPTDSSANTVTLAASIGDTFDAG
SSNLTLRLTSELHILQVVTIDDIKVWKVVGGSIPLSSLDSRYDGKGEIVV
NVKDFGAVGDGTNDDSAAFTAALTAAEDGATVWVPDGNYYLATPVAHTRT
RVNLGGSGTVKGKLIVGAFGAVRDFQGRSITGLKFIQSSASTDPTMACIE
LRNVMNLTITGCSFRDAGAAIYSYTEYDTARNTICNNFYHNVGYFFRSVT
GPTPAGRDSTAQWRSLADIHIEGNNGQSNVTAVDCDSVDGIVITGNTFFS
PGAHHASTVKEHNIKLGVSNQIVISDNNLFEAGLSAIDLTDPRAFTIADN
NITYPGQRTPSDGISITFAAATFAIGSIGGGTIAQATKNVIGFYGTGAIE
LRLITITPFAIERSLGSTPATYYGADVLPTPYRIFIDPNITTPYLPAIPF
GANHGFGINMPDNHRGRIIGQERYLAGNVKEQTLNPRVITITTSNRLYVL
RNIDPTFNGYFGGTITLFMSNSGSTAKTACYHLLVCKTPESNTSYQCVTL
GATGNTTGGAANDPSFTFDIEYASGWHYLRATKVGSTSGAFNYVGWATGV
LHLA
315445332YP_004078211.1 transposase [Mycobacterium gilvum Spyr1]MLTVVHDTDEANANDGGGRSLLDEIVRDGARQMLAAALKAEVAAYIDAHA
GELDESGRRLVVRNGSHAGREVLTAAGAVAVTAPRVNDKRIDADTGERQR
FSSAILPAWARKSPQMTEVLPLLYLHGLSTSDFGPALEQFLGSSAGLSAT
TITRLTSQWQEEAKAFGARDLSGTDFVYLWVDGIHLKVRLEQEKLCLLVM
IGVRSDGRKELVALADGYRESTESWADLLRSCRRRGMIAPVLAVGDGALG
FWKAMREVFPATREQRCWFHKQANVLSCLPKSAQPGAVAAMREIYNAEDL
DHAQVAIKAFEIDYGAKYPKAVAKIVDDADVLLEFYKYPAEHWIHLRTTN
PIESTFATVRLRTKVTKGPGSRAAGIAMAYKLIDAAQARWRAVNAPHLVA
LVRAGAVFHKGKLLERPADITPPEPAESTETEVA
315445331YP_004078210.1 hypothetical protein Mspyr1_37760 [Mycobacterium gilvum Spyr1]MPHVATDKELVKAKRDSWYSVPTHDYVKSGRLHITLATDSGYSGKVTWKD
TAKLQLESRLCDIIPLFEHWAARDAERKEVERQRQIAAREHREREDVIAM
EAYRQQALADRLIADLKAWELAGRLRTYLAAQRTRVDAMTDVDERSAAEE
WLKWCDRYVAERDPTSQPVRQPKVKEPGYTELQEFRKRLGFVTSYW
315445330YP_004078209.1 type I restriction-modification system methyltransferase subunit [MMALKKSDLYTSLWKSCDELRGGMDASQYKDYILTLLFVKYVSDKAKADPN
SLIDVPAGGSFDDMLAAKGDKEIGDRMNKIIAALAEANGLQKVIDLADFN
DEEKLGKGKEMQDRLSALVGIFNTLDFRGSRAEGDDLLGDAYEYLMRHFA
TESGKSKGQFYTPAEVSRILAKVVGISASTKQDQTVYDPTCGSGSLLLKV
AAEAPRGITIYGQEKDNATWALSRMNMILHGNEVADIRKGDTITSPQFTK
NDQLRSFDFAVANPPFSVKSWSNGLDKDYGRFEFGKPPEKNGDYAFLLHV
LKSLKSTGKGAVILPHGVLFRGGAEARIRTELLKRGYIRGIIGLPANLFY
GTGIPACIVVLDKENAAGRTGVFMVDASKGFIKDGNKNRLRSQDIHKVVD
VFNKQTEVDRYSRMVPLTEIADPKNDYNLNIPRYIDSSEPEDIQDLHAHL
HGGIPERDLDALSPFWDAFPQLRAELFTPNRPGYSDLAIDITAVQQAILD
STEFQKFSTDVSTIVGDWFAAHRNELEAITADTKPNDLIAALGDDLLARF
KPVALLDEYSVYEQLMTYWHSVIHDDVFLIMNEGWRDAAKPRKTIEDKDR
KLSEAPDLVVGSGRSAAKYKMDLIPPSVMVAAYFADYQTHIDELTTAAEE
AARAVEEYTEEHAVEDGLLAEAMDDDKISKALITARLKDAKKEGSDPDEV
KALQHLIKLYETEAAEKKAAKDAQAALDLAALTQYGELNEDDVKAIVLDD
KWHATISNRIAGEVNSLTLGLVARIQQLGDRYAETLDELDEELAILDGKV
IGHLADMGIK
315445329YP_004078208.1 restriction endonuclease S subunit [Mycobacterium gilvum Spyr1]MSRLSSSNVGVVRESSRLPANWDEAPLAEIGGFKNGINKGADSFGHGFPF
VNLMDVFGITRIRDTTTLGLISSSEVERRNYNLREGDVLFVRSSVKPSGV
GLATLIARSLPDTVFSGFLLRFRSNDRLANSFKAYLFSDAGFRNRVIGAS
TVSANTNINQRTLGSLSVRFPQSRLEQESIAQALSDADLLIETLERLIAK
KKAIKHGMMQQQFALPSMAGECATLGSVANFMSGGTPDRSNAEHWSGNIP
WISATTLRQVEVSTSEQHVTSRAVRAGSKMAPLGSTLMLVRGSALHSEIR
ASLVIAPVCFNQDVKALVPLPRMVPKFLTYSIHANTDRLLRLVTSAGNTA
GVLDTKVLKAFELWVPRRDVQEHVVSVFDAVTTELALLTAKLEKVRATKQ
GMMQELLTGRTRLPVVEAAS
315445328YP_004078207.1 HsdR family type I site-specific deoxyribonuclease [Mycobacterium gMSNVGQVERKTQDRVAELFRSSLDFEHLGNWECRGGNANVEVELLTQNLR
ARGYDDTLINKAIDKLKSDASLGGGRDLYEANRDVYGLLRYGVKVKAGIG
EHYETVWLIDWATPEANHFAIAEEVTIAGNHTKRPDLVLYVNGIALATIE
LKRSKVGVSEGIRQTIGNQKADFIRPFFTTVQLVIAGNDVEGLRYSVIDT
PEKYWLSWREDSDIQEPLNRALTQLCSKARLLEIVHDFMVFDAGVKKTCR
HNQYFGVKASQARIAKREGGIIWHTQGSGKSLTMVWLAKWIREHQDDARV
LLITDRTELDEQIEGVFGGVDETIYRTTSGADILGTLNKSDPWLLCSLIH
KFRASGDTQNRDEGEGDLVAELTSKIPRGFAAKGNIFVFIDEAHRTQSGK
MHDAMKQLLPGAMFIGFTGTPLLKADKATSIETFGSFIHTYKFDEAVDDG
VVLDLRYEARNIDQDLTSPEKVDQWFEAKTKGMTDLSKAELKKRWGTMQK
VVSAEPRSRQIVNDILLDMDTKPRLMDGRGNAMLVGASIYQACKFYELFC
QAGFKGKCAIVTSYAPQAGDISKEDSGAGATEKLRQYDIYRKMLADHFGE
SEDAAMGKVEQFESDVKHKFVNDPGQMRLLIVVDKLLTGFDAPSATYLYI
DKKMQDHGLFQAICRVNRLDGDDKDYGYIVDYRDLFNSLESAITDYTSGA
LDGYEKQDIDGLLTDRLEGARDDLDEALEKIRALCEPVAPPKDTLQYQQY
FCAAELGSAEQLKANEPKRVELYKSVAALTRTYANLANEMAAAGYSDAEA
AAIKADVAHYVAVRDGVKLGAGEDVDFKQYEAGMRHLLDTYIQASASETV
SNFENTGLIQLIVQMGAGAIDKLPPGIKKSPEAVAETIANNMRKLIIDEH
ATNPKYYDKMSALLDALLEERRKGALEYKDYLQKLLAQAAKLGKADSDTT
YPDWADNGARKALIDFGWPDPSFAIQVDTAVLTSKPHDWLGNPLKEKVVK
RAIRRTLPTDFDRLDELFELVKARNEYQ
315445327YP_004078206.1 metal-dependent hydrolase [Mycobacterium gilvum Spyr1]MSTSNAYLTVSGIDIDVIYKDIKNLHIGVYPPFGRVRVAAPQRLDDDRVR
LAVIQRLPWIKKQRKQLQEVERQSEREMVTGESHYVWGVRHRLKVIERPG
RAHLEVDGERLLLYTPPGASAEKRRTILDQWYRHQLRATIPALFTKWEPI
LDVSVPRWSIRRMKTKWGSCNRETGHIWFNVELAKKHPDCLEYIVVHEMT
HHLERNHGDRFTMLMDGFMPDWRARRDQLNDAPLAQEEWLQ
315445326YP_004078205.1 hypothetical protein Mspyr1_37710 [Mycobacterium gilvum Spyr1]MTDLLQDGSTETAMTLTATHATLVAAGIAALSAVAVAVLSAFIARIYVGR
DRRRQMYGEAFRAALEWQEMVYRVRRRENTKENDRVITDKFHELQERLAF
YEGWIGSESKFMRRSFERLVTAAKEATQDDINAAWAKRGTTGSADANDHR
PVIEQSATDGYLRDVRAHLSLQPWRWMGVAWRNRE
315445325YP_004078204.1 transposase [Mycobacterium gilvum Spyr1]MLTVVHDAIEANESTGGAGRSLLDEIVRDGARQMLAAALKAEVAAYVAQF
ADQLDEKGHRLVVRNGYHQAREVLTAAGAVEVKAPRVNDKRVDPDTGERK
RFSSAILPAWARKSPQMSEVLPLLYLHGLSTSDFTPALEQFLGSGAGLSA
TTITRLTSQWQDEARAFAARDLSGTDYVYLWVDGIHLKVRLDQEKLCLLV
MLGVRADGRKELVAITDGYRESTESWADLLRDCKRRGMTAPVLAVGDGAL
GFWKAVREVFPATKEQRCWFHKQANVLAALPKSAHASALSALKEIYNAED
IDKAQFAVKAFTVDFGAKYPKAVAKITDDLDTLLEFYHYPAEHWIHLRTT
NPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRAVNAPHLV
ALVRAGAVFHKGKLLERPTEITPPTPPSDGDQQAGTEVA
315445324YP_004078203.1 transposase [Mycobacterium gilvum Spyr1]MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCKSAGVP
IRHRRGVVVAEPVPGAESPEQELARLRSEVKALRATEARLSTERDILRSA
AKYFAGETNW
315445323YP_004078202.1 hypothetical protein Mspyr1_37650 [Mycobacterium gilvum Spyr1]MSDGPDNKPEFTDAQKGQIRKAYQGLTAGMQGLDLSSLMPALAQIQRDAM
PKLDVIAKSLVPTQNFGVDFAESLHVNIPKFKLDLPPLQLDYTRLLGPAL
NIENLGLKNLIDTSSIKVFDKIYADQRKQFEGIFENFRQIIDRMLPPNGS
AARIGDI
315445322YP_004078201.1 transposase [Mycobacterium gilvum Spyr1]MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCKSAGVP
IRHRRGVVVAEPVPGAESPEQELARLRSEVKALRATEARLSTERDILRSA
AKYFAGETNW
315445321YP_004078200.1 transposase [Mycobacterium gilvum Spyr1]MSRFQFVADHLHAFEVKWLCAVVEVARSSFYAWLAGADGRAARRAADEAL
AERIRAVHDEDNTYGAPRITAELNDGAPEGQRVNHKRVARVMRGAGIAGY
RRRRRVKTTVADPANQKVPDLLKRDFTAAQVNTRYVGDITYLPLATGANL
YLATVIDCCSRRVAGWAIADHMRTELVIDALKAAAALRGSLAGAIFHADH
GSQYTSRDFANLCRDLGVVQSMGAVGSSADNALAESFNAALKREILQDRA
CWPDAAICRREVFRWLARYNTTRRHSYCRHSSPATYERNLTPATLPEAA
315445320YP_004078199.1 transposase [Mycobacterium gilvum Spyr1]MARPYPREFRDDVVRVARNRDDGVTIEQIATDFGVHPMTLQKWLRQADIE
EGTKPGKSASESGELREARRRIKLLEQENEVLRRAAAYLSQANLPGKGST
RS
315445319YP_004078198.1 transposase [Mycobacterium gilvum Spyr1]MKELAADGIPVAVTCRVLKLSRQPYYRWLADPITEAELIEAYRANALFDA
HADDPEFGYRYLVEEARDAGEPMAERTAWRICSQNRLWSVFGKKRGKNGK
VGPPVHDDLVERDFTAEGPNQLWLSDITEHRTGEGKLYLCAIKDVFSNRI
VGYSIDSRMKSQLAIRALHSAVARRGDVAGCILHSDRGSQFRSRKFVHAL
NHHEMVGSMGRVGAAGDNAAMESFFSLLQKNVLDRRRWDTREQLRIAIVT
WIERTYHRRRRQSGLGRLTPIEFEAIMTTPASQAA
315445318YP_004078197.1 hypothetical protein Mspyr1_37600 [Mycobacterium gilvum Spyr1]MLEDGHPEGAQALAANLLDTMLRETLDGPSRKEVTDQRNRLSIDDLPMRA
AMVFGGIWGSHTEFWPNAGQSVPREFTRHGSAHAVSRKQYSRINALIALM
HVTAYIMLLDSGDLS
315445317YP_004078196.1 transposase [Mycobacterium gilvum Spyr1]MSRFQFVADHLHAFEVKWLCAVVEVARSSFYAWLAGADGRAARRAADEAL
AERIRAVHDEDNTYGAPRITAELNDGAPEGQRVNHKRVARVMRGAGIAGY
RRRRRVKTTVADPANQKVPDLLKRDFTAAQVNTRYVGDITYLPLATGANL
YLATVIDCCSRRVAGWAIADHMRTELVIDALKAAAALRGSLAGAIFHADH
GSQYTSRDFANLCRDLGVVQSMGAVGSSADNALAESFNAALKREILQDRA
CWPDAAICRREVFRWLARYNTTRRHSYCRHSSPATYERNLTPATLPEAA
315445316YP_004078195.1 transposase [Mycobacterium gilvum Spyr1]MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCKSAGVP
IRHRRGVVVAEPVLGAESPEQELARLRSEVKALRATEARLSTERDILRSA
AKYFAGETNW
315445315YP_004078194.1 hypothetical protein Mspyr1_37550 [Mycobacterium gilvum Spyr1]MRRQINLRAALIGIATAVMTVVVLGVLLYTLLENHKKAMADECVHDVTGG
LPGMDLSEDEITSLLIQCLQDPEVASDAMFAKYLDRVVDAAK
315445314YP_004078193.1 hypothetical protein Mspyr1_37540 [Mycobacterium gilvum Spyr1]MSEDQITDVPPNHLSIDPNSPFYSEEALLRDVGIRFNGAEKTNVVEYDVA
EGWVRVEVPTAKDRRGNPMVVKVNGTVEPYFRQSK
315445313YP_004078192.1 hypothetical protein Mspyr1_37530 [Mycobacterium gilvum Spyr1]MMTIAVVLAVSGALIAGAAWGIYGTLPEGLEGFIVALAGGALIFSVVLEL
VEPAVRDLHLLLVALVVLTGAMVFAGLDRLVKAKARNSGGAGLLVAITLD
GVPENLALGVALIGAGPLHVAALSGSIFLSNLPEAAGGAKEMSEGGRSNG
KVFALWGATAVLLSVAALAGNFLLAGAPAALLAAIKCFAGGAVVSSLATE
VFPQAFAKDSYQAGIATALGLVLAVSLDHLA
315445312YP_004078191.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMPLELASFFRTTLPLDLKGLEAADDGRYHSLWMPDHLVSFWPDSIWTPEF
TDLAEVSPSPHRYLDTLALAGAVAVRTTRTRLATSVLDTVRRHPVMLAQS
ALTLSHLSDGRFILGLGAGERENLAPYGFDPRGTVSRFAEALQLIRLLWN
ADGPIDFTGRYFTLEHARLDTEVHRSGPPPIWIGANGPRMLHLVGEYGDG
WWPTGSAGPETYARQLARIREAAERAGRDPQAITPAKMVVCLIGEPDELR
EILQRPLVKSLVLQLTADALAATGHRHPMGEHWRGIQDIDPRVLTRDRLL
RLFEQVDPAAILSVVPHGTPTQVAAQVAEFGEAGARVVSVLDYSGMAGQA
YAAESARKVREVEMQLTGSGA
315445311YP_004078190.1 hypothetical protein Mspyr1_37510 [Mycobacterium gilvum Spyr1]MTILDSDVLIADAKESTGLTDFGDDTLPERVALVVERLNSADLDETGSRA
AALTINGLLTSRLHFMADRTRLPLAAERITAPLFATGEPRSGTTLLHALL
AEDGTSRALRFWEVMYPSPPPGPAAADDPRRAQADADWREILDRIPPWIV
SHPYNDLLGDGLPECERTWAFDFRATNPSAWWRVPVTIQNFAQDHHAQYA
LHHMMLQHIQYARPPKRWVLKGFHGRRLGALFDTYPDARIVWVHRDPVQV
LASQIVAFGQINESLAGALDWTQYAKATIEGSRANFHAYLIDPFVDDPRI
HHVRYRDFVADPVATIGGFYDFAEVPFTAHAEQAMRNYLATNRSDRYGKF
TYSTDVLPVPVQQLHDEFAPYRERFGIDIETRR
315445310YP_004078189.1 hypothetical protein Mspyr1_37500 [Mycobacterium gilvum Spyr1]MAFGDTDDDAQLRAAWHEFCDRLKTAGDLAFKDTSPPNALQRADAFRYLT
QNLGQAYDLALETKNTRYPMIHPFCGPTRKLGGDNADFVYLQAWIDGAST
YRIAGDRGTARFLNFTVQGPRPEKDVYYGADHPNLHEPFGDTPEANITGD
DLVTEPDGSFELYVGGPRRESNWLPTTPGSRKLFMRQGFDSWTERSAQFS
IERIDMDEPRPAPTPQDLIASMRWAGDFLTGVMTDWPDRELQIGSLFGEP
EPNVFPGARFAGTVEQRDARRGRLIVTMPWHLEPDEALIFEFADDGEFWM
LTNMGAFWNSMDYLYRPVSHTPSRSAIDADGRVRMVMSHNDPGVHNWIDT
QHFSEGYLTMRVIGSRQLPEVSTRVVAAAELDTVLPPDTRRVTPEERVMH
LHERFDAIRRRYRI
315445309YP_004078188.1 hypothetical protein Mspyr1_37490 [Mycobacterium gilvum Spyr1]MDPTLQTLAASAFDNVYHVGHVVPELVSAMESLADAMQITWAPPFEMRSG
FVRPDGSADDQIVRLAFSMSGPPYLELIEVVPAADSIFAEPTLGGMHHVG
YYAQRWRDDAARLQDEGWELERTGAGVAFLRDPRSGLRVEVVSVKGRDFL
ARVLSGEMASAYPLSERP
315445308YP_004078187.1 carboxylesterase type B [Mycobacterium gilvum Spyr1]MTTVARTSFGALRGEALDDVVVFRGVPYAASPTGERRWRPAQPVSTWTDV
RDATAFGSIPPQDISPERLAKRGLTMSEDCLTLNVWTPAADDTRRPVLVF
LHGGGQAQGHGSAPLLDGARLARRGGIVVVTMNFRLGVLGSLYAPDWHGA
DSTNLTVRDQQYALQWVRDEIGAFGGDPSAVTVAGQSSGAIAISVMLAGG
CGLFDRAILQSGGLERVRSTEAAVAVAARLRALMRDDEPGVDEILAAQRG
IDPGFVPPQGPFHPCIDGDVIAEHPLVVARTRSMPAIPILAGTTRDEWRI
FDAAFDDGVFTEQYVRDRAQALAGDRHDPDAVVDRYRADHGPLRDVASAM
VTDYHFTAPTEQFVRAHAERGNAVLRYELQWPSPRAGFGACHDSCLALVF
GNLDAAPALAGNDEAARHMSDVVQSLWVDFIRGGEPWVRYDGSGGSTMLL
GRESGVTRDHRSEQLAIWEGRYPAYG
315445307YP_004078186.1 hypothetical protein Mspyr1_37470 [Mycobacterium gilvum Spyr1]MYVRGMSGGDLQTSIAVLRAAFEEVAAADVDLLARPDLVAALDELEELSC
QLPAVGHRLLARLQVETTAREMGAKSWNQVLAVRWRISPGEAHRRLTEAA
LLAPRQSLTGEPLPPALPATAVAQSRGLINGEHVEVIRRAVKKLPGWVDV
ATREQFEVNLVRTAVGNGPKELRDAAELTLFLLDQDGPEPDDTERARKRG
LTKGKQRPDGMIDLVGTLTPEAWAVLEVIFAKYAAPGMCNPADPEPCTSG
TPTQAQIDNDQRSLAQRQHDALLAVGRIALMSGELGQLNGLPVSIIIRTT
LQDLESRAGVGTTGGGTVVPIKDVIRMAGHANHYLAVFDRATGSALDLFR
TRRVASPAQRVMLIARDGGCTKPCCTVGAYGCQVHHAETDYAHGGNTNID
ELGLACGPDNRSVTDGGWTTRMNERCEVEWIPPPGLDTEQARVNTYHRPE
RLLAPPEDPEPPNQTRTTATEPVEDQAIGDPETDAPPPLDDPGEPGGPAP
PDNRAA
315445306YP_004078185.1 transposase family protein [Mycobacterium gilvum Spyr1]MRVSTAFNRLLAIPGASVTDVVIGERDVEVTLRPTARLLTCPCGKRQPSV
YDRRRRRWRHLDLGVKRLWLVNEIRRLNCPDCGVITEAVPWARPGSRFTR
DFEDMVLWLAQRSDRTTVSTLMRCAWESVTAIINRGVAELLDKRRLQTLY
RIGVDEICYRHPHRYLTIIGDHDTGTVVNIRPGRSEQSLTDFYTAQPDSM
LKQIQAVSMDVSKPYIGATRSKVPEAIICFDGFHIMRWINRALDAVFSEA
AAGPDKVHMSSAQWRTTRWALRTGENRLTDTKRELVNQIAKQNRRVGRAW
ALKEQARDLYRYDHQPGVARALLKAWITAAKRCRIPAFVALGKRLAVYFD
GILAAIELGISNALAESINAKIRLINARGYGHHTAETLTSMIYLCLGGLQ
VKLPTRT
315445305YP_004078184.1 hypothetical protein Mspyr1_37450 [Mycobacterium gilvum Spyr1]MNREVCKFLSGAFGALAYVHAAYAVATSRGIINEPVFLGRTWGVGYMWTE
AAVYSALGVALGYAGWNRRPAIPQT
315445304YP_004078183.1 coenzyme F390 synthetase [Mycobacterium gilvum Spyr1]MSRLEYTRAIIDAYRASREGAAGIDRRQQQRLREIVAYARAHSPHYRRLY
HDAPESISRIDQLPPVTKAELMSHFDDWVTDPAVAKERVEEFLADPGNIG
RDFLGRYVVCTTSGATGEPAILLHDAVALRVYNVLGYARSVPVALLSPRT
VWALLRGRARMAAVFVTGGHFLANTMMARRIRKLPWRRRMQRIFSAMTPL
AELIADLNAFQPVVLGGYPSALVTLARAQQDGRLCIHPVMISAAGESLPS
VTRRLIGAAFGCRVGNYYGSSEAVGLTFECREDRLHVNSDWYIVEPVDEH
NRTVPAGQLSEGVLVTNLANRIQPIIRYQLGDRVTVDPEPCPCGSPFPTI
DVVGRTDDTLTFTTPDGGQVEILPLAVATVAEETAGVVGCQLIQRAPTAL
SVRLRVEPPEEQDAVWPVLKDRLAAFLSEHGATAVTIDKDDEPPALNPRS
GKYRQVYVDIAETA
315445303YP_004078182.1 dipeptidyl aminopeptidase/acylaminoacyl peptidase [Mycobacterium giMAFPDLIPVEDFFNPPTRAAAKISPDGTRMAFLAPSNNRLNVWVENLDSE
SGGLRRVTDDDNRSVLHFEWTDDPRWLIYLQDTNGDENWHVHRVDLDDPE
APAVDLTPFPGAMALPVREVKNGRTTVMVNNRDATLLDIHELDIATGDLT
LIAKNPGHVNGWLSSDDGDLFATALTADGDLELSRWDRDDEALRPIIRFD
GTDYPIGIHPLVLTPDGTGVWLGSNRGTDRTRLVHVDLATGEETDVDSHP
TFDVDPRAAVSPLLPAPLIQDRRTGELLGVRYYGERQTIRALDTRFGDIL
ANLEKLSDGDLGNLSSDENGVRWIVGFNHDRDPGATYLYDHSTGESRLLF
RPLPQLDPSQLAPMRPVTITARDGLPLQSYLTLPVGVEAMSLPLVLVVHG
GPWFRDSWGFDGHVQLLANRGYAVLQVNFRGSTGFGKAFLKAAIGEFAGK
MHDDLIDGVKWTVEQGYADPDRVAILGGSYGGYAALVGVTFTPDVFAAAV
DYVGISNLANFMRTLPPIARPQLANNWHAYVGDPDDPEQLADMMARSPIT
KVDQIRTPLFVIQGANDVRVVQAESDNLVNALRDRGVEVDYLIQTDEGHG
AVNAENTIEMWEAVVRFFARHLGGRA
315445302YP_004078181.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSRIACDLFWERGVAATTGDDIAAEAGLSTRTIWRYFRCKESCVEPVLAL
SAKRFIGLAERWPAELSLAEHMAADMIENPLSEREIADEVAALRIATMSA
TEPALRTSYLMVHDEMERAFVPVIARRLGLPDDDLTARLCAAAVTAAFRV
VDEDVGRRAIVDKEKVTQEEALALIDRAIRDATNGRLGGPVTVK
315445301YP_004078180.1 hypothetical protein Mspyr1_37410 [Mycobacterium gilvum Spyr1]MTSTTATKPGVAPGLLLGLGLGGFIDGIVLHEILQWHHMVSHVEDYPVDT
LAGLEVNVLADGFFHVATWLLVWAGTIALLMSWRRGRLAPTWSFHFGLLL
AGWGIFNVVEGLIDHQILQIHHVRDDLGGPMSWDIGFLAFGALLVLGGWL
IYRRGARRMGDQAGADIR
315445300YP_004078179.1 hypothetical protein Mspyr1_37400 [Mycobacterium gilvum Spyr1]MTVDTLAAAPSTESPTAETVAKPPTKRAGRKAKTIELTLTVTGTADGEWH
AELKQGSTYVVRNLPVAAAAVSRAAGELHEDLATPIDAVIEQARSQQAAR
VAALEAELDAARRALANLD
315445299YP_004078178.1 transposase- IS4 family [Mycobacterium gilvum Spyr1]MQGRSDDQREFLDAESVAGHLLKSDSVFAFLAAYRRQLFPEEMFADLFPS
RRGRPSVPAEVMASVITLQALHGLSDNETVDAVTFDLRWKAACGLPITAG
AFHSTTLTYWRRRLAASDRPNRIFEAVKTVVAATGALTGKTRRALDSTIL
DDAVATQDTVTQLIGAIRRVRREVPGAGEVVASQCSAHDYDDPGKPAITW
DDAAAREMLVNALVTDAHRLLGHLPDQELGVRAAEAVALLALIAGQDVEP
VDDSDGTDGRWRIAQRVAQDRVISTVDPDARHAHKSVHRRQDGFKAHIAV
EPDTGLITDCALTKAGGAGTHDAAVAPQLLAGESAPVTVLADSAYGSGDF
RAQLRKSRHRDRVKPAPLRAAVPGGFTIDDFTVDHRGHRVTCPAGVARSI
SARGNATFGAACRGCALRPQCTTSIDGRSLKIGPHDALQRAARKRSQKPR
WLNEYRQHRPMVERTIAWLTRGNRKVRYRGVTRNDQWLHHRAAAVNLHRL
ITLGLTHTGAGWAIA
315445298YP_004078177.1 Crp/Fnr family transcriptional regulator [Mycobacterium gilvum SpyrMDEVLARAAIFQDVDPGAVAALCSQLQNVSFPRGHRVFNEGDLGDTLYII
TSGRAKIGCTSPDGRESLLTLMGPSDMFGELAIFDPGPRTSSVTALTALH
AVMMDRDALRFWIAERPEIAEQLLRVLARPLRRTNDALSDLIFTDVPGRV
AKQLLDLARRFGVQQEGSLRVDHGLTQEEIAQLAGSSRETINKALADFVQ
RGWIEQRGRTTIIHDPARLARRAQQ
315445297YP_004078176.1 hypothetical protein Mspyr1_37360 [Mycobacterium gilvum Spyr1]MSQDDLREALRRAASALKADGPPFALAGSYALWVHGAPEPVHDVDFVVAE
HDAEAAAATLSKAGFDIRRPPEEWLFKAAFSVDGPVLIDVLHQINRVPVD
AELIERAEVTDVLALAIPVLAPTEVLTQKLRALHEHHCDFEKLFGPVRAV
REQLDWAQLRRATAENPFAVAFLSLCDSLGIAEHH
315445296YP_004078175.1 metal-dependent hydrolase [Mycobacterium gilvum Spyr1]MKLVTFNILHGRTPGAEVDLDRFVDCVAGLDADILALQEVDSIQARSGLA
DLTALAAEAMGARSHRFVAAIAGTPGATWMAATGEEQPGTAAYGVALLSR
YPAVSWQVARLPRIPFPFPLYLREPRKVVVVHEEPRAAVIGRFDTPLGEL
TVANTHLSFVPGWNRYQLHHLMRDVRGLPSPWIVTGDLNMPAKPARRWSR
LHCLASAPTFPADRPTRQLDHVLTDEPAFTIRSYDTPEMAISDHRPLVVD
LERIGHENDSAAR
315445295YP_004078174.1 hypothetical protein Mspyr1_37340 [Mycobacterium gilvum Spyr1]MTDTTEGTVHLDDLAEPRYSPEAQQLRELMASLAADCPLDAEVLHTRARE
ATGLDDFGPDDYRERLEMYLAELREIDMHAPGVVNFHVQLVQWLKNRLLL
TDLLTRHPEIEEIELLPPVVIAGLPRSGTTHLHNLLAAAPTFRSLPYWES
VEPFPLPAEHGVEPDPRIGRMDLAVQTMDLLMPHFALMHEMTTDHAHEEI
QLLANDFSTMLMETLAHVPRWTEYYWNRDQTPTYEYLVTQLKALQFLRGG
GRWVLKSPQHLAQLPVIDRVLPGVRVVFTHRDPGPVALSMIAMVTYSARM
HRDHVDVPTVAAAWVDRLEKLLAACVRDREVIAPDRSLDVRFDDFMADEL
GVAESIYALTGEDFDGRSRAAVAQYLQSHRRGRHGRVHTSADMFGLDPDE
LRERFAPYSARFLR
315445294YP_004078173.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MTTDIGRPRNRAIADAVLRATVELLAESSYAELSLDAVAARAGTSKPAIY
RRWRGKAHLVHEAVFPLGADTAIPGSGSLEADVREMTRRTLAVLSTPAAL
AALPGLVGEMASDPTLHTALLERFGDILVRGLTEFLESAVRRGDVRPDVT
ASELAEAVAGMTLLALLTRGTAVDEVWLDRTARLITKGISA
315445293YP_004078172.1 hypothetical protein Mspyr1_37320 [Mycobacterium gilvum Spyr1]MTTESHEATAAWRELLDTLRTLDASFMSGPKAVGDDRHVADGYRMLATTL
GVAFDTYLFADPSRPHWVELNSPFRPDRRWGGDNTDAIYFMCPVDPHRRY
RISGNRGDSVYFSMTAYNEPAPGAWSDKIVAIVRDDDLDIDAEGNFSFEF
GPQPGAAVLMTRDYQADPLVGRAATWTIEALEPPDPFRHGEAETAAALRA
SAAWMRTMFAILPLSVGVKNADAHELGHETALVANDFADPYQVPDANFGW
SARDACYSYGSFDLAEDEALVITHRPPACRFWNLVVWNQFMAVPGVEDAR
SSVNGYTAAPNGDGSVTVVLSRGMTAHPNSLTTLDYSRGNLAFRWFLVDE
VPARPEVRLVKVSDAPTVVT
315445292YP_004078171.1 universal stress protein UspA-like protein [Mycobacterium gilvum SpMSTQPAPLGIVVGVDGSAASRVAVDWAARDAALRQVPLTLAYVLPGAAVQ
SWIQVPLPASFYEDEKAEATRVLADARAVVDAATQAHPLPAVTEKVLSGQ
PVPTLADLSRDADMIVVGSRGMGKWERRVLGSVSSGLVHHARCPVAVIYD
EDPLIPHPAQAPVVVGIDGSPASERATAIAFDEACRRGVDLVAVHTWSDA
GYELPGVEWTEVQPEEEMLLSERLAGWHERYPDVTVHRVVRRDQPARRLL
EEAEKAQLLVVGSHGRGGFTGMLLGSVGSQIVQSSRTPVIVARTA
315445291YP_004078170.1 hypothetical protein Mspyr1_37300 [Mycobacterium gilvum Spyr1]MKASGAGVAALALAATVIGYRTRLRPWIYRWGATYEESVAGLPGDELVAG
GARTTRAITIDAPPTQVWPWLAQIGEDRGGFYSYSVLERAVGADIRNASR
IHREWQDLAVGDTVWLARRGGDRGRQIVAALMPNSHLVLMSPADYERVQR
GEKASGSWSFHLKAQGGRTRLLARGNGGYGGNVLYDVVHFIMERRMLLGV
RDRAEVRESSVGRSA
315445290YP_004078169.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MDFTLNDEQELLRGGLTRFLATRYDLEKSRTAAKTGAGWQPEIWRAFAEE
LGILGAALPEENGGIGGGPVEMMLIAEALGHALVIEPYVDTAVVAAGLLR
RAGGEIADALLEEIVAGSAIVSLAATEPTSGDFWQDVRTTAVRDGDEWVL
SGEKIVSSATPLAGHVLVTARTTGERADTAGISLFLLDIASAPSGVEVHH
YRTVDDRRASDIVLDGVRLPATALLGAEGDAWPSLAQARDEGAAAISAEA
VGCMRKVLADTVEYCKQRQQFGQPIGSFQVLQHRMVDMYMEVEQAAAAAL
LATLKLDEDETTRARAVSAAKATVGRAAQFVGQQAVQLHGGMGMTEELAI
GHYFKRLTALQFEFGSTDHHITRYGRLTTP
315445289YP_004078168.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MDLGWSATDLEFRDEVRAFLEEKLTPELRQAGRLMTSVYADHDASMAWQA
ILHERGWAAPAWPVAHGGCDWSLTQHYIFSRESTLAGAPSLSPMGIRMVA
HAIIKFGTDEQKEFFLPRILTGEVFFCQGYSEPEAGSDLAALSMAARDDG
DHLVCTGSKIWTTHAQEANWMFALVRTTRTDKKQRGITFVLIDMATPGIE
IRPLVMTSGEEVQNQVFFDEVRVPKSNVIGQIDDGWTVAKYLLEFERGGG
AVAPGLQVMAENIATVAADQPGPGGGRLLDDPAFARKLADVRIRTEVLEI
LEYQVLAVVAGGGNPGAKSSMLKVLGTELSQAITELAMEAAGPRGRVYQP
HATYPGGPIAEFEPPEGDYVSGEPWQAVAPLRYFNDRAGSIYAGSNEIQR
NILAKAALGL
315445288YP_004078167.1 hypothetical protein Mspyr1_37270 [Mycobacterium gilvum Spyr1]MNDPEWDDEVDVVCTDTGLAAMATAISATEEDGEVFLADPSRAPRHGWFG
LVRPDGEVDREDDETAAYLAELTADLDLTSLSRQDAALPVRRAGAVVPVR
RRPIPAFEGRRLRDWAARCIPSPTGYLYTQVTDWTSTTMDCGDGELFKVL
DIGAVDVGDDPIGAVTDWLAGEAQDRGLHGVEVTRFEHLVFDEGVVAGAV
FSTPDGPLAVRARHGVLMGPGTAVTAEASADSAAAGHGVRVALVGKEASR
FGRVELLTADAASDPEA
315445287YP_004078166.1 diguanylate cyclase domain-containing protein [Mycobacterium gilvumMSESLDLVVTSVATRLMGAGAATWAEASQQVLADLVEHFGVDVSFLRRND
HTIRASVLVAEWPVRPGIPDPDPLAVVYFADADPVFALAEFQKEPLVFRP
DANTDEYQKTIEEGRQVPQVSMAAVPLLSGDVTTGVLGFVKFGDRDWTGV
ELNALKAIASLFAQVQARVEAETQLRYLAEHDDLTGLNNRRALLSHLDGR
LAEGQPGPVSALFFDLDRLKAINDYLGHTAGDWFIRVLAERLREGADPRA
LIARLGGDEFVVVPAGPMDGEAAELLAHHLQSTLKERVSIDGEMLTRTVS
IGVAVGIPGQDTTSDLLRRADQAVLTAKNSGGNRVTVFTEEMSLKQEFNN
DIELHLQSVIENGALLLHYLPEIDMRTGDILAMEALVRWQHPTRGLLSPE
SFIGVAESINLAGELGRWVMRSACTDFARWRALGIGKDAIMRINVSPVQL
VTDGFVESVAGIVDEFGLEHGSVCLEITESVVVQDIETTRVTLNGLKKAG
VLVAIDDFGTGYSALSHLKSLPVDTLKIDKSFVRELGSDPGDLAIVRAII
ALAEAFGLELVAEGVETDVGALTLLRHGCHRAQGFLLSRPIPTDAMETLL
AQGRIPVSFSKG
315445286YP_004078165.1 dinucleotide-utilizing protein [Mycobacterium gilvum Spyr1]MTHADTDRTGHRAVVLDESEPAHVQTLARLRADSGIEFLDPLPAGGGTPT
RWVYYAWRRAVVRVPEPGLFRRERLDRNRNLVTLDEIATLGTLRIGVVGM
SVGHAIAHTLAAEGLCGALRLADFDELELSNLNRVPATVFDLGVNKAVAC
ARRIAELDPYLPVEVVTGGVTADTVDAFLDGVDIVVEECDSLDIKVLVRH
AARTQKVPVLMATSSGGLLDVERFDLEPDRPVFHGLLGDVDAAVLARLSS
KDKVPHVLRVIDATALRPRMQASLIEVGTSLTTWPQLSSEVAIGAATVAE
AVRRIGLGEDLGSGRVRVDVPALLDDVHDPSPPPGDRGDATLSATAADDT
AARALGTAGTDAMTAIAAAAVRAPSGGNTQPWQVEVGDTTLTIRLDTDLT
STMDVGYRASAVAVGAATFNARVAASAHGLRADVTFETFEQGPQGPPLTA
TVRTAPGQEPELARLYDGMLRRETNRHTGERAEIDDETIDALTRVAESEG
ARLHLVTGTEDIRKIASVLGDADRIRYLTPALHAEMIRELRWPGDPDPHT
GIDIATLELDPADTVFLDILRSGPVMAHLAAWGAGSALGDTTRGAVASAS
AVAAVTVRGDTLADYARGGAAMEAVWVRAQEHGLAVQPISPAFLYARDRR
ELDALSPAFTQRLADLQYSLQASIGVDSDESLILILRVFRGPRPSAPSRR
RKIPGRSTPT
315445285YP_004078164.1 hypothetical protein Mspyr1_37240 [Mycobacterium gilvum Spyr1]MTTPEFHSAAFDRASLTESPSYWDPATQCTVVYATPARERELWRDYARGA
CASYEKHGVAAALDLDALRTGHDTVLFAALVNSAGAVVGGLRARGPYRSA
DECHAVNEWDGQDGQAAVHKMVTDRIPFGVAEMKTAWVTDDPDENRRLTT
AIARTPLHAMTLLDIQFIVATAASYVLKRWLSSGGLLATKIPATPYPDHR
YDTKLAWWDRTTFTKHAEPSQVSAFFSEQRQLAETVPHLMGAPVTAPAL
315445284YP_004078163.1 acyl dehydratase [Mycobacterium gilvum Spyr1]MKRFDNLAELVAAQGTQLGPTEWLEITQERVNLFADATDDHQWIHVDPAR
AADGPFGGTIAHGLLTLSLLPRFTHQLYTVDNVAMAINYGYNKVRFITPV
RVGAKLRARAEISAVAQLENAVQATLSTTVEIEDSEKPAAVAESIVRFIG
315445283YP_004078162.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MLQTPPYVAVIGAGISGLTAGKMLKDYGIDYTTFESSDRIGGNWAFGNPN
GHSSAYRSLHIDTSKDRLSFKDFPMPEHYPSFPHHAQIKAYLDDYADTFG
LLDHIEFENGVVHAGRTDDGGWIIRDQGGADRHFDLLVVANGHHWDPRLP
EFPGSFDGESIHSHAYIDPATPLELTGKRILVVGIGNSAADITVELSSKA
LRNQVTLSTRSSAWIVPKYIAGRPGDTLFRTSPHLPLSWQRKAVQLIAPM
LGTDPTMYGLPPADHKLFEAHPTQSVELPLRLGSGDVTPKPNVARLDGST
VHFVDGTHSDFDVIIYATGYNITFPFFDPDFVSAPDNAIRLYKRMFIPGI
ENLVFMGFAQAVPTLFPFVESQSRLLAAYAVGRYALPPVDEMERTIDADQ
QLHAGHCTDRPRHTQQVDYFVYEHDLRTRELPAGLKRAQRAVAVAR
315445282YP_004078161.1 lysophospholipase [Mycobacterium gilvum Spyr1]MSRTEVAFPSGGDTCSAWHFAADGVRRPVVVMAHGFGGTKDSGLEPFALR
FAEAGFDVFAFDYRGFGASEGTPRQSLSVRRQIDDYHAAIHAARQLDGVD
PDRVALWGASFSGGHVVRVAAERADVAAVIALTPLTSGVAVSRSAMASRD
TVTSLKWTLTGLKSRIAVGRGGSPTLMPLVSPVGQPGALALEGAYESYTA
LAGPTWRNEIDSSIGLQVVGVRTTAAAKKLRCPLLVQIADFDQYVPADAV
AKTAAHGRAQVHHYACDHFDVWPGNDWFDKTVTDQIAFLRRTLTRQ
315445281YP_004078160.1 hypothetical protein Mspyr1_37200 [Mycobacterium gilvum Spyr1]MRLEGRVAFITGAARGQGRAHAVRMAKEGADIIAVDIAGPLPPCVPYDHA
TADDLAETVELVKATGRRIIASAVDTRDGDALTAAVDSGVAELGRLDIIV
ANAGVTAPQAWDDISAEDFRDVIDVNVTGTWNTVMAGAHKIVDGGRGGSI
ILISSAAGIKLQPFMIHYTASKHAVTGMARAFAAELGKHSIRVNSVHPGP
VVTDMGTGDMVTALGKAMETNPQLSNMMTPFLPTWAVEPEDIADAVCWLA
SDESKFVTASAISVDQGSTHY
315445280YP_004078159.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MASPPANAAEAGIPSAEVNDEDFQAILAATREFVRTAVVPREQEILSTDQ
VPDDLREQTKSMGLFGYAIPQEWGGLGLNLAQDVELAMELGYTSLALRSM
FGTNNGIAGQVLVGYGTDEQKKTWLERIASGEIVASFALTEPGAGSNPSG
LRTKAVRDGDGPHSGWILNGQKRFITNAPNADLFVTFARSRPADDKGAGI
AVFLVPADTPGVDIGAKDKKMGQEGAWTADVNFTDVEVPDTALVGGSEDL
GYRAAMTSLARGRVHIAALAVGAAQRALDESVAYAATATQGGTPIGDFQL
VQAMLADQQTGVMAGRALVRDAARLWVTGQDRRIAPSAAKLFCTEMAGKV
ADLAVQIHGGSGYMREVPVERIYRDVRLLRLYEGTSEIQKLIIGGGLVKG
AKGK
315445279YP_004078158.1 hypothetical protein Mspyr1_37180 [Mycobacterium gilvum Spyr1]MGQVSLLTGQTAVITGGAQGLGFAIAQRFVDEGARVVLGDVNLEATQEAA
EKLGGADVAHAVRCDVTSSAEVDALVAAAVDTFGALDIMVNNAGITRDAT
MRKMTEDDFDKVIAVHLKGTWNGLRAAAAIMRENKRGVIVNMSSISGKVG
MIGQTNYSAAKAGIVGMTKAVSKELAYLGVRVNAIQPGLIRSAMTEAMPQ
RIWDSKVAEVPLGRAGEPDEVAKVALFLASDLSSYMTGTVLEVTGGRHL
315445278YP_004078157.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum Spyr1]MTREAVICEPVRTPIGRYNGMFKSLTAVELGVVALKGLLERTQVAPEAIE
DVIVGHCYPSMEAPAIGRVIALDAGLPVTVPGMQLDRRCGSGLQAVIQAA
MQVASGTNDLVVAGGAESMSNVVFHSTDMRWGGARTGITVHDALARGRTT
AGGKHYPVPGGMLETAENLRREYGISREEQDELAVRSHSKAVRAQQDGLL
AETIIPVTVSGRSGDAVIDVDEHPRADTSPESLAKLKPVLAASDPEATVT
AGNSSGQNDAASMCLVTTPEKAAELGLVPLVGIVSWGVAGVAPKIMGIGP
VPATEVALRRAGLQLPDIDLIELNEAFAAQALACLREWKFTETDLERTNV
HGSGISLGHPVGATGGRMLATLARELVRRDGRFGLETMCIGGGQGLAAVF
ERVEG
315445277YP_004078156.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MSRLAQTLGLTEFQTEIVSTVRQFVDKEVIPTAQELEHADTYPQAIVDAM
REMGLFGLMIPEEYGGLGESLLTYALCVEELARGWMSVSGVINTHFIVAY
MIRQHGTDAQKSHYLPRMATGETRGAFSMSEPELGSDVAAIRTRAKNNGD
GTYTIDGQKMWLTNGGSSTLVATLVRTDEGADKPHRNLTAFLIEKPTGFG
EVAPGLTIPGKLDKLGYKGIDTTELIFDGYRADAGDILGEAPGQGFFQMM
DGVEVGRVNVSARACGVGIRAFELAVKYAQQRSTFGKPIAEHQAIAFQLA
EMATKVEAAHLMMVNAARHKDSGERNDVAAGMAKYFASEVCAEVTQQSFR
IHGGYGYSKEYEIERLMRDAPFLLIGEGTSEIQKNIISKRLLADYRV
315445276YP_004078155.1 GntR family transcriptional regulator [Mycobacterium gilvum Spyr1]MTTPEFAARPQLAEDVARFVRRRIFDGTYPAGRYIRLEQLAAELGISVTP
VREALFGLRAEGLLTQQPRRGFVVSPITERDIADVSDVQAHIGGVLASRA
AELITDEQLAELERIQDELEAAYDAVDHEAAVRLNHAFHRGVNIAAGSPK
LAQLMGQITRFALESVYPTVEGWPAHSMNDHRVLLAALRKRDGTAARDAM
SEHLCAAAGPLIDHLTTRGVIG
315445275YP_004078154.1 acyl-CoA transferase/carnitine dehydratase [Mycobacterium gilvum SpMTGVLDGIRVLDYGRFIAAPWCSALLADMGADVIRVEKREGGEDRWVQSI
ADSGEGGTFLQCNRNKRSLTLDTTTAEGREVTRKLVAGADIVVANMPAVG
MRTSGLDYDTLRTIKPDIILASATAYGEGGPYSDRIGFDGAGQVMSGAVY
RQGLPDQPIRTVVPYADFGTALTLTIGVMMALYHRDRTGEGQHVEGALLP
TAMMLSNAFLIERDLLGTDKPRMGNQGTSVAPCDLYRTSDDGWVLLQIAG
PSMFRRWCRLVGRPELFDDPRFADDDLRWQHGEELNGIMAQWCADKTKAE
VLELLEAAKLPAAPMHSTQEVLEDPHVQAMGYLKRVPFPGTPKDVPLIET
PFRLSATPGEIRRRAPLLGEHTDEILEEIGYSSEAVVGLRDRGVV
315445274YP_004078153.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MTDTVDALLRAQAERHPDTEAVVDPAERITRRELDAATRELGAAFVASGI
AKGTRVGLLMPNGVEWARTALALMRIGAVLVPLSTLLTPPELSAQLRTAS
VQHLIAVEEFRGHRYLDRLDADLPALSTVWTTDQITGLRPGPGTAAVSDA
MSRGVRAADPMAILFTSGSSGPPKGVIHSHGNAIGAVRSGLDARCIDDRT
RLYLPMPFFWVGGFGGGLLSALVAGAILVTEAVRQPDSTLRLLTAERVTL
FRGWPDQAEALARHLPASGVELNLRPGSLEALLPPNLRARPGARANLFGM
TESFGPYCGHPADTDMPETAWGSCGTPFDGMQVRITDPGTGEELPAGATG
MIQIRGPHLMRGICRRTREDVFTPDGFYPTGDLGHLDSDGFLFYHGRCDD
MFKVRGATVYPAEVEQALRTVDGVRAASVTNLPGPEGNRVGAAVVCDASL
TVDVLRRAAREVLSSFKVPSVWALLPDEAAIPRGATGKVDTARLRELLQD
315445273YP_004078152.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MSDPGTVAEVLRAQRRHGDKPLLTCDDERLSYAEADARSAVLAARLTTLG
VGKGSHVGILYPNGAQWVVAMLAAARIGAVVVPFSTFSTAVELRRQLRDS
DVGVLLAAREFRTHDYVRALGEAVGVPLDDGPLLSAEVPVLRHVVFDAEC
GGVADVSALEGDVDGSDVLAIIYTSGSTSDPKGVVHTHTSLLAHQRGLNE
IRGLTAEDRLFCNSPFFWIGGFAFGLLATLVAGSTLICSTASDAGRTLDL
LEAEKPTVTNGFVAGITHLTRHPSFARRDLSSMRRGNLYPIMAPDVRPAD
PELRHNMLGMTEAGSVVLLSGDESDQPEARRGSYGFLAPGFDARVVDPDT
GSDTDGAVGELVLRGPHLMQRYYGRSREECFDADGWFHTGDLVRRDDDGV
FYFVGRAGSMIKTAGANVAPAEVEKALSAALQAVDAGVAVHVVGLPDPER
GQIVAAVIATDNGTVFDEPAVKEALSTQVSAYKIPRRVLSLRHTEIPTMS
SGKIDLPALRRLFDD
315445272YP_004078151.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MHPLSRRIAEVMALDASAPAIQFERRWVTWGQIAESARHVSTVVGSGTAG
IMLRNTPSHVAALLGVLSGGGTVVVINPSRGDERTRADIEALQLPTLIGL
AEDLESLAPGTTATTMALGDIDTTPEITGSSPSEGQHRPGVAVRMLTSGT
TGPPKRVDLTYDMLARSVMGRDPDTAPSPTELRHGVAIVNSPLVHVGGVF
RILLCLAEARPFVLLPKFELHSWAEAVREHRPAAVSLVPAALRMVLHSDL
TRDDLAGVRVVTSGTAPLSADDAEAFTAKFGIPVLTSYAATEFGGGVAGW
TLADHRKYWQDKRGSVGRANPGARLRVVDDNRDPVPPGEPGLLEVIPAQL
ADTGEWMQTTDVARIDEDGFLWILGRADQAIIRGGFKVMPDDVRSALESH
AAVAGAAVVGRPDPRLGETPVALVELRPGATASPEELSAYLQTRLARYEI
PTALILTDAIPRTPSGKPDLTAVRARLAQP
315445271YP_004078150.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MTFETIDLGLDHDVRVATITLNRPEALNSFNRAMCREMRDAWHLVKSDES
INAVVLRAAGDRAFSAGLDVKSSYGQPDIVWNHEDPGELLSPKWQKMWKP
VVCAVQGMCTAGALYFVNEADVVICSDGATFFDSHVSAGLVSALEPIGLM
RRVGLGDTLRMALMGNDERVGAQTALRIGLVTEVVPEDELWSRAHEIATA
IAAKPPTATQGTVKAIWESLDKPYRAAMDQGLIYTRLGNPIAKAELAERP
IPKTAPRIR
315445270YP_004078149.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MSSSPSYDTITYDVDGHKATITLNRPEALNALSPHMVSELRAAYDEAEND
DDVWLMIVTGNGRAFCTGADVKEIPEDGRVIYERPYLSTYDQWEAPQEGT
PPFRRMAKPVLAAINGICCGAGLDWVTTGDIVIASDKATFFDPHVSIGLV
AAREMVRLARALPRSVALRMALMGKHERMTAERAYELGMITEVVPHDTLL
ERAHEIADIVNSNAPLAVRGTRLAIHKTLDLPLLEGEILAETFRERVVRT
EDAQEGPLAFVEKRAPNWQCR
315445269YP_004078148.1 enoyl-CoA hydratase [Mycobacterium gilvum Spyr1]MRDDADAGAVRLTRDDAVLHITLDRPSRRNSLSRTMIGTLVDTLTEAASD
DSLRAIHLTGVGKDFCAGSDWVATNSGGGKPRPGNLLRRVPHQANRVVEL
LATIQLPVVCTVRGWAVGLGCNLALAADFTVATPEANLWEPFIDRGFSPD
SGATWLLPRLAGVARAKRMLLLGEKVTGADAADWGLIHQAVPQDEIAGVA
EDLMHRLAAGPTVAIGLAKRSIHYGMHATLPQSMDHELSDLELACRTSDF
KEGLAAFRDRRAPGFTGR
315445268YP_004078147.1 GntR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPAQRIRQPRVAELVASRLRDDILTGRLKEGDVLPSQESLFAEFGVSPPA
VREAIHILEADGLISVRRGNVGGAVVHLPSAERTAQMISMVLQTRAATPG
DVSEALLHLEPICAGMCASREDRATEVVPHLQAAIDAQVEQFDSPSQYVP
NARRFHEAIVSHCGNEPMILLIGSLQVIWSAHESSVWSDEYHPSDPMEPK
TMRAALRDHQRLLDAIAEGNSARAVKLAGDHLAAARRNTLAAASQKTIEA
KLISN
315445267YP_004078146.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MTTTDDDRVLFDVDRDTRIATITLNNPKQRNSYDAAMRNLLARHLDEVAE
DDDITVVLLRGAEGVFSTGADMNNAYGWYGPEDPAGAGKPRKSRPSQRRR
LTVDRKSFGFYHNLMGFPKVTVGEISGYALGGGFEMALMTDISVIARDTR
IGMPATRFLGPALGSLHLFFHRLGPVQARRLLLTGDIIRAADVEHLGVFT
ETCDADAVTARARYWAEKAAKMPADGVVIAKEAFRLVEQSQAYQGEEVAS
YLFHAYGTNLQFADGEFNFVKTRAQHGTKEAFRLRDEHFHVPEP
315445266YP_004078145.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum Spyr1]MSTPVIVGAARTAIGRSFKGTLVNTPPETLITTVLPEVIRRSGVDPADID
DIIFAESHYGGGDLARYAADAIGLQHVPGQSVNRHCAGSLTAIGNAAAQI
GSGMERVMIAGGVQSLSMTPLVNWRIPGPELKFEERWMPPTHVETPDAPT
KDMSITVGWNTAQAAGITREDMDAWAARSHQRAVAAQDAGKFLDEIVPLK
VEQFDGSVIDFSVDEQPRRDTSVEKLAGLKVLHPEIEGFSITAGNASGTN
DAAAGVALVEADYAAANGLTVMAKVRSWGAVGVAPRDTGLGGVKVIGRVL
DKAGLKPSDVTLWEINEAFASVPIAAVREYGIDEELVNFSGSGCSLGHPI
AASGARMITTLIYELQRRGGGIGVAAMCAGGGQGGGVVIEV
315445265YP_004078144.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MARQATAEKRQRRERGSINPDDIIKGAFELAEQVGIDNLSMPLLGKHLGV
GVTSIYWYFRKKDDLLNAMTDRALRQYAFATPYVEARDWRETLANHARTM
RKTFNGNPILCDLILIRSALSPRAAKVGVQQVEKAIGSLVEAGLSPEDAF
DTYSAMSVHVRGSVVLQRLREKNLAGDDGHGDIDDTMAIDPETAPLLAAV
TQKGHHLSASDDRNFEFGLDCILENAARLIEKAKTTRKAPARKR
315445264YP_004078143.1 short chain enoyl-CoA hydratase [Mycobacterium gilvum Spyr1]MSDEVLLERRDRVLIITINRPEARNAFNLAVAQGLADAMDELDDTPELSV
AIITGAGGNFCAGMDLKAFMAGEVPAIEGRGIGFTERPPRKPLIAAVEGY
ALAGGTEIVLATDLIVAAKNAKFGIPEVKRGLVAAGGGLLRLQKRIPYQK
ALELALTGDSFTAEEASAWGFVNVLTEPGGALDGALALAERITANGPLAV
AATKEVIAKSADWTEAEMWKKQGEIVFPVFSSKDAMEGATAFAEKRKPNW
TGT
315445263YP_004078142.1 dihydrodipicolinate synthase/N-acetylneuraminate lyase [MycobacteriMATAAEARDWARVALRGIGDSLYTPFCGVDGDDIDWEAYRTLVRYCVGDL
GHPLLWCTSGIAEFWALTLDERKRLLEIAIEEGRAVNPDVVIQACTAATS
AKDCLELTRHAQQAGADIVYIQTPMMETHGGEGVLRFFRYIAERTDIALG
MFNSPSSGYVLTPAEGARIYEEIPAVCATKEGAFRPAASRMLHDLAPDLV
LWECDKTVYRAGWLREGIVCAAQLGTAGYLFETPRRPIFSEYWELIVAGE
LIEAMDFARESGLDQFDLDMGSWFTCYPARADYFTHWGGAFKFAASVLGL
PIGAYPHSRPPQAELPDLAQNQIRDAYRHLGLIDG
315445262YP_004078141.1 enoyl-CoA hydratase [Mycobacterium gilvum Spyr1]MSAVDRAVDRRAEPVLFDLHDRGVAVLTLNRPDRMNSWGGGLARAFYECI
DRAEADPDVRVIVLTGNGRAFCAGADMGDLDSISGASDSSDTDVTQLVGE
RHPHFVTQLRTPIIAAINGACAGIGLTQALMCDVRFAAAGAKFTTAFSRR
GLIAEYGISWILPRIVGWGAAQDLLLSGRTFYAEEAKSLGLVNDVVAPDE
LMAHTLSYAEDMARNCAPSSLAVIKRQLHKDALRNLHDASAEAETLMHES
MLRPDFIEGITAFFEKRPPSFPPLSTQKEETP
315445261YP_004078140.1 TIM-barrel fold metal-dependent hydrolase [Mycobacterium gilvum SpyMTIQQEERVAAQRLDYRAIDVDNHYYEPIDSFTRHLPKEFRSRGVQMLND
GKRTYAVFGGVINHFIPNPTFDPIIEPGCLDLLFRGEIPEGVDPASLMKV
DRLSEHPEYQNRDARVKILDKQNLETVFMLPTFACGVEEGLKHDIPATMA
SVHAFNLWLDEDWGFNRPDGRILSAPIISLADVQKAVEEVEFVLSRGAKI
VCVRPAPVPGEVRPRSLGDPVHDPVWARLAEAGVPVVFHLSDSGYMAIPA
LWGGSGVFKGFGKRDPLDMVIMDDRAIHDTIASMIVHQVFTRHPKLKVAS
IENGSYFVYRLIKRLKKSANNAPYHYKEDPVEQLRNNVWIAPYYEDDVKL
LAETIGVDKILFGSDWPHGEGLADPTSFTADIPQFPEFSHEDTRKVMRDN
ALTLVHGA
315445260YP_004078139.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MREWTIGGVVDAIAEAIPDRLMTVCGSRRSTYAETAERTRRVANFLSANG
IGAHQERDTIDGWQCGQDRVALIMHNDLYPDMVIGALKARAVPVNVNFNY
APREVDELLAYLRPRAVIFHRSLGAKFADVLPRTGVEVMISIDDGSDAPE
LTGAVTLDDALAAGDADQPITPSPDDVMMICTGGTTGRPKGVMWRQSDTY
VVSMNGADHESVDEIHAKVQHAGPPWFAVSPLMHAAGMWTAFAALLNGQT
VILYDKPTLDAAAVLETAEREKVGLMTMVGDAYARPLIAELQRRPYDLSS
LFAIGTGGAATNQRHQDALLELLPQITLINGYGSSETGNMAFGRSLRDDR
KDTFERRDGVVLLSEDRTRFLEPGEDEIGWVAREGRIPLGYFDDADATAR
TFPVVDGRRVVISGDRASLDADGTIRLYGRDSLVINTGGEKVFVEEVEEV
LRAHHGVADALVIGRDSDRWGQEIVALVQKQPDAVVDPSALLDACHEALA
RYKAPKEFLFVDRVRRLGNGKADYRWAKSQVAPQDTLAGQP
315445259YP_004078138.1 TIM-barrel fold metal-dependent hydrolase [Mycobacterium gilvum SpyMIDCLVNVHFGETANQPEFMLKVRDDYFKGPQSLYDQVELPALLDEMAEH
GVEKAILMDNLVKPSVTARKFAEERPDKFALAIGGVNLLRPMPSLRELSS
VVADLPVAYAAVGPSFWGDGMYPPSDAVYYPLYTKCAELGLPLCINTGLP
GPPIPGEVQNPIHLDRVCVRFPELKLCMIHGADPWWDVAIRLLIKYANLR
IMTSAWSPKRLPDSLLHYMRTRGKNKVIFASDWPVLRQSRVVPEALALDL
PPDVLDNYLYNNANDFFFGTDEQEI
315445258YP_004078137.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MDRYELRRLDYSLSEDHQALQAAYKDLFATRCTIDTVRAAEESGFDKNLW
ERLCAMGATTMALPESVGGDGATLVDLTLVAEEIGRSLAPVPWIDHVVAA
RLLARLGSVDADVVNGKNLVALDPAPDSAGVRLIPAGSIADRLLVRDGDE
IVALSFSSRPARVDNIGKLPMAWVDPAAADSRTVLASGAAALAEYQRALD
EWQLLTAAALVGLVEETMTIAAEFSKTRYTLGVPISTLQAISHPLANIAI
VVQGGRNLARRAAWFLDNEPDERRELAPSAFVFMAEEAAKAATMAVHVQG
GLGVSAEAAATAYLVRARGWAIAGGDPGVTAKYIAQIVADREGRS
315445257YP_004078136.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MDFSRVQLSDDEQKFQDEVRTFLSEIVTDEVIRRDRETGDNFDEGVHLAL
GAAGYLDRDWNPATERPFSRVERRIWELEKRRAHVPWVTSGTTAMITKSV
EKFGSPELKDEVLPRVYSGHVRLCLGYTEPEGGSDVATCKTRAVRDGSSW
VINGSKMFTTGAHNCQYVFLITNTDPSAPKHKSLTMFLVPLDTPGVEIQG
IRTVDGDRTNIVYYSDVRVDDRYRLGEVNGGWTVVREPLNAEHGDVAAAD
DGLADVSIMMHQAMFMAKAVDTAAQKSTIPDPNGRRPIDDGAVAYRLGRS
VARLEASLSAPSIFGRVALAQTMRDISPDLMDILGTASALPVGTDGAADD
GAAEYVYRFAPLVGIYGGTLEVFRNMIAQYVLGLGKPNYSPPRKAS
315445256YP_004078135.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum Spyr1]MHDVAIIGVGLHPFGRFEGKTAMQMGVDAITAAVADAGVSWNDIQFGVGG
SWTVANPDAIVGMLGLSGIPFTNVFNACATAASATKTCADGIRLGDYDIG
IAVGLDKHPRGAFTEDPGLVGMPSWYAENGQYLTTQFFGMKANRYLHTHH
ISHRTLAKVVNKNLRNGALNPNAFRRKPMDEDAILNSPMLNYPLTQYMFC
SPDEGAAAVVMCRADLAHKYTNKPVFVRAVEVRTRKYGAYEVNTTFAPVD
EDVAPTVYASRAAFEKAGIEPSDVDVIQLQDTDAGAEIINMAEAGFCADG
EQEKLIADGATEIGGTMPVNTDGGLLANGEPIGASGLRQLHEIVRQLRGQ
AGDRQIPGDPKVGFAQLYGAPGTAGATILTT
315445255YP_004078134.1 hypothetical protein Mspyr1_36930 [Mycobacterium gilvum Spyr1]MTDAYYELVDPDDPRGERFASSDHVISTWGRSMQNAAPVSALLVRAIERC
APRDDTRISRVVIDLLGPVPVTDELWVQARIDRRGRQIELLGADMTAPGP
DGAPRVVATASAWRFQRVPTPTLPETPIEPMRPVSEGRRRLPDDDTDRTY
IHSLDWLWLNDILHSVEAECWATPLVGLVVGEQMTPTQRLFAVADIANGM
GSRLDPADFTFLNTDLAVHLHRLPEGDWIGVRSESRYGADGVGVSRGTLF
DENGPVAAIQQAQLVRPRR
315445254YP_004078133.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MDVVGQSVADVHFDPFSADFYDDPHACYPRLRAEAPVYYNQTYEFYALSR
HADVAAGLKDFATYSSAYGVDLGMVRRGEKVPAKMIISLDPPEHRAMRSL
VNKVFTPRAIEELRAMVSDTVGRFLAAAVGDAGSEGSEFDVVQDFSAYFP
VEVITQMLGVPERFRQQVRLWIDESLHREPGQIDISESGKQAMAEMWLMY
YELIQQRRDDPGDDMISALIAAEVQREDGAVDRLRDSEIAGFATLLGGAG
AETVTKLIGSAAVTFARHPDQWQQLLADRGKIGVAIEELLRYDAPVQYNV
RRSNVDVTVHGVTIPAGAPVFLLGASANRDPEAWTAPDTFDINRDRSEAQ
YLAFGYGIHSCLGAALARLESAIALDKLLDLMPRYEVQWDRCRRVSMQNV
SGWSHVPVRILP
315445253YP_004078132.1 hypothetical protein Mspyr1_36910 [Mycobacterium gilvum Spyr1]MRWIVDGMNVIGCRPDGWWRDRHGAMTTLVANLERWALAEDADVTVVFEG
PPAPPIDSTVITVAHPRVSAPNSADDEIVTMIGSDPRPGRVLVATSDRTL
AERVRSAHGEVCSAERFRELIEPR
315445252YP_004078131.1 anaerobic dehydrogenase- typically selenocysteine-containing [MycobMVTRTEHTGIEHRATFCRICEPLCGMVATVEDGKLVSLRPDKDHPLSAGF
ACQKGIAFTEIVNDPDRITTPMRRTPDGFEPVSWDEAMSDIADRLSRVLR
SHGPGAVGWYMGNPGAFSYAHVMAIMAFIKGIGPGTHFFTASSQDTNCRL
MASQLLYGTPTSVPIPDLTRTDLLVMMGANPVVSHGSFLTAPRIKDRMHD
IVKRGGRVVVIDPRKTETAAQFEWCGIVPDTDALLLLSLLQVMFAEGIAH
TREIDAVADGSAWLRAQVAPFTPEVTQSHTGIDPDTVRGLARDLAATPRA
AVYGRLGTCVGRYGTLTSYLIDVVDLVAGNLDVPGGSVIVGQGMPAQRLV
NIGMGAALRRTYRRQRSRIGGFRAIIGSEPAALMAKEMTTPGHRQIKAMF
VSAGNPVLSVPNGDELESALDSVDLTVGLDFYLNETMAHCDYVLPVTTMY
ERDDFALVFQQFQATPFRQVTEAVIAPVGQARQEWEIIGELIGRMADHSR
VFAGMTAAGKVLRRLGKPFTPRAFADIVIRTSTGGDWFGLRRGGLSHWRL
AREHPHGAVLSPHLRTGALKEAIAYLRGRIQLTHEDIAAEIATLLKQEQP
DAYPLRMIGMREPRSENSWMHNAPLLMRGDRGHHGLMNADDAADLQIGDG
SEVRVSSPYGSITVPVTLTKDIMPGVIAVPHGWGHKGTGGWTLANKAGGA
NVNRLTSSDPDDVESLAGMAWLTGVPVRAEKV
315445251YP_004078130.1 transposase [Mycobacterium gilvum Spyr1]MIDLSRSTWHYRTNPRPPVSDPLPQKHRAYPSRIDEADRAVIRDKILAGW
EAGSSVDHAFAASWDEGVMLASRRSWWRIAAAIEDQSARPVAPTRSTSKT
PRQAPVLKATGPQQIWSWDITDLRSPWRGVAFKAYSILDIYSRKIVGWRV
EERECDDLAVDMFEAAFAGHGLPAVVHADSGPAMRSTVLKDLLAGLKIGQ
THNRPRVSNDNPFSESEFRTMKYRPNYPGVFTDLDSARAWVSAYVSWYNQ
HHRHSGVELFTPDSVHDGTWAQLWDRRDTALQAYYDAHPERFRNRPRTKS
PSPVVGINLPTENDPDRLQAA
315445250YP_004078129.1 hypothetical protein Mspyr1_36870 [Mycobacterium gilvum Spyr1]MSVSISAGFSIAEIREFVVEYQRVPHGQKGSWLAASGVSGGQFRRWQAAV
FSGDLDRGLIPREGSEMTVPPALRKALAKVDAARQDRDEAELAQLRERVR
ELEATNEALGKAIGLLHTMSAHEPDAAPTIHDLDDSSTPRTDLSPS
315445249YP_004078128.1 acyl-CoA transferase/carnitine dehydratase [Mycobacterium gilvum SpMEGVRVLEVAQFTFVPAAGAILADWGADVIKIEHPVRGDTQRGFINMGGF
QLDPNRHPLIEHPNRGKRSVGIDVSTPEGQEVLYEIAKTADVFLTNYMPQ
ARQKNKFDIEHIRAVNPNIIYARGSAYGDKGPERLVGGFDGTAFWTRSGV
GHALTPEELGGALPQGIPAFGDSIGGMNIAGGISAALFHRERTGEAVEID
VSLLSTAWWAAGASVTQGMETGETMRSLIPGTTTSVNPFMANYQTSDGGT
INLCIVSPTGYIRDTWEHLGLPELADDPRFSDVMPLIQNAEEGVRLITEA
IAAKPFEYWRRHLKTMKGQWAPFQSLVDLGTDEQAIANDMIVEVEASDGG
KPFKVVRGPVQFNHEPLETTRAPQASEHTEIVLMELGLEWDRIEELKDKG
AIA
315445248YP_004078127.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium gilvum Spyr1]MSATPTERTETSLEWGRRAAQRAESRMLIDGELVGAASGEMFDNLSPATG
AVLGGTAAAGADDMHRAIAAARRAFDTTDWSTDKELRRRCLQQLQAAIES
EKEELRTELVAEVGCPVMTTESAQLDWPLAEALRYPAGLIDDFEWERVLD
GGGLFGERNIRMVVKEAVGVVAAVTPSNFPIEVILNKLGPALAAGNTVVL
KPDPHTPWNATRLGRLIAEKTDFPPGVVNVVTTPSNAVAGLLGTDARVDL
VSFTGSTAVGKLLMRQGADSMKRMFLELGGKSAAIVLDDANPAVIVPTAV
GVCVHAGQACAATSRMLIHRSLYDQAVADITMAYQYVPVGDPTDPGTLVG
PVISAAQQERVLSAIEGARRDGAEITAGGGLVAGLPDHLAGGHFVAPTVI
TGVDNSAAIAQQEVFGPVLVLLPFDDDDEAVRLANDSAFGLAGAVMSRSA
ERGMNIARRIRTGAFGVNGGMFYGADAPFGGYKSSGVGRQCGIEGFSQYL
ETKTIARRERRQG
315445247YP_004078126.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MRVDTPVQDVEMDGPIDLRDPYPMFARHRAEGGVFRGSVMDWSKTPESLM
PEKLYAAVSFDAVNRVFRDGKVFNSKIYDATIGLFIGPTILAMEGKPHWE
HRNLVSAAFKTRSLARWEPEIVRPVVNGLIDEFIDKGSADLVRDFTFEFP
TRVISRLLGLPEDDLPWFRKRAVELISYTINHKRAFEASAALKDYFLAQI
EKRRCAPTDDIIGDLVSAEIDGEHLTDEAIFSFLRLLLPAGLETTYRSSG
NLLYLLLTHRDQFDAVDADHELIGQAIEEGLRYETPLTTVQRFTTEDTEL
EGVPIPAGAVIDVCIGSANRDEKRWERSEEFDIFRKRVPHLSFAAGEHTC
MGLHLARMETRVAVETLLTRLSDIRFVTDDDPHIHGQPFRSPTALPVTFS
PAAAK
315445246YP_004078125.1 hypothetical protein Mspyr1_36830 [Mycobacterium gilvum Spyr1]MGGKTVITTVEITRLVVPTMEGYQEGSAMSAEGRRVVVVGAGSGIGAATA
AWFHSRGDHVLAVDARPRSGPFAEWLVCDLRSADEIEGALGRIGHGWDVL
AHVAGIPGTADARDVLTVNYLGARLMLDGMLPLMNHGGSMVAVASTAALG
WDSNIGLLSGLLDARDTTAVTRWLEAQDPSMAYYLSKQALVLYAKRLSGV
AWREYGVRVNTVSPGPTETPILGDFEESMGRDMLDGVRTTIGRHGTVDDM
TPAIGFLSSPEARWINGQDIHVDGGFTAALVHPMPERAQV
315445245YP_004078124.1 hypothetical protein Mspyr1_36820 [Mycobacterium gilvum Spyr1]MTRGDKTLCVIYAAVALVALVATWWHNVAFILSGQGESLLDFIRAAYANH
AGASLTNDLLLLGVAVFVFMVVEARRLGIARIWLYLVISIGVAISVGLPL
FLIVRQVALARTRGAEKGAQA
315445244YP_004078123.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MTEPNQFTVPAAADAVAAVIGDREFIIQGERRYTYAQIVERSNRLAAFLH
AQGLGCHTERSELPGHEVGQDLLGIYAYNGPEYVEGMLGAWRARVAPFNV
NYRYVKSELQYLLADAGATALLYHSAFAPRLAEVLADLPSLKVLIQIADD
SGNELLPGAVDYESIVAEGPAEVPPVQPSPDDLYVLYTGGTTGMPKGVLW
RQHDIFMASFGGRSLYTGELISSLDDVAQRCVESPGTTLMVLPPLMHGAA
QWAVFTAMNTGQSVVFSPVTEHLDVDDVVATIEREKVLAVTVVGDAMARP
LADAFERTTADLSALAVVANGGAQLTPSAKQRLIDVKENLMVVDGVGSSE
TGAQMTHMSAPGAVSTGKFTAGPDTFVASEDLSTILEPGHDGMGWLAQRG
YVPLGYKGDATKTAATFPVIEGVRYSVPGDRARHLADGAVELLGRDSVTI
NSGGEKIFAEEVESAIASHPAVADVVVAGRPSERWGQEVVAVVALDSGAT
ATAEELIDHASAVIARYKLPKAVVFRPAIERSPAGKADYRWAREQAISGS
315445243YP_004078122.1 nicotinamidase-like amidase [Mycobacterium gilvum Spyr1]MRIPLAELVAPGHTAVVTQECQEAVVGTNAGLAALADAASGEALPNISRL
LPVARRAGVDVVHCLVQRRADGRGANHNAKLFTVGASGVDITPDSPGTQL
VPEIDVQPSDLVLRRWHGLGPMGGTDLDAILRNLGVTTIVAVGVSVNVAI
LNLVMDAVNAGYRVVLPRDGVAGIPAEYATAVIDNTLSLLATLTITDDLI
SAWAATC
315445242YP_004078121.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium gilvum SpyMKVPFTWKVTGWFMIGWSAEFEVGDVKALRYFGEDLAAYRDESGRLHVLE
AHCKHLGAHIGHGGKVVDDCIECPFHGWRWGPDGSNTYIPYQPDRPNRGL
RLRSYPVEEQYGCIFMWYQPQGKEPQWELPDIFHKFPQFETDANAYYRPY
PEFSSRADAIPVHPQIVAENGPDSSHFRYVHGATVTPVCLHWEHVDEEWR
FLTGWPDARSDDPDKMALRIHSHFSGLGFAMSAFEGSSNHRLIFACTPVD
DEVSDMFYSIWWPKLPGETSDIPPAEVIEKVERQFLKTVWEDCDIWRYQK
YVENPPLAKIDAKPYMAMRKWAQRFYEVPPVGDPVASR
315445241YP_004078120.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MTIEHGPRRFDAIVVGAGFSGLYALHHLRELGLSVRVLERAHNVGGTWLF
NRYPGARCDIESIEYSYSFSEEVQQEWVWTETMPTQPEIEAYLNFVADRL
DLRRDIAFDTNVTAMVFDDDRAEWVVTTEAGESFVASYVIAATGILSVPL
EPTIPGMASFAGTSLFASRWPEGADLRGRRVGVIGTGSTGVQLIPVVAEE
AAHLTVFQRSPAYTLPWTVRPFAPGELDELKAQYPQIRAAQREHPVGAAR
LSAFSVLLEMLVKPPLKSASREERTRAVEERGIMGALDWGDLFFDIDANR
MAAELYGEAVARIVDDPVTARALTPSHPFACKRPIIDQGYYETYNRDNVS
LVDLRADPIVSVRPTGIETEGGLHELDAIIYATGFDAMTGALSRIDVRGR
GGMSLGEFWATEGPLSYLGMAVAGFPNLFTIQGPGSPSAASNFVAAMEQN
VEWIGACIGHLREHRYQTIEALPDAQQNWIEQATALVAPTVLVHPSCNSW
YNGGNVPGKKRMYMGYTAGIPEYRRQCDEIAATGYAGFKLA
315445240YP_004078119.1 hypothetical protein Mspyr1_36760 [Mycobacterium gilvum Spyr1]MKTSERLWRIGSDFAGVLPRAHSAVADGQAWNPLSVRGLRQLGEVALDEL
ALTGMTLTAPPPRLERSEASCAAAAAELAGLGVTGANADPDPVDIGSLRR
RRLGRHRYEQLTFDHDPHLPDTLSAEGFGGAATAVAHLCRTDSKRRPWLV
WVHGAGQGQPIDLLFSRARRIQDELGVNVALPVQPGCGVRASAWPEYPTM
DPLANVAGMLRVVSEVRALVRWLRPQATAIAVAGVSMGSPVAGLVSHLEP
VDAVAVYTPIFGLNAMIAAHLGRWGPSVDDTVALLRSEVVEQVSAAVDYQ
AVEPSASPDRRLIVGAWHDRMAMREPAQVLHARWGGELYWHQGSHVGHLF
APGVHTASEKFLRSLTG
315445239YP_004078118.1 phosphotransferase family protein [Mycobacterium gilvum Spyr1]MTVPGSVDALTACWLTEALRSDPTLSDTLTVDGVRAERIAMDSGFSSLLY
RLHLTGTGVPATVIAKLPAESEARGAMELLGGYRRELAFYRNVAGRAPLD
TPHVYTAQIAEDSVDFVLLLEDLRDWDNADHLVGLTVEQTRLAVTNLAGL
HAWSVDPSNSAALQHFPSLSTPIVRDLLVPAFAPGWQVYRDRSGAAVPRR
IARFADRFAELAPQALAALVEHSMLLHGDIRADNMFFDGGRLKIVDFQFA
SVGSGAADIAYLVSQGLPTDARRGHDETLMREYLGMLGVPYRFDDAWRHY
RFAVAYLMVLPVIILVGWDSLPERSRALCLELTSRAIAAIDDVDATEVFA
315445238YP_004078117.1 hypothetical protein Mspyr1_36740 [Mycobacterium gilvum Spyr1]MTRTAREVVEQYNLIVWNERDFALAEELMGDTVIRHDVGESTTLTHEQAV
ARVVDHWAMFESIRFDLNLVIAGDDGEHVTIVYQSPMKLKDGTETTIGSM
EIFRVVDGRITEVWNCGYKQGVWA
315445237YP_004078116.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMTEAKMDELGYYLLAGAGGEGPATLMDEARRGEELGFGTGFISERWNVKE
ASSLTGAALAVTSRMQIATAATNHNTRHPLITGSWATTMHRLSGGRFTLG
IGRGIGAIYNAFGIPTVTTAQMEDFAQVMRKLWHGELIFNHDGPLGKYQV
LFLDPDFREDIRLAIVAFGPQTLALGGREFDDVILHTYFTPETLQRAVKT
VKDAAEQAGRDPASVRVWSCFATVGDHLPEELRLKKTVARLATYLQGYGD
LLVNTNGWDPAVLQRFRDDKVVQSIGGGIDHKATAEQIEHIATLIPDEWL
EPSATGSPQQCADRVRKEFDYGADAVIMHGATPDELEPIVAAYRAGQS
315445236YP_004078115.1 acetyl-CoA carboxylase- carboxyl transferase subunit alpha [MycobacMAKAEDWAETLDELSRRRDHSRAMGGDERVARHHGKGKLDARGRIQHLVD
KGSFREFGTLVGGDIAADGIITGAALIDGRPVMVGAEDFTTLAGSIGPGG
NAKRYRLAELALRDRVPMVMLLEGAGFRPSGEHYGRTPTDLLAQAQCSGK
VPTVGGLFGPSAGHGALVAPVCDWTIMTGQGAIFTAGPPVVKESTGEDIS
KEELGGPSVALASGVIHNLGADDAAVLDDIRRYLSFFPSSAWSYPSSTPA
GEGTGHRATPELLDIVPRGNRQVYDMSDVLDVVFDDSGWFEVQPRFGRAM
ITALARLGGHPIAVVANQPKVLAGSIDADAADKAAHFIMVADAFHLPIVF
LADNPGMLPGSRSEKTGVLRSGARMFAAQTAASTIKLHVTLRKAYGFGSM
VMSLLGFDNQSATFAYPGATMGAMSAAALSRASNATEDLEAKLRQAEVDA
SFRSAGHLGFDDLIHPQETRDVLLDALERGLYSRQAAAQPVTRTVITP
315445235YP_004078114.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMDAAVVSQLSHVPAAARTLEQRGYDGCWTAEINHDPFLPLTLAAEHTERM
ELGTSIAVAFARNPMSVAQIGWDLQDYSEGRLLLGLGSQIKPHIEKRFSM
PWGRPVARMREFVQALHEIWACWRDGTRLNFEGEFYTHTLMTPMFVPQQH
AYADPKVFVAAVGDRMTEMCGEVADGLLAHAFSTQRYVREVTIPTLERGI
ARAGRTRADVVVSSPLFVVTGHDEQELAANAVATRKQIAFYASTPAYRGV
LELHGWGDLQTELHRLSRAGEWDTMGVLIDDTMLAEFAVVAPVDELVHTI
RARCDGLIDRVLVGFPPSIDEATVVGLVSELQAEETS
315445234YP_004078113.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MSVRVADEAGKVFADPTAYADEQRLHAAMTHLRANAPVSWVDVEGYNPFW
AITKHADIMAIERDNTVFTNSPRPVLTTAEGDAQHASMGVSTLIHMDDPQ
HRKVRAIGADWFRPKAMRALKVRVDELAKTFVDQMYDRGGECDFVQEVAV
NFPLYVIMSLLGIPESDFGRMLTYTQELFGSDDAELQRGTTMEERGLALF
DMFTYFNELTASRRAQPTEDLASAIANARIDGEPLSDIDTVSYYLIVATA
GHDTTSATISGGLQALIENPDQLARLQQAPELLPLAVEEMIRWVTPVKEF
MRTAQQDTEVRGVPIAAGESVLLSYPSGNRDEDVFTDPFRFDIGRDPNKH
VAFGYGVHFCLGAALARMEINSFFSELLPRLTSVELAGRPEHIATIFVGG
LKHLPIRYSLTR
315445233YP_004078112.1 TIM-barrel fold metal-dependent hydrolase [Mycobacterium gilvum SpyMNKDDMILISVDDHVVEPPDMFKNHLPKKYLDEAPRLVHNEDGSDTWQFR
DVVIPNVALNAVAGRPKEEYGLEPQGLDEIRPGCWKVDERVKDMNAGGIL
GSVCFPSFPGFAGRLFATEDPEFSLALLQAYNDWHVEEWCGAYPARFIPM
TLPVIWDAEACAKEIRRNAARGVHALTFSENPAAMGYPSFHDDYWTPVWE
ALVDTDTVMNVHIGSSGRLAITAPDAPMDVMITLQPMNIVQAAADLLWSK
PIKKYPDLKIALSEGGTGWIPYFLERADRTYEMHSTWTGQDFGNKLPSEV
FRDHFLTCFISDPVGVALRNEIGIDNICWEADYPHSDSMWPEAPEQLDEV
LKANNVTDVEINKMTYENAMRWYHWDPFTHIPKEQATVGALRKAAEGHDV
SIQALSHHKEGERGGGAGHFDALNAAARGNSGA
315445232YP_004078111.1 hypothetical protein Mspyr1_36680 [Mycobacterium gilvum Spyr1]MGDNHYRRYLDHHARTHADQVPMTEREYWRRRHAQADAEPGARCC
315445231YP_004078110.1 carbon starvation protein- membrane protein [Mycobacterium gilvum SMATPTAASSDRIEETDGDITYIRTDKNLPPVAIVDRSPITVKHKIIFSIV
AVLGAVAWAIIAFFRGETVNAVWFVVAAICTYVIGFRFYARLIEIKVVRP
RDDNATPAEVFENGTDYMPTDRRVLYGHHFAAIAGAGPLVGPVLATQMGY
LPGAIWIIIGAVVAGCVQDYLVMSISVRRRGRSLGQMARDELGVVGGVAA
IVGVLVIMVILLAVLALVVVGALAESPWGVFSIAMTIPIAIFMGLYLRFL
RPGRVSEVSVIGVALLLLAVVAGGWVAETDWGVEWFTLSKVALSWCIIIY
GLAASVLPVWFLLAPRDYLSTFMKVGTIALLAVGILIARPVMEAPAISQF
AASGTGPVFAGSLFPFLFITIACGALSGFHALISSGTTPKLLEKESQMRL
IGYGGMLTESFVAIMALITAAILNQHLYFAMNAPSASTGSTAQSAADYVN
GLGLSGAPITAGEISDAAESVGEESIVSRTGGAPTLAFGMSEVLHQVFGG
AGLKAFWYHFAIMFEALFILTTVDAGTRVARFMLSDGLGNLGGPFTKLRN
PSWRVGAWICSVIVVAAWGSILLMGVTDPLGGINTLFPLFGIANQLLAAI
ALTVVTVVIIKRGLLKWAWIPGVPLLWDLIVTMTASWQKIFSGDPKVGYW
TQHFQYRNARDAGQTAFGAAKDAGQLDAVIRNTFIQGTLSIIFAVLVIIV
FAAGVIVALRAIRGKGSPLTEDDPVPSRMFAPSGMTMTPAEKEVQKQWDA
LPKTPAGSSATSPGTGKH
315445230YP_004078109.1 ATP-dependent DNA ligase I [Mycobacterium gilvum Spyr1]MLLVDVAGASADVAASSARLAKIARIAELLRRAGREDVAIVVSWLSGELT
QRQIGVGWASLRSVPAAAAEPTLTVAEVERRFGEIGATAGRGSQARRAQL
LADLFSAATDVEQTFLRRLLTGELRQGALVGVMADAVAKAADLPAATVRR
AAMLGGDLPAVAAAALTDGDAGLAQFTLQAGKAVGPMLAQTAADVTDALD
RLGGTAMFEAKLDGARVQIHRRGDSVSIFTRSLDDVTARLPEVVEATLAL
PVTDLIADAEAIALRPDGRPHRFQVTASRFGRRGGTSDTASNPLSVFFFD
LLHVDGVDLLDAPAHERIARLDAVTPDSQRVDRLVTSDPGAAQEFFDRTL
AAGHEGVMAKSTVAPYEAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRSG
KLSNIHLGARDPGTGGFVMLGKTFKGMTDEMLAWQTRRFLDLADGDATDH
YVVKVRPEQVVEIAFDGLQTSTRYPGGMALRFARVVRYRDDKAATDADTI
DTVREIYERGN
315445229YP_004078108.1 sulfite oxidase-like oxidoreductase [Mycobacterium gilvum Spyr1]MTTPGVRAAGGVAAAAVAVGVASLVGAAFGPEADVRTAVGSSVIDLTPGP
VKEWAIATFGTADKLALAVMVLLTIAAIAAVAGLAETRRRPVGSIAIVIA
GGIGCAAVLSRAGSTGADIIPTLIGTACGVAVLRILQSDRLDGPSSETGT
DPGRRRSLLTIGLLAAGAVSGVAGVVISRLASSVAGDRDAFALPRIDTPA
APIPESVQPKGVELPSWVTGNDDFYRIDTALSVPQLSRSEWRLRIHGMVD
REVTFTYEDLDRFEVVEKVITLTCVSNPVGGELISNAVWTGYRVKDLLAE
AGVRSGADMVLSMSVDGWTAGTPVEALTGDDALLAIGMNGEPLPIEHGYP
ARLVVPGLYGYVSATKWVTALELTRFDRAQAYWTRLGWSARGPIKTASRV
DVPRSGQDVALGPVTFGGVAWAQNRGVRSVEVQMDDGPWEQATLGDSYSG
DTWRMWSYAWEARDTGFHTITVRATDDSGYTQTPDRADPVPDGATGWHSI
TFAVK
315445228YP_004078107.1 hypothetical protein Mspyr1_36640 [Mycobacterium gilvum Spyr1]MEIEGKKAIIVGGASGFGRATAEALAKRGATVAVLDRPQSKGKEVADQIG
GTFYEVDITDFEGTESVLNKVVEDLGGLHIAVTTAGGGIAERTVKKDGPH
SLDSFRKSIDLNLIGTFNISRIAAWHMSKNEPVDDEAEERGVIINTASIA
AFEGQIGQLAYTASKAAIAGMCLTMARDLGSLGIRALAIAPSLFATGLTE
GIPDEFATVLTKDAAFPKRLGKPEEYAKLAVAIVENPMLNGQCLRLDAGQ
RFAPK
315445227YP_004078106.1 aminoglycoside phosphotransferase [Mycobacterium gilvum Spyr1]MSLVNLRLTNDTEIAIRVVRVPVDVTLTDDAVAALQEWVRRTGLGSVVSD
VEPLTGGSQNIVVRVRLDGSDVVLRRPPQHPRPTSNDTMRREIAVLQTLR
GTDVPHPEFIAGCEDLDVLGVVFYLMQAVDGFNPGTEIDEAYVRDAGMRH
RVGLSYAASLARLGAVPWEGSPLAALKRPGSFLARQVPQFLRLLESYRHE
NYAPESFPSVHVLAEWLEAHRPPDSEPGIMHGDCHLNNVLLRRDVPELAA
FIDWEMCTVGDPLLDLGWLLVCWPDGPNPIDAGSALGALGGLASRAELID
AYRDAGGRPTTHLDWYIAMACFKLAIVIEGTWSRYLAGRASAEAGERLHA
SAENLIALGTRVSTGDNPFV
315445226YP_004078105.1 permease [Mycobacterium gilvum Spyr1]MLFAAGILGGLTGSIAGLASVATYPALLVAGLPPVTANVTNTVALVFNGV
GSVLGSRPELRGQRTLLTRAIPFAVLGGVTGAVLLLSTPAEGFEKIVPAL
LGFASLAILLPVRPAGDPSTASRRRRTLSLAVQGLAVFAICIYGGYFGAA
AGVLLLAMFLRLGGETLAHANAAKNVVLGVANGVAAVIFAVVAPVQWVAV
LALGAGCLVGSRIGPVVVRRTPDRPMRLAIGLAGVALAVKLGIDAYR
315445225YP_004078104.1 hypothetical protein Mspyr1_36610 [Mycobacterium gilvum Spyr1]MRKSLIIGSTAATLLFGGAGIANATETVAPATTTTVVAQEAEQEDGDNTG
LWGLAGLLGLVGLAGLKRRKDADYRPAANTGTVNPPRV
315445224YP_004078103.1 hypothetical protein Mspyr1_36600 [Mycobacterium gilvum Spyr1]MNVSSSTHPTTASSASASMPFAAHVDGRTPRALREPAERKSFDEFLAEYA
PTSGPLRLGQWTCVDDDRPGRRLGPQARQYQATLAVGDRIATSRAAACGP
VAALTEMLHEHGVAIEMTAFHQVPAGDHTATFIRGSRCGGEQWAMGWSDD
STDSALRAVIACVNRLLTE
315445223YP_004078102.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MTAISTPEYLLDQAKRRLKPTPVTIPGMGAIEKRLLEKQWDEIILAEPPA
GSGLKAVRGDNGLPIVAHMIEMFRGGPDFILHQYRKYGPVYYSGSQVLPA
VGALGPDATQAVFSNRNKDFSQRAWDPVIGPFFEGGLMLRDFEDHMYHRR
IMQEAFTRSRLTGYVEHIDQVASAVIANDWVADDRRFLFYPAVKELTLDI
ASVVFMGHKAGTDKQLVTTVNEAFTTTTRAGNAIVRKPVPPLSWWRGIRA
RKTLEDYFNAGIAEKRRSESTDMFSVLCHAQDEDGQSFTDQDVVSHMIFL
MMAAHDTSTSTLTTMAYHLAANPEWQDRCREESERIGDGPLDIEALEKLE
TYDLVINEALRMVTPLPFNFREAVRDTELLGYYIPAGTAIMTWPALNHRL
PELWTDPEKFDPARFAEPRNEHKKHRYAFAPFGGGAHKCIGMVFGQLEIK
TVMHRLLRKYRLEPVSPNYRPRYDHGGMAVPIDGMPIVLRPLH
315445222YP_004078101.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPRSNSMTAEPAPTDLRRSRGDRQRDAIVTAVRELLHERPFAELSVSTIS
ERAGVARSGFYFYFDSKYAVLAVIIAEAMAELDQLTHSFAPRDEAESPSE
FAKRMVGYAAIVFASNDPIMRACNLARSTDAQIREIMDDFQNTVVEKIVG
LVGRDAGARPISDDLPALVRVMIAVTSSTLAHDSAFVGRDGDPARALAVV
ERLWESSLWGGQ
315445221YP_004078100.1 hypothetical protein Mspyr1_36570 [Mycobacterium gilvum Spyr1]MAQRSGSDRFSGKRCFVTGAASGIGRATALKLAARGAELYLTDRDADGLA
LTVADARALGGVVAEHRALDISDHDAVVAFADDIHSRHPAMDVVMNIAGI
SAWGTVDKLTHDDWTSLININLMGPIHVIETFVPPMMEARRGGHLVNVSS
AAGIVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPL
VDTVRIAGVDRDDPRVQKWTNRFSGHAVSPDVAADKILDGVARNRYLIYT
SLDIRALYLFKRTMWLPYSIAMKQVNPLFTRALRPKTKQR
315445220YP_004078099.1 ATPase [Mycobacterium gilvum Spyr1]MLETVAIRGYRSLRDLVLPLRRLTVITGANGTGKSSLYRALRLLADCGRG
EVIGSFAREGGVASALWAGPEHLGGARRTGTAQGGPRSRSVSIELGYAGD
DFGYLIDLGLPQATETAFGRDPEIKRELVFAGPVARSTTTLVRRVRGMVE
VASDTGRGFDELARNLPAHRSVLTDWAGASPELAMVRERLRNWRFYDGFR
ADADAPARRPQVGTRTPVLADDGSDLAAAIQTILETGNGDLARAVDAAFD
GATVSVAITDGLFDLQLHQRGMLRPLRSAEISDGTLRFLLWAAALLSPQP
PSLMVLNEPETSLHPDLVPPLARLIGEAATRTQLVVVTHSAMLRECLGAE
PIGTDGDAWEIELYKDWGETRVGDQDLSTMPPWDWGRR
315445219YP_004078098.1 GAF domain-containing protein [Mycobacterium gilvum Spyr1]MASQVPGFDERLDDALVDEAARAGEPVDVFIARAVAARIAVEMARRSDPD
LDGILRRLRLMDLSPPRPGLPADTGSVIADPERLQALYETGLLDERRGPV
LDRIVEMTVAALAVPTAVVSLVDRDSVYLPSAIGMPGVLAAARQVSLERS
ISRPIVATGEPVIVEDARSHPALRDHPMVLDGFVVGFAAMPITNSGGHTI
GTLAVWDSTPRRWTDGHIQILEDFTAIICDRIFGRGAA
315445218YP_004078097.1 nucleotidyltransferase/DNA polymerase involved in DNA repair [MycobMSDPPAAGERDWVLHVDMDQFLASVELQRRPDLVGLPVIVGGNGDPAEPR
KVVTCASYEARTFGVHAGMPLRAAARRCPDATFLPSDPEAYDAASDRVMG
ILRDLGHPVEVWGWDEAYVGARVSDPFALARHIQTVVASQTGLTCSVGIS
DNKQRAKVATGFGKPAGVHMLTDENWMPVMGDRPVDALWGVGPKTAKKLA
AIGITTVADLAGTDSAELTKTFGPTTGLWILLLAKGGGDTTVSAEPWVPR
SRSHVITFPQDLTERAAMDEAVTELARRTLDEVIAQQRIVTHVAVTLRTS
SFHTRSKIRKLPEPTIDADAVISTATTLLDAFDLQRPVRLLGVRLELAMP
SATAARG
315445217YP_004078096.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MSAPENRNGLPVLSVAESGPSERAAERGDAARNRVLLLDAARRLVDERGA
DSVTTDDIANAAGVGKGTLFRRFGSRAGLMIVLLDEDEKAQQHALLFGPP
PLGPGAPPLERLLAYGRHRLKFVDTHHALLSDVGRDPQMRFNAPMTLHHS
HVRLLLDEAETTGDLDAQAAALLALLDADYVHHQRTDLGRSLESIADAWE
TVARKLCGT
315445216YP_004078095.1 flavoprotein [Mycobacterium gilvum Spyr1]MSENGSSTVLVLVGSLREASVNRQLAELAVESAPADVDVEWFDRLGELPF
YNEDIDTADVPEPVAALRTAAARADAALVVTPEYNGTIPGVLKNAIDWLS
RPYGDSALKDKPLAVVGAALGQYGGVWAHDETRKSFGIAGPRVVDGLELS
IPTKTLDGKHPRESDDVVARLRDILGKLVAEID
315445215YP_004078094.1 hypothetical protein Mspyr1_36510 [Mycobacterium gilvum Spyr1]MSWQLLRSCGSLSISDREVTEIPGRPGSESVGGDPDFTGSSGPGRPLDIG
GLSVFETLHLVSDNPKRYKMF
315445214YP_004078093.1 ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit MTQPAPVTVYTKPACVQCNATYKALDKQGIAYEVVDISVDTEARDYVMAL
GYLQAPVVVAGSDHWSGFRPDRIKALAGAVTATA
315445213YP_004078092.1 ribonucleoside-diphosphate reductase 2- operon protein nrdI [MycobaMANIVYFSSVSENTHRFVQKLELPAIRIPLKDRIRVEEPYVLILPTYGGG
HANGPDPDRGGYVPKQVIAFLNDEHNRSLIRGVIAAGNTNFGAEFGYAGV
VVSRKCDVPFLYRFELMGTTDDVFAVRAGLQDFWKDQSCPQPSQLQNR
315445212YP_004078091.1 ribonucleoside-diphosphate reductase class Ib alpha subunit [MycobaMPPTVTAAEPLTTGAHALPGEMDYHALNAMLNLYDADGKIQFEKDVQAAR
EYFLQHVNQNTVFFHSQDEKLDYLIEKNYYEREVLDQYSRNFVKGLLDRA
YAKKFRFPTFVGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLASGDT
VLAEKLVDEIMDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGR
SINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSF
SYANQLGARQGAGAVYLHAHHPDIFRFLDTKRENADEKIRIKTLSLGVVI
PDITFELAKKNEDMYLFSPYDVERVYGLPFADISVTEKYYEMVDDARIRK
TKIKAREFFQTLAELQFESGYPYIMYEDTVNRANPIDGKITHSNLCSEIL
QVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKAMDSPDFAQTIEVSIRAL
TAVSDQTHIWSVPSIEQGNNSSHAIGLGQMNLHGYLARERIFYGSDEGVD
FTNIYFYCVLYHALRASNRIAIERGTAFGGFEKSKYKSGEFFDKYTDQVW
EPKTEKVRGLFADAGIRIPDQEDWKQLKASVQEHGIYNQNLQAVPPTGSI
SYINHSTSSIHPIASKVEIRKEGKIGRVYYPAPYMTNENLEYYQDAYEIG
YEKVIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLY
YIRLRQMALEGTEVEGCVSCML
315445211YP_004078090.1 hypothetical protein Mspyr1_36470 [Mycobacterium gilvum Spyr1]MSRPNAQSMKPATAAKKLDVYLPATPADFQQNPITRNELAALQADPPQWL
IDLRKNGPHPKNLVAAKLGVSIAALARNGVGTALTTEEINELVEENPEWL
AVEREGYQQVLREERRLKSLRADQAGDS
315445210YP_004078089.1 LysR family regulator [Mycobacterium gilvum Spyr1]MTRPSLTLGYVPGATPAKWARHWADRHPEAPLRLHGVTAADAAAAVRDGS
VDVALLRLPTETSGLAVIPLYEEMTVAVVTAEHVLTAADNVDATELHDEA
ILIPADTVVDWPDAPGAPVEHRPETTEAAVELVAAGVGVLLVPQSLARLH
HRKDLTYRPIVDAPTCPVALAFPEGPQSELLEEFIGIVRGRRPGSSRGQT
QPERKRTAREKTLAKQAARAAAGKVARKPGRGRR
315445209YP_004078088.1 hypothetical protein Mspyr1_36450 [Mycobacterium gilvum Spyr1]MTSAAVMASAAVTLSMVIAPVAIADPAVHADPAAAGEFAITSEVPTLAEL
DAQIRLLVASPAPDDVKAAQLEGGVRAVVVPKMIYRVGFFRPPKGSSVVT
GPETHEPDRHTAVINASRQGAPTVQVVAEWRRIDGRWKLASKSLCNGIKT
IGLPIPCNFE
315445208YP_004078087.1 ABC-type multidrug transporter- ATPase component [Mycobacterium gilMIETSGLTKSFGPKKVLDDVSVCFPGGTVTALLGLNGAGKTTLLRLIAGL
DRPDGGTVAVDGRAPGGDPNQVGVHLGPGALDPRHTVGRHLRWLAALAGT
EVGRVDDVLDETGLHAQRPERIGALSLGARQRLSIAGALLCSPRALLFDE
PLNGLDVPGIVWFRGLLRKLADDGCAVVVATHLLAEVVLSADRVLLLDCG
RPRVHGPLGNVIPAGDQPRDWLESALLDGARCA
315445207YP_004078086.1 hypothetical protein Mspyr1_36430 [Mycobacterium gilvum Spyr1]MSVALAVRGARAEMVRTGGRSRLWTVLIPAAVMLPAGITVAIAIAAETFA
RIPGQISVLQVPTSNAAYWVITVTTVVVALAASDGQACENRYHAGEYVRL
AAPRQWPVLTGRWLFYGALGAGAAAVALLTVLVLLPVVSPLVYGSVSVTD
PVALRLLWTVPLLSFFAAGAGIGIGSLIRSPLGAAAVILLWVYAAESAAG
YLPSGAYLQRFMPVLNGVYATGQDAVLIPPWSQNVALLYVCSLFTAIFVI
AAVERTVRHG
315445206YP_004078085.1 methyltransferase family protein [Mycobacterium gilvum Spyr1]MADSPLPLAERSDADLPGHWLLARLGKRVLRPGGLELTTRLLTAARIQGA
DVVELGPGLGRTATDIVAERPRSYVGVDDTAAATEQVRSIVAPVGGKVVV
ADAASTGLPDGSADVVVGEAMLTMQGEKAKRAIIGEAFRVLRPGGRYAIH
ELGLSPDDLSQGIKDDIRRDMSRAIKVNARPLTSAEWTALLTDAGFEIES
VDHAPMALLNPARVLADEGPLGALRIVGNLIRRPAARKRVIGMRKTFQRY
RRSLTAVAVVGVVPGQ
315445205YP_004078084.1 transcriptional regulator [Mycobacterium gilvum Spyr1]MAVLSSEAGQKPDRAAGRQRHRVLDLLREADGPVDAQGVADLLKIHITTA
RFHLSTLETQGFVRRAGVRKSGAGRPKLTYEPAPRLDYADIVALFATHLG
GTAQEREARAQLIGADLAHRVRLARPRAESSIGDLVVATLTELGFQVRSV
LSSFGEVTVQLCTCPLAEVAQSAPEVVRGIQQGLIQEVIDLNVDVIGGSY
GVSVTPDPRGGSCEVGLVLRPTRVAASEREGV
315445204YP_004078083.1 hypothetical protein Mspyr1_36400 [Mycobacterium gilvum Spyr1]MDVVSLKATAAEQLEAARNAHAGRAAHTVYGGHEHKLRQTAIALLADHRL
DDHESPGEASLLVLHGRVRLSTSSESAELGEGEYLIIPAERHNLAALEDS
VVLLTVVTGI
315445203YP_004078082.1 hypothetical protein Mspyr1_36390 [Mycobacterium gilvum Spyr1]MDQRISLITLGVDDLARAREFYEQGLGWVPKSAPDGVVFYQLPGIAMALF
GRGDLAEDAHHPVDGRFSGITIAINQRTEADVDAVLAQAEASGATILKPA
ERVFWGGYSGYFADPDGHVWEVAMNPQWTINDDGTVSI
315445202YP_004078081.1 WD40 repeat-containing protein [Mycobacterium gilvum Spyr1]MSRIFLSHSSRDTRQAIALKQWLIEQTPPLANEIFLDVDPGSGLRAGTRW
KDALRQANARCEAVICLLSKNWEASHECKVEYRTAENLNKQIFVARLEPS
TGDDLTSEWQRCDLFGEGPTTAIDTGQGDPVEFATAGLYRLRDGIRGAGI
GAASFVWPPPRDPDRAPYRGWEPLDEADAAVFFGRDAQIVRALDTVRGMR
LSGVTSMFVVLGPSGTGKSSFLRAGLLPRLRREDRRFVVMNIVRPERNVL
SGDAGFAAALCATRSEFGLSEPSLGEVKAACLAGDADRVISMLAELRQVA
ADRLLQRGGDGDELVAPTVILPLDQAEELFNAEHAESSERFLDLLRQILD
AANGSDLGLAVAATIRTDRFEIMQTHPRLAGLGTALFDDLKPMPATQFKE
VIVGPAQRSTEGGRPLQIAVDLVDRLLADAGSGADTLPMLALTLARLYTD
YGSTGELTLRQYEGMGGMNRVVQSEIDEVLSHDAVQRTRQLQALRSAFIP
WLATINPDNGQPMRRVARLSDLPQDSRGLIDALVAKRLMVSDVRGGTTVV
EVALESLLRQWSELAGWLRDERKDLRDADDLIRGAAAWRGSNRNPAWLLE
GTRLSEAAALVNRPGFRERLREVHDYLDASHRRQQQERDDEEKRRRGELI
AAQEREQAAQERARYAQEQQLTAERHATTLRKRGRVLRSVLALTAVVAVV
AVAGLAWAVSANSRAAERFRQATSLRLTSDSLAMMRGTRPGGDIQAIQQM
VAARALTSSPDDYALSTIVEQDNNTTKIIPAQGVMAGVSYSPDGSRLAAS
GADGYVRVWDAESGQPVVDPIPDHQGVSEIAFSPDGQALVTADLDGVLRI
FDAGDFSVDHEIDTGTENLSSIAFTSDGSRFATIGNDRVIQVVDTDTGDP
VREFPSGHQGYVSELAFSPDGALLLSGSEDGTLQMWDAEAGTAIGPRIET
GGMVADVAFRPDGRRFVSSGNSVILWDTQTRKPIGDPLQGHVNAVTTVSF
SPDSQVLATGSADATVRVWDADTGAFLWNVMYGHEGRIWGLVYSPDGRHI
ASASSDGTVRIWNPLGSQPLLGHTAAVRDLSYSPDGEFMASAGEDGTVRL
WDPDTHQLLGRPLDAGVPLYALDFSEDSSTLVAGGDGGTVVLWNMGSRQV
AGRYETGRAGAIRTLEFEDKGERLSVLDWDGVASVMDIDGQQVGEEVPDV
EAITLSPAWNLAATSRMSENNVYVLPIGGDSQGSEVTLEGHTNRVGRLVF
NPDGSLLVSASDDTTVRRWNPATGESVGGPLAGHTDEVLDLAFSPDGTRL
VTGSADTTARLWDVATGRQIADPYVGHTEHVTSVAFDPDGGSFATGSRDG
TVRVRSVTASPEMLCAKLTANMSHKQWDVWVSPDIDYVQACPGLPIAPD
315445201YP_004078080.1 patatin [Mycobacterium gilvum Spyr1]MSAKTRDDHLFGAGPKRILALDGGGIRGALTLGYLGRMEDILRDRHGGDP
EFRLCDYFDLIGGTSTGSIIATGLALGFAVDELVDLYRSLGEKVFDKSRL
RLGLFGAKFPKEPLLRALDTHFGDMTLGGDELRTGLMIMTKRLDTGSPWL
LHNNPRGKYFDGDGGSYPNRDLLLRNIVRASTAAPHYFEPETLRIAPGVT
GAFVDGGVSPYNNPALQMLMLATCSGYGLNWRFGAENLMLVSAGTGHRPL
RMTAAQVTDMPAVVLAAQSMLSIMADANWLGQAVLQWLASSPTSWQIDSE
IGDLRDDRLGPGPDLITYQRYEVSLEPNWLRDTLDVHIDDEQCDALYAMD
NPKNLTRLASLGVTAGAVQVQPDHFPPGFDLL
315445200YP_004078079.1 hypothetical protein Mspyr1_36360 [Mycobacterium gilvum Spyr1]MRTASLSSTRTVVIRNVLAMIVAGLTGYLAAVAAWPQVHDLVPEQLRWFG
APNSAVTMGIVVIAYIALAVVLVRAGGGRRGGTPVAIVLILAIATTLLGV
ASYWRCQDETHPDFFTPLLWTAALLKGGDPARSLADGSCPSPMPVALNIA
QLSALAALFTSVAGVALALFRSQFDRLRLRLSRSVTVVVGGDDDASSLVA
AIAHTMGRTGTLVVVVGSAETDYARRARTAGACIVAVDLDDAEHLLAVPV
WDKLDRLYLLAPDPSTNLLRLRAVTARGGDERLRIPLVVRIDDPWQAAAW
RAQHFGGAHNRWAGDTVGMYEVTARRLLDRTLTGPRVDRLFVCGSSQLTT
ALCADMLTRRLEAEYLGDDELPVLHVLAPDATQYQRDYAFTATQMGHADR
EADIVAVDGAPSVATLLRLVGEGDAQSTALIFADSTDYGSTATRIAARLP
DTTIHVHDHRADATRERVSVVGRLYTYRLSLDLPGGQAHDAWERAAILIH
RRYVAESGATGPAAEPWEELDEFYRESNRRQVRNALWMVEKIGGHTWNTW
GKPPDGVSTVALRGLQPQEQLRQLGFDLTTATAMARAEHEDWCRYYRRHG
WRHGPRRDDRAKVHDKLIDWTQLESDPAMVAAALRSLAATLTKLRELGYR
SHSDASTHWERFRRAGAVIAEQRATAWTWTAHDGSTMHAAAGDWEVREES
GTDSWSVRDDIFRATHRHIGGYRWRRLGTVLARPANDGESVRTLEGTITA
PPGSWIVQGDHGDVWAVPGDEFTRRYALADHNRSNPGGK
315445199YP_004078078.1 hypothetical protein Mspyr1_36350 [Mycobacterium gilvum Spyr1]MHDAGAALGADAAQRLAALGAVTIERGMSDDELDRAEADLGIEFADDHRA
FLAAGLPTGGSWPNWRDEGRRSLTKRLHLPAEGILFAVEWNRFWHDSWGR
RPAQMKHALRTARYQLERVPMLLPICSHHYLPAGRGSFGHPVLSVVRTDV
VVRGADLVDYVTAEFGAGGPVAVDAVATVEFWSTLSGDYRC
315445198YP_004078077.1 geranylgeranyl reductase [Mycobacterium gilvum Spyr1]MTQRYDVVIAGGGPSGSAAAWQAAQTGAKVVVLDKAQFPRAKPCGDGLTA
RAVSYLQKMGLADEVATYHRVNRVTVFSPSRWELSFPKRPGMPDHGHTVS
REHLDTVLLKHAESAGAEIRQGAEVAGPEFDASGRVVGVILKSGEKVLGD
AVIAADGAYSPIKRALKIDSEYNGYSAIAIRSEMPANRPDTDSLDIYLKL
LFEGDQLPGYGWVFPMGDGIFNIGLGYVNSYKNWQSINATQFLGEFLRTL
PREWELPPIEELKKNKSVRAWRLPMGFTAWPPWRPGVLFTGDSLGAGKPA
SGAGISKALESGLAAGECAVAALTNGGPDDFTNYALRMEAAWGREYRRGR
IMHKLIGQPKLAEAGVKLIDNAAFRDRMLKALYKKAQGPQHSF
315445197YP_004078076.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MRRGSRARAAEETGVKVDARSERWREHRKKVRSEIVDAAFRAIDRLGPEV
SLREIAEEAGTAKPKIYRHFTDKADLFQAIGQRMRDMLWSAIFPSIDIST
DPARTVVFRAVEQYVRLVDEHPNVVRFLMQGRFAEQTESAMRALNEGRDI
TLAMADMFNNELKDMQLDYAAFELAGFATFGAAASATDWWLGAERDSPRR
LPSEKFVDYLTKIMVGSINGTCEVLGVKIDPDVPLHEGVTRREQVA
315445196YP_004078075.1 hypothetical protein Mspyr1_36320 [Mycobacterium gilvum Spyr1]MSAALPQPTISGMNTHSTPRAAAAAVTAHPVLPDGDDERFVGFGIMGLPF
ASGHYLALRQFPATTFAPAYTSVWHRDPSCTWTFYATTPGQQSCARYFSS
ATPNDPVQCDIGVTWDSEWDVRIEIPHLLRWDVQLENTWATRTMTSLGGR
LPQAAWTSKSALSLISRVAGPVLGAGDIRLTGTAANGQHYMVAPTTVWAV
GASRAIVDGKDLGPTGPLMRQARLGDFRCPQRGIGVIGSGHFENYDAERH
LAAERTVAFG
315445195YP_004078074.1 HD-GYP domain-containing protein [Mycobacterium gilvum Spyr1]MAPPAQPPVRTPSRAELLAALSIAIDLGLGQPAEHMLRSAVIATRIADRL
GLDRAERDCTYYTALIMWIGCHADSHEYARWFGDDIAVRRDSYLVDWSGL
PYLRFLMANTGRGQPVLRRLSVLATLLADARGQIAELIHSHCSSAGILAD
RLGLSADVQTVLGYTFERFDGGGLPGGVGGDAIPIPMRVAQLADTAEVHH
RTFGVEGAVAMARSRSGGQFDPRVVDAFLADADAILEPPGDAWSAALRED
PHYGTGLADGELDELLVALGDFVDLKCPFTLGHSRAVAELAAGAAALMGM
DAGGVDLVRRAGHVHDVGRIGVSNQVWSKPSTLTTGEMERVRLHPYLTVR
ILSQVGGLDAVARVAGNHHECLDGSGYPRGLPAAALSVPDRVLAAAVAYR
SAVEPRPYRVALSPAAAATRLRDRVREGHLDELAVDAVLSAAGHAARRVS
ARPGGLTPREIEVLCLVARGASNKEIAATLGISGKTARNHVERTYAKIGA
TNRIGASMFALGHGLITPA
315445194YP_004078073.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MTVAESADTTAPPQTPVRTRTLIIGSGFSGLGMAIELQRRGVDFLILEKS
DEIGGTWRDNTYPGCACDIPSHMYSFSFEPKADWSHMWSFQPEIQEYLLG
VTAKYGLRRYIEFGAHVDRAHWDDAEMRWHVFTKDGREFIAQFLVSGAGG
LHIPLIPEFEGYDDFLASGRAAFHSAQWDHSVDIAGKKVAVIGTGASAIQ
IVPEIVEDVAELQLYQRTPAWVMPRPNNPIPEGMQRAFATVPGTRAAMRA
GIYWIHETVGFAMTKQPKLLKIGELLGKWNIRRSVKDPVLRRKLTPDYRA
GCKRILNSDTYYRGIADPRTEVITDRIARFTARGIVTADEHGRETEREAD
VVVFATGFHVTDSYTYVDIKGPGGEDLVDRWNREGISALRGITVAGMPNL
FFLLGPNTALGHNSVVFMIESQIRYAAKAIAAVEKKGVQCLTPTREAQDA
YNDELQDDLRGTVWSTGGCRSWYLDEHGVNRTLWSGMTWQYWLATRRFKE
SEYTFG
315445193YP_004078072.1 ribonucleoside-diphosphate reductase class Ib beta subunit [MycobacMKLIDRVSAINWNRLQDDKDAEVWDRLTGNFWLPEKVPVSNDIPSWNTLT
AHEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMES
VHARSYSNIFSTLCSTSEIDDAFRWSEENPNLQRKAEIVMQYYKGDEPLK
RKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYI
GYKFQKGLALADDATRQELKDYTYELLFELYDNEVEYTQDLYDEVGLTED
VKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSG
SGSSYVIGKAVVTEDEDWDF
315445192YP_004078071.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MSTAAPSVFEADLPTFTYGFTATPHDIFDDVRAAQSRAPIALGPLGPEIL
SYELARDILRDNRFRLPPGITLAAQGITSGPLYDKMAGSLLGLDGPPHVR
LRKLVSKAFTPRATARLQDTIHEVVNGLVDRVLDAGRCDVVTDIARSYPT
PIICALLGAPREDWPLFADWTEEVFKALNFQPEVTFDEAQIMRAWGELDT
YVDDMVAARQSNLTDDLLSELIRAESDGDRLNLDELRMLVAGFLMAGTDT
TRNQLAASVQVLCEHPDQWTKLRDHPELAMQAVEESMRHSPAASIVPRVA
GEDAEFGGYMFPAGTFILVNTFVANRDPAIYHDADRFDITREDVPPILTF
GGGAHYCLGANLARRELAEALVVLTRRLAAPVASDRPRGSHCSE
315445191YP_004078070.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MRSRGWAGSTPASDEEAIARILDAVDDVVAERGPAMRLADVARTLGVTRQ
TVYRYFPNADALLIASAMRAADGFIDQVAAHAAGIPDPVTAVVECVSFGV
QNLAGDPQLEGLMTRRQESGAVISLTSDTAITFCLSIFRRLDVDWSLHGF
DDTVLTELAEMTLRTVHSILVDPGEPPRDESELRRFVTRWLGPAILYPRI
TVLAGARR
315445190YP_004078069.1 hypothetical protein Mspyr1_36260 [Mycobacterium gilvum Spyr1]MTVTSMLHSILDWLRAGYPSGVPGPDRVPLLALLRATPLTEDQIKEVIAH
LTEPGAAATEDGAIDADEIAAFIKDVTQHDAGPENIARVAAKLAAAGWPL
TGVDPGATTAD
315445189YP_004078068.1 Zn-dependent alcohol dehydrogenase [Mycobacterium gilvum Spyr1]MSTVSAYAATSATEPLTKTTITRREVGPHDVAFDIHFAGICHSDVHTVRA
EWGQPAYPVVPGHEIAGIVTEVGPEVTRYKVGDRVGVGCFVDSCRECEEC
RAGEQQYCTGGGMVGTYNGVGRDGEPTQGGYSGAIVVDENYVLRIPDSIS
LDKAAPLLCAGITTYSPLHHWNAGPGKKIAVIGLGGLGHLAVKIAVAMGA
EVTVLSQSLKKMEDGLRLGATDYRATSDRDTFKDLKGTFDLIINTVSANL
DLADYLKLLKLDGTLVELGMPEHPMEVPAGALIFGRRSIAGSLIGGIAET
QEMLDFCAEHDVTPEIEVVAPDYINEAYERMLASDVRYRFVIDTASLR
315445188YP_004078067.1 ABC-type Fe3+-hydroxamate transporter periplasmic protein [MycobactMAGRAARRTLTCRDAGECYGLRVLFTGAQAVRRVARSTGLAAVGTAVVVF
AAAGCGASGGDGAPEGARSPVETTVTRIAGAGVLGNDRRPDESCAPEPAR
LDDGPPDREVRNADAHGVTPPIPEVTTVRADPQRIVVLSGDQLDALCALG
LQSRIVAAALPDGSDVQPSYLGQLIHDLPGAGTRSDPDLEAIRGAEPDLI
LGSVALTPEEHPELSEIAPTVFEGPAGAAWKDNLRTVGAATGRAAAADAL
IEDFDRAADRTGIDNDATHFQASVVQFTDTTMRVFGVDSFAGSVLADVGV
DRPATQRFTDKPYIEVGITDEDLGDSPDLSLADGDLIYVSFATAQARDRA
PKVLESDAWRRLSATRDDRVFAVNNEVWQGDQGPNGIVAARGILADLRWV
NSPIN
315445187YP_004078066.1 cytochrome C oxidase subunit I [Mycobacterium gilvum Spyr1]MVAEAPPIGELEARRPFPERIGPKGNLIYKLITTTDHKLIGIMYCVACFA
FFLIGGLMALFMRTELALPGLQFLSNEQFNQLFTMHGTVMLLFYATPIVF
GFANLVLPLQIGAPDVAFPRLNAFSFWLFLFGALIATAGFITPGGAADFG
WTAYSPLTDAIHSPGAGADLWIMGLAVGGLGTILGGVNMITTVVCMRAPG
MTMFRMPIFTWNILVTSILVLLAFPILTAALFGLAADRHLGAHVYDPANG
GVLLWQHLFWFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLIYAT
LGIAALSVAVWAHHMYATGAVLLPFFSFMTFLIAVPTGIKFFNWIGTMWK
GQLTFETPMLFSVGFILTFLLGGLSGVLLASPPLDFHVTDSYFVIAHFHY
VLFGTIVFATYAGIYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLVQH
WLGDEGMPRRYADYLPSDGFTTLNIVSTIGAFILGLSTLPFLWNVFKSWR
YGEVVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHM
IDRMRREAHVGRAHGPEDGDVTRNEENVRT
315445186YP_004078065.1 phosphoserine phosphatase SerB [Mycobacterium gilvum Spyr1]MVDLSGSSVLITVTGRDQPGVTSALFEVLSRYGVTLLNVEQVVIRNRLTL
GVLVAAAPDVAAGAQFREDVEAAIHGVGLEVTIEGSNGLPVMQVPSTHTI
VVLGRPITAEAFGVVAREVAELGVNIDFIRGVSDYPVTGLELRVSVPNGV
YGDLQRVLARLSAEEAVDIAVEDYSLARRAKRLIVFDVDSTLIQGEVIEM
LAAHAGAEAAVAEVTEAAMRGELDFAESLHRRVATLAGLPAGVVDEVAAT
LELTPGARTTIRTLRRLGYHCGVVSGGFRQVIQPLADDLMLDYVAANHLE
IVDGKLTGRVIGPVIDRAAKAKALRDFAAQVGVPMQQTVAVGDGANDIDM
LSAAGLGVAFNAKPALREVADASLNHPYLDTVLFILGITRGEIEAADALD
GVVRRVDIPD
315445185YP_004078064.1 GntR family transcriptional regulator [Mycobacterium gilvum Spyr1]MTEALATRSLNVDLLARELGNWRTSSRSGPAYHGLADAIRLLIVDGRLPV
GARIPSERALSEALRVSRTTVTAAYTQLREDGYLNARRGARSTTALPLTP
TPALRPVTATANLAAATLAAPASVTARAFTEAADMVAPYLQEIGIELTGV
PPLRAAIAERYCARGLPTDVDEIMVTTGALHAISLILATYTQPDDRVLVE
QPTYHGALAAMASRGLRPVPVAMAPDGWELDAVEAAIRQLAPELAYLIPD
NQNPTGMTMPVGDRARLARIISETKTRTIIDETITDMWLDEQVPPPLATE
MTSRPDLVMTVGSMSKSFWGGLRIGWIRAERSTLATIATLRPAIDMGTPI
VEQLAAARLLAADEEVLPERRDILRSRRALLLRLLAEHLPEWQPVPGKGG
MSVWVRLPAPMSSALSAAASRMGLEIPPGPRFGVDGTLERFIRVPYTLPD
AQLVEAIELLARAWRSVTGLTAPEPATVVV
315445184YP_004078063.1 hypothetical protein Mspyr1_36200 [Mycobacterium gilvum Spyr1]MRLRRGAIRGAALLIGLCGYGLSMAMMVRAGLGLDPWDVFHQGLALRTGM
TIGTASALVGVAVLVAWIPLRNRPGIGTVANVIVIAVAVDVALWLMPAPT
SLPVRVAMMVAAVVLNAVSTVLYMGAGLGPGPRDGLMTGLVVRTGRPVRL
VRSAIEVSVLTVGWLLGGTVGVGTVLYAFGIGPLVQLFVQWTPDRVLAVS
GWAGVDSPRRDVEDDRNGQPAGIGVAGG
315445183YP_004078062.1 hypothetical protein Mspyr1_36190 [Mycobacterium gilvum Spyr1]MDNPPGSESLAAEAVGLGDGTHRAVLGIAGSPGAGKSTLVELLAARIRQM
RGPGWVAHVPMDGFHLADAQLRRLGLLDRKGAPETFDAVGYAHALHRIRT
DVDSDVYVPGFDRDLEQPLAAALVVPASARLVLTEGNYLLLDQPAWRRVR
RSLDQTWFVSADDSLRVERLIARHVEFGKTAAAARAWVDTVDEANAALVT
STAASADRIVVNGTRGWSFGACLR
315445182YP_004078061.1 ABC-type molybdenum transporter- ATPase component/photorepair proteMPVEEVEAADPDLLIDFAEVTLRRNGRVLVGPVTWAVELDERWVVIGPNG
AGKTSLLRMAAAMEHPSSGTAYVLGERLGRVDMSELRSRVGLSSAALSQR
IPDDETVRDLVVSAGYAVLGRWREKYDDIDYVQAIDMLESVGAEHLADRT
YGTLSEGERKRVLIARSLMTDPELLLLDEPAAGLDLGGREELVARMSDLA
ADPDAPALVLVTHHVEEIPPGFTHCLILSEGAVVDSGLLTDVLTAENLST
AFGQSIALDVIDGRYFARRVRSRAAHRRRQ
315445181YP_004078060.1 NUDIX family protein [Mycobacterium gilvum Spyr1]MSELKTTTEPDPLVPRPAATVMLVRDTPEGIKIFLMRRHSAMDFVAGVMV
FPGGGVDDRDRNADVAWHGPDRHWWAERLGVDAELAEALVCAAARETFEE
SGVLFAGAADDPDLLVDDASVYRDQRAALENKSLSFGEFLRSEKLMLRAD
LLRPWANWVTPKEERTRRYDTYFFVGALPQGQRADGDNTETDKADWVTPQ
AALDDFAEGRSFLLPPTWTQLDALNGRTVAEVLAVERRIVAVEPSLAATK
GGNWEIEFFDGDRYNAARNRRAPQGYTDGAPLA
315445180YP_004078059.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium gilvum Spyr1MAPDDGERRIATLLLSRPPTNALTRQMNREIADAVAEVGGRDDICAVIVF
GGHEMFSVGADVPELKTLDTDEAGTADAVAAQAVAALAALPKPTVAAITG
YALGAGLTLALAADWRVSGDNAKFGATEILAGLAPAGDGAGRLAEAVGPS
RAKDLVFSGRFVDAREAHTLGLVDELVTPDGVYDAALAWAGRFREHPPEV
LAAAKAAFSAPRSVAGP
315445179YP_004078058.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTETKEPGAYPDVAVPAPTPHATKEQVEAAMHDTKLAQVLYHDWEAETYD
EKWSISYDQRCVDYARGRFDAAVPDEVQRELPYDRALELGCGTGFFLLNL
IQAGVARRGSVTDLSPGMVKVATRNGQSLGLDVDGRVADAEGIPYEDNTF
DLVVGHAVLHHIPDVELSLREVVRVLKPGGRFVFAGEPTTVGNRYARELS
TLTWYAATNVTKLPMLSDWRRPQAELDESSRAAALEAVVDLHTFDPADLE
RMAANAGAVEVHTASEEFTAAMLGWPIRTFEAAVPPGRLGWGWAKFAFGS
WTTLSWVDANVWRRIVPKGWFYNVMVTGVKPS
315445178YP_004078057.1 hypothetical protein Mspyr1_36140 [Mycobacterium gilvum Spyr1]MSEVARYDLTESSLISDIASARRRFGDRTAVLVETVKLRRKAAVKFVDAG
EWLFTDDALQQATAAPVAAHRARRLAGAVVHDATCSVGTELAALRNSAAL
VLGSDIDPVRVAMASHNLGLRGPGVALCRADALRPVSEGAVVLVDPARRS
GSRRRFDPRAYLPPLDTLLDVLRERDYVVKCAPGIDFAVVGELGFHGEIE
LVSLGGSVREACLWSSGFAADGVRRRATMLDTGEQVTDTDPGECPVAPAG
RWIVDPDGAVVRAGLVRHYAARHGLWQLDPDIAYLSGDRLPDGVRGFEVL
DQVAFSERHLRQALSALDAGALEILVRGLDVDPDALRARLRPRGVAQISV
VVTRIGSGAASRATAFLCRPSR
315445177YP_004078056.1 hypothetical protein Mspyr1_36130 [Mycobacterium gilvum Spyr1]MRFLAAALTVAAVSASLAAGPAALAQPAPPATPSACVALGGTVDADDMCR
VQVENPTYRLDYSFPADYPDQQALTAYLTQTRDGFVNVAGMPGSWNLPYV
LDGRGTGYRTGPDDGGTRSVVFEMYENVGGAHPQTWFKSFNWDVAKKAPI
TFDTLFKPGSEPLAVIFPIVRSDISRQLGIEAPITTADGLDPAKYTEFAI
TDDAVIFYFGQGEIMAGAGGALQATIPRSAIASMLALEPTEVTP
315445176YP_004078055.1 amino acid carrier protein [Mycobacterium gilvum Spyr1]MSEFLSTLNGLVWHETLVYLCLAAGVYFSARSRFVQVRQIPEMVRLMIRG
EKSPSGVSSFQALTMSLAGRVGTGNIAGVATAIAFGGPGALFWMWMVAFL
GASTSFVECTLGQIYKDRDKLTGEYRGGPAYYLSTALSHTAAAGAMKVYG
YVFAAVTLLAMGLLLPSVQSNSMASAMNSAWGFSKWWVAVGTVIVLAFVI
IGGVKRIATFASVVVPFMAVVYIVLALIIVLMNASEIPAIISLIFSSAFG
LDSAFGAIIGAAVMWGVKRGIYSNEAGQGTGPHAAAAAEVSHPAKQGLVQ
AFAVYIDTLFICSATGFLILSTGAYRVFEGESAEGAVLSEGGNFLPADAE
VGPAFAQAGFDTLWSGAGSSFIAISLAFFCITTIIAYYYMAETNLRFLLG
GSAIRQMPLVGGTVGTNITMLLQALILVSVTLGAVSTASEAWTLGDIGVG
LMAWLNIIGIIILQQPAYTALRDYERQKKAGLDPTFDPIALGIRNATFWE
NYDPVTGRDKLPTTTA
315445175YP_004078054.1 WD40-like repeat protein [Mycobacterium gilvum Spyr1]MLRRIIVVAWTTLVAGVLAGCGTTDSWVDSRAATGWSAQYADAANSSSTP
TRGTDTLQLEWGRSVKGSLAAQAALGSGNYLAVNAQTEGGCSLMVWEVDN
RARQRWCTRLVQGGGIASPLFDGFDNLYIGQPGLLQSFPTTQWVRWRKPV
IGLPLTARLVAPGRVLAVTHLGQVLVFDAHRGTVTGNSLDLVAGLDPRDS
ERGLADCRQARPECPIAAAPAYSESNGMVVLTLWEPGADKPVLVGLRYQQ
GQTPQLTREWTSDAVGGGPLASPVLSHDGATVYVNGRDERLWAINTADGS
AKWSVPLSYLAQTPPSVTPDGLVIAGGGPGSRLVAIRDTADDGEELWTRD
DVAPLTTSSLAGLGYAVVRDGDGDSAGLALTIFTLGDGSTVNTYPLPNAS
GWPVGVSIGHDGRVVTATSDGQVYGFAPA
315445174YP_004078053.1 acetyltransferase [Mycobacterium gilvum Spyr1]MTTMWGAPLHKRWRGSRLRDPRQARFLTLASLKWVLKNRAFTPWYLVRYF
RLLKFKLANPHIITRGMVFLGKDVEIQATPELSQMEIGRWVHIGDKNTIR
CHEGSLRIGDKVVLGRDNVINTYLDIELGDSVLMADWCYICDFDHRMDSI
ELPIKDQGIVKGPVRIGPDTWVGVKVSVLRNTSIGRGCVLGSHAVVRGDI
PDYSIAVGAPAKVVKNRKLSWETSAAERAELAAALADIERKKAAR
315445173YP_004078052.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium gilvum Spyr1]MSSRKLQTISYPASGAHPYRRDEPPLAPFVIVLFGATGDLAKRKLLPGMA
YLDQSELAPHIQVVGTSLEDLTDDEFRALAREAVDAHGTHKLTDEQWENF
AKILTYVPQSAGPDALAAAVSEAESRLLAGYGSSDAGEVQRLHYLSVPPD
AARAVITMLSEADLVRRSRVVMEKPFGTDLESAVGLNKFVHETFKERHIF
RIDHFLGKEAAQNILAFRFANGLFEPIWNRNFIDHIQIDIPETLGLDERA
GFYESTGAYKDMVVTHLFQVMAFVVMEPPTALEPRAISEEKNKVFRSMLP
IDCSTVVRGQFSGYRELDGVARDSDTETFIALKVGIDNWRWAGVPIYLRT
GKRMAEGQRIISIAFKEAPRTMFPAGSGVGSQGPDHLTFDLADASKVSLS
FYGKRPGPGMKLEKMSMQFSTQETEQSNDVLEAYERLILDAMRGDHTLFT
TAEGIESLWERSTDLLVDPPPVKMYQPGTWGPNSIHQLIGPNAWRLPFER
EWRERRD
315445172YP_004078051.1 glycosyltransferase [Mycobacterium gilvum Spyr1]MKMKILLVSWEYPPVVIGGLGRHVHHLATELVAAGHEVVVLSRRPTGTDP
QTHPTTDETHEGVRVIAAAEDPHEFGFGTDMMAWVLAMGHSMIRAGFGLD
GWRPDIVHAHDWLVAHPAVALAQFFDVPLVSTIHATEAGRHSGWVSGSVS
RQVHALESWLVRDSDSLITCSASMRDEISALFGPELAEISVIPNGIDTDG
WPFAARRAHSGPAELLYFGRLEYEKGVHDAIAALPKVRRTHPGTTLTIAG
DGTQLGFLTEQARRHKVLKATKFVGRVDHSQLLTLLHRADVAVLPSHYEP
FGIVALEAAATGTPLVTSTAGGLGEAVIDGVTGMSYPPSDVTALAAAIRA
VLDAPAAAQERATAARARLTSDFAWHTVAAETAQVYLAAKRAERRPQPRR
TIVERPLPDR
315445171YP_004078050.1 hypothetical protein Mspyr1_36070 [Mycobacterium gilvum Spyr1]MSHADVASGDEKNSVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAA
YLPLIRVLRTLAAENRRHLITLGITPVVAAQLDDPYCLQGMNHWLANWQL
RALEASTTRSSEPGAPPASQPQALRQFGVREYEEAERELGEFDALWRHGA
SPLFRELLDNQTIELLGGPLAHPFQPLLNPRLREFALREGLADAHTRFAH
RPSGIWAPECAYAPGMEIGYDDAGVTHFMVDGPSLRGDTSLGRPVGGSDV
VAFGRDLQVSYRVWSPKSGYPGHSAYRDFHTYDHATGLKPARVTGRNVPS
DAKAPYDPARADAAVDVHVADFVDTVRRRLAAESERIGRPAHVVAAFDTE
LFGHWWYEGPVWLERVLRALPAAGVRVGTLSDAIAEGYVGAPVDLPPSSW
GSGKDWQVWSGDQVADLVQLNSEVVDAALSTVDKALAHGAALGSPTPRDF
VADQILRETLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREISDALAS
GRREHAQQLADGWNRADGLFGALDARRLPAT
315445170YP_004078049.1 methyltransferase family protein [Mycobacterium gilvum Spyr1]MSASVTNGDPGLPLTGERTIPGLAEENYWFRRHEVVYRRLVERCRDRDVL
EAGSGEGYGADLIAEVARSVIGLDYDESAVAHVRARYPRVDMRHGNLAEL
PLESGSVDVVVNFQVIEHLWDQGQFVAECARVLRPGGVLLMSTPNRITFS
PGLDAPVNPFHTRELDAAELTELIESAGFAMETMLGVFHGPPLVELDARH
GGSIIEAQIARAVADAPWPPDLLADVESVTIDHFDLTAGSDTTPGRHIDD
SLDLVAIAVRP
315445169YP_004078048.1 electron transfer flavoprotein subunit beta [Mycobacterium gilvum SMTNIVVLIKQVPDTWSERKLSEGDWTLDREAADAVLDEINERAVEEALLI
KEREGGDSTVTVLTAGPERATEAIRKALSMGADKAVHLLDDGLHGSDMVQ
TGWALARALGTIEGTELVIAGNEATDGTGGAVPAIIAEYLGLPQLTHVRK
LSVENGKVTGERETDDGLFTLEASLPAVVSVNEKINEPRFPSFKGIMAAK
KKEVTTLTLAEIGVEADEVGVANAGSKVLSSTPKPPKTAGEKVTDEGEGG
KKVAEYLVAQKII
315445168YP_004078047.1 electron transfer flavoprotein subunit alpha [Mycobacterium gilvum MAEVLVLVEHAEGALKKVTAELITAAKKLGEPSAVVVGKPGTSEGLVDGL
KSAGAAKIYVAESDDAENYLITPYVDVLAALAESATSAGVVLAASADGKE
IAGRLAARIGSGILSDVVEVKEGGAGVHSIFGGAYTVEAEAVGDTPVITV
RPGAIEAEPSDGAGEVVNVEVPAPAENATKITSREPAVAGDRPELTEASV
VVAGGRGVGSADNFTIVEELADSLGAAVGASRAAVDSGYYPGQFQVGQTG
KTVSPQLYIALGISGAIQHRAGMQTSKTIIAVNKDEEAPIFEIADLGIVG
DLFKVTPQLTEAVKARKG
315445167YP_004078046.1 ornithine-acyl(acyl carrier protein) N-acyltransferase [MycobacteriMNASSVLIPSDHSVTAGSVPRYSMLLCTDPASIEAAQRLRYDVFTSEPGY
TLNRGTLHRSAAPDGLDADRFDEFCDHLLVRDDDTGQLVGCYRMLPPPGA
IAAGGLYTATEFDISALDALRPSLVEMGRAVVRDGHRNGAVVLLMWTGIL
AYLDRSGYDYVTGCVSVPVADPDGLTPPGSRLRGVRDLVRRRNAAPPEYT
VRPYRPVVIDGHHLDDIAAPPRVKVPALLRGYLRLGAQVCGEPAHDPDFG
VGDFPALLDKRRADVRYLTRLRSAAAAAADVTR
315445166YP_004078045.1 lyso-ornithine lipid acyltransferase [Mycobacterium gilvum Spyr1]MTVTDGHAWLQAATCGAGCVDAGADGPGRRWVVALRTGVRVSAALTLFTG
VWLLALPLPGRSHLQRGYCRLMLRSLGVRMSVAGGPVRNLRGVLVVSGHV
SWLDVFAIGTVLPGSFVARADLVTWPALGPVVRLMKVIPIDRARLRRLPT
VVASIADRLRAGQTVVAFPEGTTWCGLGYGRFRPAMFQAAVDAGRPVQPL
RVSYRHRDGRPSTVPAFVGDDSLLDSITRVITARRTVCHISVESLQLPGR
DRRELAARCESAVRGHSAPVPRATAAACGGGHALVA
315445165YP_004078044.1 cysteine desulfurase [Mycobacterium gilvum Spyr1]MSASAAAPRPVYLDHAATTPMRPAAIEAMTAALATVGNASSLHGSGRTAR
RRLEESRETLAQLLGARPSEVIFTAGGTESDNLAVKGIYWARRDAEPQRR
RIVTTPVEHHAVLDAVQWLADHEGAEVTWLPVDQYGAVNPADLRVALSET
ADVALVSVMWANNEVGTIQPIAELAAIATEFGVPMHSDAIQAIGQLPVDF
GASGLSAMSVAAHKFGGPAGVGALLLRRDTACVPQLHGGGQERDVRSGTQ
DVAGVIGMAVAARDAADTMEPVIARVRDLRDRLVAGVLESIDDVDVNGAP
GPGRLPGNAHFTFRGCEGDSLLMLLDAKGIECSTGSACTAGVAQPSHVLT
AMGVDPASARGSLRLSLGHTSTEADIEAVLEVLPAAVDRARQAALASSGR
H
315445164YP_004078043.1 tRNA (5-methyl aminomethyl-2-thiouridylate)-methyltransferase [MycoMRVLVAMSGGVDSSVAAARMVAAGHDVVGVHLALSSAPGTLRTGSRGCCS
KEDAGDARRVADVLGIPFYVWDFADRFKEDVIDDFVESYARGETPNPCVR
CNERIKFSALASRALALGFDALATGHYARLADGRLRRAVDHDKDQSYVLA
VLTAEQLRHAVFPIGDTPKAQIREEAARLGLAVADKADSHDICFIPSGDT
KAFLGARIGVRRGNVVDAAGTVLAEHDGVHGFTIGQRKGLGIPGPGPDGS
PRYVTGIDAQTGTVHVGDVADLEVTSLQGDAPVFTSGVAPTGPLECVVQV
RAHGGVADAVAELRGDTLEVSLRTPLRGVAPGQTLVLYRRDPAGDEVLAS
ATIRATH
315445163YP_004078042.1 hypothetical protein Mspyr1_35990 [Mycobacterium gilvum Spyr1]MTGRAWAPLLCATAIMAVGCTQIVGGDAVRTVRAIDEDSRSPVDVDTVLL
ESAQMQAVTGAGRDLTAIPGTESKVPVDVPVDMALPRMAKDLPPQCGWVF
AETQVFGSEVEEFRKTSYQNPPRGGLISQAAAGYRDAATAQRAFAAIVEQ
IEGCGTTDSGAAMVGMVTTTPDSVQTRPGNCGRDYRVKSVVLVEVTFCAF
PDSVPEIVMTNILANVPDR
315445162YP_004078041.1 cobalamin-independent methionine synthase [Mycobacterium gilvum SpyMSVFATATGVGSWPGTSAKEAAEVVVGELHRLPHLVELPARGLGADMIGR
AGGLLVDIWIDTVPRGYRIASGRSSVTRRAVSLLEEDLDALEEAWEKAGL
RGGGRAVKVQAPGPVTLAAQLELPGGHRAITDPGAVRDLTASLAEGVAAH
RAALARRLESPVVVQFDEPTLPAALAGRLTGVTSLSPVHPVDDAVATALL
DDCVQTVGGDVVVHCCASGVPWKLLQRSAVHAVSVDVDTLSADDLDGVGE
FVDSGRTVVLGAVPTAAPAARPSAEQIAATVAAVTDRLGFARAVLRDRVG
ITPACGLAGATTAWARSAIELAQRAADGLADDPEAF
315445161YP_004078040.1 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protMNVTGWCSLSGKIPGRGPSPGDAKDDEVARLLALESFDILDTPPEESFDG
LTALAAYVCDVPMALIGFLDAERQWLKSRQGVGHSEIARELSFCASTMGD
GDTLIEIPDTRLDSRLAGHPMVTGDPHLRFYAGMPIRTAEGHALGTICVM
DVEPRTLSDAQRSHLRTLADQVMNLLDLRRRARQYAVEMTRRLEIDEALR
QQQRLLSGVLDHTDVLVYTKDVEGRFVMANNAVQHVTQADRSMIGATDYD
FFDATVADSYRRNDRRIMETREWQVFSEDVVHPDGSVHTYRSTKFPLISD
SGEVLGVGGLSTDVTELAAARAAHEAAEERWRALVEQSPAPVIVVDAEGA
LAYVNPEGLALLGVARGADVSLLPAEDFIPPQLRRATQKLLDETMAGTRV
VRGERGVLRRRDGTEITVEINATVVSHSGERSVQLEIRDVSEVAAAHAAL
EHSASTDPLTGVLNRKAWDARVATLLPEVSDTSPMTIAVIDLDNFKTYND
TRGHTAGDALLQQFAGAAAACLGADDVFARWGGEEFIVALPGADPDRAEP
ILDRLRGHVPSEQTCSIGYTGHVPPEALTDTVIRADKALYQAKRRGKNRI
ARL
315445160YP_004078039.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MTFSSPFPEVDIPTASVYDYLFSGLSDPDDPVLDRVALIDAKSGRQTTYR
EMVARIDSFAGALAARGVGVGDVVGLLAPNSSAFAVAFHGILRAGATATT
INALFTAKDIAKQLTDSRARTLITVTPLLAQAREGAALAGLSDEDVIVLD
GPGRDGSGDGAGHPNAADILAPGTPAPQVNFAPSSHLAVLPYSSGTTGNP
KGVMLTHRNLVANVAQIRPLHGMEPDDVVLAVLPFFHIYGMTVLLNAALH
ARARLVIMPSFDLGDFLGNIAEHRCTIAFIAPPVAVALAKHPLVDDHDLS
SLQVVMSGAAPLDADLGHAVAKRLDCKVVQGYGMSELSPVSHITPFDGGR
LNMHDDAPLASVGWTVSNAASKLVDPETGAEIEIPDEGLSKTGELWFKGP
NVMAGYLNNEEATKETIDEDGWLHTGDLAQIDDRGLVYIVDRLKELIKYK
GYQVPPAELEAVLLSHPDIADAAVVGVRDEEGEEVPKAFVVTQANSELTE
TDVIEFVAGQVAPYKKVRKVEFIDAIPKSASGKILRKDLRTG
315445159YP_004078038.1 hypothetical protein Mspyr1_35950 [Mycobacterium gilvum Spyr1]MAHPIMFRDDDMGLAEVREIALGFPAATEKISWGRPVFCAPKMFAIYGGS
VKGADKGAYVQYPHSVLVKVEESERRALEQDRRFFFPAYLGPFGWLGLDL
TAAAAVDWTEITELIDASYRMVAAKKLIRQLGER
315445158YP_004078037.1 NAD-dependent DNA ligase [Mycobacterium gilvum Spyr1]MLAEQAHDALDPDLRRSWQELADEVREHQFRYYIRDAPIITDAEFDQLLR
RLQALEDEYPELRTPDSPTQLVGGAGFATDFTAAEHLERMLSLDNVFDLE
ELAAWAARIRTEIGADAQYLCELKIDGVALALVYRDGRLERAATRGDGRT
GEDVTLNARTIEDIPERLSGTNEFPLPTVLEVRGEVFFRVADFEDLNAGL
VAEGKPPFANPRNSAAGSLRQKNPAVTARRRLRMICHGLGHVESSGGSPF
PTLHDAYRALKAWGLPVSDHTAQVTGLDAVTERIAYWGEHRHDVEHEIDG
VVVKVDAVALQRRLGATSRAPRWAVAYKYPPEEAQTRLLDIRVNVGRTGR
VTPFAYMEPVKVAGSTVGLATLHNASEVKRKGVLIGDTVVIRKAGDVIPE
VLGPVVDLRDGSEREFVFPTHCPECGSELAPAKEGDADIRCPNTRSCPAQ
LRERVFHVAGRGAFDIEGLGYEAATALLQSGVIADEGDLFGLTADDLLRT
ELFTTKAGELSANGKRLLANLGKAKAQPLWRVLVALSIRHVGPTAARALA
TEFGSLEAIETASEEQLAGTEGVGPTIAAAVIDWFTVDWHRAIVDKWREA
GVRMADERDASIERTLEGLSIVVTGSLAGFSRDEAKEAIIARGGKAAGSV
SKKTAYVVAGDAPGSKYDKAIELGVPVLDEDGFRRLLAEGPERDAEDGEP
G
315445157YP_004078036.1 ACT domain-containing protein [Mycobacterium gilvum Spyr1]MLPVPSYLLRVELEDRPGSLGSLAVALGSVGADILSLDVVERAAGYAIDD
LVVELPPGAMPDMLITAAENLNGVYVDSIRPHTGLLDAHRELELIDHVAA
ADGKLQRLQVLVDEAPKVLRVGWCTVVTLTDSGPQRLVGSSGAPETQAAE
TPWLPLARAEALDASAQWVPQVWRDMDTTLAAAPLSDPSTAVVLGRPGGP
AFRPSEVARLGYLAGIVTTIIG
315445156YP_004078035.1 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C [MycobacMVVSQISRDEVAHLARLSRLALTDGELDSFAGQLDAILGHVSQIQAVDVT
GVEATDNPLVRRAEAGGVVNVFRPDEVRPSLSQQQALAEAPNDAEGRFAV
PRILGEPE
315445155YP_004078034.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Mycobacterium giMSELIKLDAATLADKISSKEVSSAEVTQAFLDQIAATDGDYHAFLHVGAE
QALAAAQTVDRAVAAGEHLPSPLAGVPLALKDVFTTTDMPTTCGSKVLEG
WTSPYDATVTAKLRSAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWDTE
RVPGGSGGGSAAALAAFQAPLAIGTDTGGSIRQPAALTATVGVKPTYGTV
SRYGLVACASSLDQGGPCARTVLDTALLHQVIAGHDPLDSTSVEAPVPDV
VAAARTGAGGDLTGVRIGVVKQLRSGEGYQAGVLASFNAAVDQLTALGAE
VTEVDCPHFDYSLPAYYLILPSEVSSNLAKFDGMRYGLRAGDDGTHSAEE
VMALTRAAGFGPEVKRRIMIGAYALSAGYYDAYYNQAQKVRTLIARDLDA
AYQKVDVLVSPATPTTAFRLGEKVDDPLSMYLFDLCTLPLNLAGHCGMSV
PSGLSADDNLPVGLQIMAPALADDRLYRVGAAYEAARGPLPTAL
315445154YP_004078033.1 6-phosphofructokinase [Mycobacterium gilvum Spyr1]MRIGVLTGGGDCPGLNAVIRAVVRTCDARYGSSVVGFLDGWRGLLEDRRV
QLKNDDRNDRLLAKGGTMLGTARTNPDKLRAGLDQIKQTLEDNGIDVLIP
IGGEGTLTAAHWLSEEGVPVVGVPKTIDNDIDCTDVTFGHDTALTIATEA
IDRLHSTAESHQRVMLVEVMGRHAGWIALNAGMASGAHMTLIPEQPFDVE
EVCRLVKQRFQRGDSHFICVVAEGAKPAEGSMQLRQGGMDEFGHEKFTGV
AAQLAIEVEKRIKKDVRVTVLGHVQRGGTPTAFDRVLATRFGVNAADAAH
AGEYGMMVSARGTEIGRVPLADAVRHLKLVPQTRYDDAAEFFG
315445153YP_004078032.1 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [MycobacMSVTTDELLDYDEVIAAYEPVLGLEVHVELSTATKMFCGCANRFGGEPNT
QVCPVCLGLPGSLPVLNQSAVESAIRIGLALNCEIAPWGRFARKNYFYPD
QPKNYQISQYDEPIAINGHLDVPLDDGTTWRIEIERAHMEEDTGKLTHLG
SDTGRIAGATTSLADYNRSGVPLIEIVTRPVEGAGARAPEIARAYVTALR
DLLRALDVSDVRMDQGSMRCDSNVSLKPIGQVEFGTRTETKNVNSLKSVE
VAVRYEMRRQAAVLKAGGSIVQETRHFHEDGYTSPGRSKETAQDYRYFPE
PDLEPVAPSAELVEQLRATIPELPWLSRKRIQQEWGIGDEVMRDLVNIGA
LDLIAATVTHGASSEAARAWWGNFLVQKANEKGVELDALPITPAQVAAVV
KLVDDGKLSNKLARQVVEGVLAGEGDPEQVMNDRGLVVVRDDSLIQAAID
EALAAHPDVADKIRGGKVAAAGAIVGAVMKATKGQADAARVRELVMAACT
315445152YP_004078031.1 signal transduction histidine kinase [Mycobacterium gilvum Spyr1]MTRIQDLVYRVLDHPLRWLSLRSIVILSQLGVTILVLTLGVWVWVGVTND
QYDQLDRRLDSLSSLGDVNTLLRSAQEGVGPEPTEGGLVRTARWAGSTVS
IPADIVLPDLDSGYADATIDGVEYRVRTIKTGNASIALGAPMAETQARID
SLHWRVFWICSGVILTTMLVGWVIGLIMVNPFRLLAQQARAINAQSNPDE
VQVRGVWEAVEISEAVEGMLARIGDEQQRTRAALESARDFAAVASHELRT
PLTAMRTNLEVLATLDLGAEQRQEVLGDVIRTQSRIEATLTALERLAQGE
LTTVDDFVPVDVAELLDRAAHDAMHNYPGVEVTLASSTTVLMLGMPAGLR
LVIDNAIANAVKHGGATQIRLSVVSSHTGVEIAVDDNGSGVPEEERAEVF
ARFHRGTTASRSGSGLGLALVAQQAEIHGGTASLEVSPQGGTRLMLRLPG
SGPS
315445151YP_004078030.1 glucose/sorbosone dehydrogenase [Mycobacterium gilvum Spyr1]MSERRSSGAFVVLLSAALLAGAGCARFDSAQSQPFTTEPQLAPGPTSTPP
PPPPLPAKPFPKECPAPGVMQGCLESTSGLIMLPDSQSALVAERTTGAVK
QVSVRAEPIQKMMIPVDGSGDGGLMDIVLSPTYTQDRLMYAYISTPTDNR
VVRIAEGDPPKPILTGIPKGTTGNTGSLIFTSPTTLVVQTGDAGNPAQAA
DPGSMAGKMLRIEQPTTVNQAPTTTALSGLGPGGGMCIDPSDESLYVTDR
TPTADRLQRITKDSQVSTVWTWPDRPGVAGCAALDGTVLLNLVDTKQTVA
VRMAPETGAVTGDPEVVRQDQHGHAWALEVSPDGNVWGGTVNKTSGDAMK
LDDVVFPLFPQGGGFPRANDEKT
315445150YP_004078029.1 hypothetical protein Mspyr1_35860 [Mycobacterium gilvum Spyr1]MLNAPSEFPARDRSALTLAVVTSPLDPRPWQRPDDSAGRPASASLVDPED
DLPSANYGGDFETTAIPRYDSAKPAEAQQPFALLNDPEPLPYVQPSTGLA
PGAYGSAAAPTEVGVDPDRHSGDRRGTQDLGLLLLRVAVGALLIGHGLQK
VFGLWGGPGLGGFRDQLTDVGFRNADILSYVAAGGQIAAGVLLVLGLFTP
IAAAGALGYLVTATLAEATLAHNDARLSSFLTDGHEYQIVLLVAVAAIIL
VGPGRYGLDAGRGWARRPFVGSIAALILGAGAGVAIWVLLNGANPLG
315445149YP_004078028.1 hypothetical protein Mspyr1_35850 [Mycobacterium gilvum Spyr1]MAHVAVGFLTVALLAVVLAGPIWFLLLFLIPAGVSYAVARYRTVADRDTV
TARTLFGKQTVRWEDIHGLRFGRQAWAVARRRDGSELTLPGVTFATLPVL
TAASGGRVPNPYE
315445148YP_004078027.1 acetolactate synthase- large subunit [Mycobacterium gilvum Spyr1]MSAPTKRPPEQSETPTNGTAAAAKYNSATTQAQPNVVAPHQLTGAQAVIR
SLEELGVDVIFGIPGGAVLPVYDPLFDSQKLRHVLVRHEQGGGHAASGYA
HATGRVGVCMATSGPGATNLVTPLADAYMDSIPMVAITGQVGRALIGTDA
FQEADISGITMPVTKHNFLVRDGDDIARVIAEAFHIAASGRPGPVLVDIP
KDVLQGQCTFAWPPQFELPGYKPNTKPHNRQIREAAKLIAESRKPVLYVG
GGVIRGEASEQLLDLAELTGIPVVTTLMARGAFPDSHPQNLGMPGMHGTV
AAVAALQRSDLLIALGTRFDDRVTGKLDSFAPEAKVIHADIDPAEIGKNR
HADVPIVGDVKNVIADLIEVLRRDGQGAVELDAWWESLRGIQATFPLSYG
PQSDGSLSPEFVIETLGKMAGPDAVYVAGVGQHQMWAAQFISYEKPKTWL
NSGGLGTMGFAVPAAMGAKMGRPEAEVWAIDGDGCFQMTNQELATCAIEG
VPIKVALINNGNLGMVRQWQTLFYEERYSQTDLATHTRRIPDFVKLAEAL
GCVGLRCEREEDVADVIAQARAINDRPVVVEFVVGADAQVWPMVAAGTSN
DEIQAARGIRPLFDNEEGHA
315445147YP_004078026.1 acetolactate synthase small subunit [Mycobacterium gilvum Spyr1]MATTHTLSVLVEDKPGVLARVASLFSRRGYNIQSLAVGATEHKDLSRMTI
VVDVEESPLEQITKQLNKLINVIKIVEQDEEHSVSRELALIKVRTDATTR
GQVIEAVNLFRAKVVDVSTESLTVEATGTPEKIEALLRVLEPYGVREIVQ
SGVVSLSRGPRGISTK
315445146YP_004078025.1 ketol-acid reductoisomerase [Mycobacterium gilvum Spyr1]MAVEMFYDADADLSIIQGRKVAVIGYGSQGHAHSLSLRDSGVEVKVGLKE
GSKSRDKVTEQGLDVDTPAEVAKWADVIMLLAPDTAQAEIFTKDIEPNLE
DGNALFFGHGLNIHFGLIKPPANVTIGMVAPKGPGHLVRRQFVDGKGVPC
LIAVDQDPKGEGQALALSYAAAIGGARAGVIKTTFKDETETDLFGEQAVL
CGGTEELVKTGFDVMVEAGYEPELAYFEVLHELKLIVDLMYEGGIARMNY
SVSDTAEFGGYLSGPRVIDADTKKRMQDILKDIQDGTFVKRLVANVEGGN
KELEGLRKQNAEHPIEVTGKKLRDLMSWVDRPITETA
315445145YP_004078024.1 hypothetical protein Mspyr1_35810 [Mycobacterium gilvum Spyr1]MTNYTEITGSVRSVFMTGTPTPASALLTRAGGIRGLVYTALPVTTFAAGN
AIAGLMPALIAAVVAGALVMTVQLVRRESTRPAMFGFAGVAAGAGFALVT
GRAKDFYLPGIWMYLALAVLFTASVLARRPLIGVVWAWMTGRDDTWRRTR
RVRIAFDLVTLMMAAVSATRFAVQFYLYDTDQEGLLAVARIAMGWPVFLL
TSTLIYLAIRTAMRTLPRGVPE
315445144YP_004078023.1 phytoene dehydrogenase-like oxidoreductase [Mycobacterium gilvum SpMGSNGQVELTVVGSGPNGLAAAVICARAGVSVRVVEAQPTAGGGARTLPD
PEFSGVSHDICSAVHPLALASPFFAAFDLRARGVTLEVPEVSYGNPLPGR
RAAIGYLDIDRTCAELEDGEPWRRLLGPLAADCDGVVGLLLGDKRSIPPS
IPAALRVAPRLLAQGTPAWGTLLGEDARALFTGVAAHTISRMPSLVASGA
GLMLSTLAHAVGWPIPVGGSQAIPDALIADLRAHGGELVVGEEVSTPPSG
VVLYDTAPTALLDIYGDRLPSRYARTLRRYRYGPGVAKVDFVLSGEIPWR
DKRLASTPTLHMGGDRATMALAEKDIAEGRHAQWPMVLASLPHLADPGRI
DAAGRRPLWTYAHVPAGSTVDMAETITGVFERFAPGFRDLVVGVRSVPAA
RLADHNANLVGGDIGVGGNNMFSALTGPALRWNPWATPIPRTYLCSSATP
PGGGVHGMAGYYAARTVLRREFGIREMPPLAP
315445143YP_004078022.1 D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum Spyr1]MSLPVVLIADKLAQSTVEALGDQVEVRWVDGPDREKLLAAVADADALLVR
SATTVDAEVLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIH
SAAEHALALLLSTARQIPAADATLREHTWKRSAFSGTEIFGKTVGVVGLG
RIGQLVAQRLAAFGAHITAYDPYVSHARAAQLGIELLTLDELLSRADFIS
VHLPKTKETAGLIGTEALAKTKPGVIIVNAARGGLIDEQALADAITSGHV
RGAGLDVFSTEPCTDSPLFELPQVVVTPHLGASTVEAQDRAGTDVAASVK
LALAGEFVPDAVNVGGGAVGEEVAPWLDLVRKLGLLVGALSAELPTNLCV
QVRGELASEEVEVLRLSALRGLFSAVIEDQVTFVNAPALATERGVEASID
TESESPNHRSVVDVRAVAADGSTVNVSGTLTGPQLVEKIVQINGRNLDLR
AEGVNVIINYHDQPGALGKIGTLLGGANVNILAAQLSQDADGEGATIMLR
VDREVPADVLAGIGRDVNALTLEVVDLT
315445142YP_004078021.1 3-isopropylmalate dehydrogenase [Mycobacterium gilvum Spyr1]MKLAVIAGDGIGPEVIGEALRVLDAVVPGVEKTEYDLGARLYHRTGEVLP
DSVLDELKGHDAILLGAIGDPSMPSGVLERGLLLRIRFELDHHINLRPGR
LYPGVQSPLAGNPEIDFVVVREGTEGPYTGNGGAIRVGTPHEIATEVSVN
TAYGVRRVVQDAFKRAQQRRKHLTLVHKNNVLTNAGSLWWRTVQAVAAEY
PEVEVAYQHVDAATIHMVTDPGRFDVIVTDNLFGDIITDLAAAVCGGIGL
AASGNIDATLTNPSMFEPVHGSAPDIAGQGIADPTAAIMSVSLLLAHMAE
IDAAVRVDKAVAEHLATRGDEKLSTTQVGDRILGKL
315445141YP_004078020.1 hypothetical protein Mspyr1_35770 [Mycobacterium gilvum Spyr1]MADSLCFVGSWFFTTAAWMQLALSDRRVRFEWSSAFVQFGGTVLFNLSTG
AAVWAHAVTEERRYVWVPDVTGSIFFLVSGVLAMVSVAPVTGVLAFRSGA
WRAAAVNLAGCVAFGVSAVSAFVRGDGVTVDEWLANFGTFLGALCFLVAA
LMVLPRAVPSGPP
315445140YP_004078019.1 major facilitator superfamily transporter [Mycobacterium gilvum SpyMAPSSIGPTRRWLMLAIGLLTTLCANVFINGVAFLIPTLHDERGLDLAGA
ALMSSLPSLGMVFSEHGWSPESAGVLVMVAQIMGAAGRIGAGRWSDHYVR
RSGDLIASRLRPIRIIAAAAAASMALLALTDLVNSPLSIALMMVASVITV
SDNGLAFTLIAEYAGPFWSGRALGTQNTSQLFAQGVAPPLFGGLIAVAGY
PVAFAVCALLPVLAIPAVPLKVTVDR
315445139YP_004078018.1 2-keto-4-pentenoate hydratase [Mycobacterium gilvum Spyr1]MRLGRIASPDGVAFVAVEGPPDDPAAAVAREIAEHPFGTPTFTGRQWPLA
DVRLLAPILASKVVCMGKNYAAHIEEMGGGTFEDPIIFLKPNTAIIGPYT
PIQLPADADPVHFEGELAAVIGRPCKDVPASRAAENILGYTIANDVSARD
QQKKDGQWMRAKGHDTFCPVGPWIVTDIDPSDLEIRTEVNGELKQHSRTS
LMIHDIGAIIEWISSVMTLLPGDLILTGTPEGVGPLEHGDTVSITVEGIG
TLSNPVVRKGKS
315445138YP_004078017.1 glutamyl-tRNA synthetase [Mycobacterium gilvum Spyr1]MKVRVRFCPSPTGTPHVGLIRTALFNWAYARHTGGDFVFRIEDTDAQRDS
EESYLALLDALRWLGMDWDEGPEVGGPYAPYRQSQRRDLYLDVIRRLLAA
GEAYEAFSTAEEVEARHLAAGRNPKLGYDNFDRDLTEEQRAAFRAEGRQP
VVRLRMPDADMTWVDLVRGETTFPVGSVPDFALTRGSGDPLYTLVNPVDD
ALMKITHVLRGEDLLPSTPRQLALYAALIRIGVTDMTPQFAHLPSVLGEG
NKKLSKRDPQSNLFLHRERGFIPEGLLNYLALLGWSIADDRDIFSVQEMV
AAFDVADVNSNPARFDQKKADALNAEHIRRLDEAEFVRRLADYFSTHGYD
TGLDDARFAEAAALVQTRIVVLGDAWDLLKFLDESSFALDEKSAGKELKD
TAVPVLTAALAALKGVGEWTTAQIEDALKVALIDGLELKPRKAFGPVRVA
VTGSSISPPLFESLELLGRDRSLERLRAGRDHAAAAVTMDA
315445137YP_004078016.1 IclR family transcriptional regulator [Mycobacterium gilvum Spyr1]MRQNSGIGVLDKAITVVHAVAESPCGLADLCERTDLPRATAHRLAVGLEV
HRLLARDGDGLWRLGPALTELAGHVNDSLLAAGAVVLPRLRELTGESVQL
YRREGTSRICVAALEPPAGLRDTVPVGTRLSMTAGSGAKVLLAYADTHTQ
QAVLPNAKFTDRTLAEVRKRGWAQSAAEREPGVASVSAPVRDGRGAVIAA
VSVSGPIDRMGRRPGARWAADLVAAADALTRRL
315445136YP_004078015.1 3-isopropylmalate dehydratase large subunit [Mycobacterium gilvum SMAVANQPRTLAEKVWSDHVVVSGSGEGAAREPDLIYIDLHLVHEVTSPQA
FDGLRLAGRPVRRPDLTIATEDHNVPTVDIDKPIADPVSRTQVETLRRNC
EEFGIRLHPMGDVEQGIVHIIGPQLGLTQPGTTVVCGDSHTSTHGAFGAL
AMGIGTSEVEHVLATQTLPLRPFKTMAVNVDGELPPGVSAKDVILAVIAK
IGTGGGQGHVIEYRGSAIESLSMEGRMTICNMSIEAGARAGMIAPDETTF
EFLKGRPHAPQGADWDAAVEAWKLLRTDEGAQFDTEVYIDAASLSPFVTW
GTNPGQGVPLSDSVPDPEMIFDEGERSAVEKALAYMDLRPGTPMREIPVD
AVFVGSCTNGRIEDLRVVADVLRGRTVADDVRMLVVPGSMRVRAQAEAEG
LGEIFTAAGAEWRQAGCSMCLGMNPDQLAPGERCASTSNRNFEGRQGKGG
RTHLVSPAVAAATAVRGTLSSPADLTAEPTR
315445135YP_004078014.1 3-isopropylmalate dehydratase small subunit [Mycobacterium gilvum SMEAFRTHTGIGVPLRRSNVDTDQIIPAVYLKRVTRTGFEDGLFAAWRNDP
SFVLNQPPFDQGSVLVAGPDFGTGSSREHAVWALMDFGFRVVISSRFADI
FRGNAGKAGLLAAEVTQDDVELLWKVIEQHPGTEITVNLQDRSVTAGTVM
VPFTIDDYTAWRLLEGLDDIGLTLRKLDEIEDFETHRPSWKPRTLPA
315445134YP_004078013.1 nucleoid protein Hbs [Mycobacterium gilvum Spyr1]MNKAELIDVLTEKLGSDRRQATAAVENVVDTIVRAVHKGESVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQKLPAEGP
AVKRGVAAASTARKAAKKAPAKKAAPAKKTAAKKAAPAKKAATKAPAKKA
APAKKAAPAKKTAAKKAAPAKKAPAAKKAAPAKKAPAKKAATKAAPAKKA
PAKKAPAKKAPAKRGRK
315445133YP_004078012.1 ADP-ribose pyrophosphatase [Mycobacterium gilvum Spyr1]MKAVTKTPIMAAGAVLWRPQDGTDAPEIAIIHRPRYDDWSLPKGKVDPGE
TDTVAAVREIEEETGFRSHLGRRLPTVTYPVDGAVKKVRYWAARAVGGEF
VPNDEVDEMKWLPADKAIAELGYPHDRKVVRRFLKLPADTKTVLIVRHGT
AGDKKRYRGDDRKRPLDKHGRAQAESLVGQLLAFGAAELFAADRVRCRQT
LEPLAEELGVSIAGEPTLTEEAYAEDRKAARARILDIAETAGTPVICSQG
KVIPDLIAWWCERDGVRADKSRNRKGSTWVLSLAEGRLVAADHLSSALPP
KK
315445132YP_004078011.1 polyphosphate kinase [Mycobacterium gilvum Spyr1]MTEAQTRTEPSESSESSEAVAPAITSAADSAPEAPPATTAPAIENPLPED
RYLNRELSWLDFNARVLALAADPSLPLLERAKFLAIFASNLDEFYMVRVA
GLKRRDEMGLSVRSADGLSPREQLRRISERTQQIASRHAHVFLDSVRPAL
ADEGIVIVTWAQLDDAERAKLSTYFHEQVFPVLTPLAVDPAHPFPFVSGL
SLNLAITVKHPDDGGQHFARIKVPDNVDRFVELPARGDSPGVVRFLPMEE
LIAAFLTVLFPGLEIVEHHAFRITRNADFEVEEDRDEDLLQALERELARR
RFGSPVRLEVSDDMTESMLELLLRELDVAPGDVVEVPGLLDLSSLWQIYS
VDRPGLKDPPFVPATPSAFGERETPKSIFSALRDGDVLVHHPYDSFSTTV
QRFIEQAAADPNVLAIKQTLYRTSGDSPIVNALIDAAEAGKQVVALVEIK
ARFDEQANIKWARALEQAGVHVVYGLIGLKTHCKTCLVVRREGSTIRRYC
HIGTGNYNPKTARLYEDIGLLTAAPDIGADLTDLFNSLTGYSRKESYRNL
LVAPYGVRRGIIERIDREIAATRDGAEGRIRLKANALVDEQVIDALYRAS
QAGVQVEVVVRGICALRPGEPGFSDNITVRSILGRFLEHSRIIHFRAIDE
YWIGSADMMHRNLDRRVEVMAQVKDPRLTTQLNDIFDSAADPRTRCWELG
SDGHWTALPQEGHSVRDHQISLMERRRHP
315445131YP_004078010.1 hypothetical protein Mspyr1_35650 [Mycobacterium gilvum Spyr1]MSGMRNSAPDADIGLVIAVKRLTAAKTRLAPVLSATNRESVVLAMLVDTI
GAAITVPAVRSVLVVTPDDGAASAARRLGARVLADPTPAGHRDPLNNALS
AAETAIREECSNIVVLQGDLPALKSVELAEALHAARAHPRSFVTDRHGTG
TAALFAFGVALQPRFGAGSAQRHRESGAVELTGDWPGLRSDIDTPEDLVA
ACELGVGPATSQAISAA
315445130YP_004078009.1 glycerol-3-phosphate dehydrogenase [Mycobacterium gilvum Spyr1]MGAGAWGTALAKVLADAGNSVTLWARRPELADAINRTHRNDNYLDATLPE
SIRATSDAADALTGACTVLFAVPSQTLRTNLEAWKSHVGADATLVNLAKG
IELDTLLRMSQVIAQVTGADPGRIAVVTGPNLASEIGAGQPAATVVACTD
SGRAVALQRALATGYFRPYTNADVIGAEIGGACKNVIALACGMAAGAGLG
ENTAAAIITRGLAEIMRLGIALGAKPATLAGLAGIGDLVATCTSPHSRNR
SFGERLGKGGTMQAALDATGGHVAEGVTSCRSVLALAASYDVEMPLTEAV
HGVCHKGLSVDEAIALLLGRTTKPE
315445129YP_004078008.1 cystathionine beta-lyase/cystathionine gamma-synthase [MycobacteriuMAGTHGDSTRSVKAVASQDVPGAAVAAPPVFASAYHLAADEDDTLDSYGR
RSNPTWRQLESALAQLEGAAAALSFASGMAALTAALRVLAQPGHTLVVPA
DGYYQVRAYAREYLASRGVTVVEARCADMVDAAAHADVVLAETPSNPELD
VVDLHRLALTCRSRGTVLVVDNTTATPFGQQPLSLGADLVVASATKALAG
HSDVLAGYVAGSHPELMERVERERLHAGAILGAFEAWLVTRSLGSAGLRF
DRQCQNAAAVALTLRSHPAVRSVRFPGLADDPSHEVAARQMRRFGGIVSF
ELADADAVHALVDRSALLVAATSFGGIHTSVDRRARWGDSVAAGFARMSM
GIEDTDDLVSDLQQALGPA
315445128YP_004078007.1 D-alanine--D-alanine ligase [Mycobacterium gilvum Spyr1]MNARIRVAVVYGGRSSEHAISCVSAGSILRNLDPDRFEVTAVGITPEGSW
VLTEGRPETLAITDGKLPGVTGDSGTALTLTADPARRGQLVSLGEAAGEV
LASADVVFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTK
KLLASAGLPVGDHVVLRARDSTLSLQDRERLGLPVFVKPSRGGSSIGVSR
VTAWDELPAAIELARRHDPKVIIEAAVPGRELECGVLEFPDGHLEASTLG
EIRVEGVRGREDGFYDFETKYLDDGAELDVPAKVDDDVAEAIRALSLRAF
TAIDCQGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYQT
LLATMVETALARGTGLR
315445127YP_004078006.1 hypothetical protein Mspyr1_35610 [Mycobacterium gilvum Spyr1]MDSETADGPPRAVLIAAAAVAVGAVVALLIVVAVMQREPAQKPVAVSGIP
APQADSPQCRSLVEALPEQLGDYRRAQLVEPAPAGAAAWQPEAPDGEALI
LRCGLDRPAEFVTGAPLQVVDAVSWFRVGEAGAGDDRVGEAGAGESGVAD
GDRSTWFAVDRPVYVALTLPRDSGPTAIQTLSTIIAETLPAQTPQPAPLG
315445126YP_004078005.1 AsnC family protein [Mycobacterium gilvum Spyr1]MVEAFVLVQTEVGRAEVIAKQLAGLTGVLSAEYVTGPYDVVVRVGAPSLD
DLKSGVVPAVQQVAGITRTLTCPIADGAAP
315445125YP_004078004.1 thiamine-phosphate kinase [Mycobacterium gilvum Spyr1]MAAEDADATLSELGEFAVIDRLVADRRQPPAVSLGPGDDAAVVFAADGRT
VVCTDMLVEGRHFRLDWSTPHDIGRKAIAQNAADIEAMGARATAFVVAFG
APGDTPTAAAVQVADGMWHEAALLGAGIVGGDTVAAPQWVISVAALGDLG
GREPVCRDGARPGDTVAVTGVLGRSAAGYEVLRNGIDGFDELRRQHRVPS
PPYGQGAIAAQAGATAMTDVSDGLLADLAHIASASGVSIDITLDTLTSDE
AAVADAAGATGVDARQWVLGGGEDHALVATFPGAVPPNWRVLGTVAATAA
DGAPAVTVDGSPWIGNAGWQSF
315445124YP_004078003.1 uracil-DNA glycosylase [Mycobacterium gilvum Spyr1]MNARPLSELVDDGWAAALAPVESQVAQMGEFLRAELAAGHRYLPAGPNIL
RAFTFPLEKVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPLPRSLDNIFKE
YRADLGHPAPSNGDLTPWCEQGVMLLNRVLTVRPGTPASHRGKGWEAVTE
CAIRALVARRQPMVAVLWGRDASTLKPMLEDTAVIESPHPSPLSASRGFF
GSKPFSRANELLAQRGAEPVDWRLP
315445123YP_004078002.1 50S ribosomal protein L28 [Mycobacterium gilvum Spyr1]MAAVCEICGKGPGFGKSVSHSHRRTSRRWNPNIQSVRAVSSPGGNKQRVN
VCTSCLKAGKVARG
315445122YP_004078001.1 dihydroxyacetone kinase [Mycobacterium gilvum Spyr1]MSARRLDASTLRRWAHDAVAALISHTDEINRLNVFPVADADTGTNMLFTM
RAAWAQADSDAADDVTAITAALAAGALRGARGNSGVILSQILRALAEVTA
EAAEERGGVLSEVTGEMLAAALRHAVTLVVASMGEAVPGTIVSVLHDAAA
AAEDAVCGQADLAAVVVACTQAAAAALDRTPTQLDVLADAGVVDAGGRGL
LVLLDALSAILTGELTRRQVYLPDPKHAAGAAAPPSPTPGFEVMYLLSDC
DAENVEQLRARLDALGDSVAIAASGFGEAGAGHYSVHVHADDAGAAVEAG
LAVGTLSRIQITSLHGGADRSSAGSWGRERAVLALVDGEGAEELFVGEGA
AVLRTEPGVEISAQQLLHALVKTGAAQVMVLPNGYVAAEEIVAGCAVAAD
WGIDLVPIPTGSMVQGLAALAVHDPGHRLVDDGYTMARAGAAARFGSVRI
AAEDALTWAGACRPGDGLGITGDEVVVVGDDIVSAATGLIDLLLAAGGEL
VTVLTGDGVESEVGAALAEHVHHNHLGAELVTFHTGHRADALLIGVE
315445121YP_004078000.1 ATP-dependent DNA helicase RecG [Mycobacterium gilvum Spyr1]MATLDDRLDFVIGAKAARPLEEHLGLHTVGDLVRYFPRKYSDAMTVRGEG
EDLDLEEGEHVTFVDVIARAELKRVRNQPSREFLVVTLRDRRPKVTATFF
NPKWLKKTLVEGTKVMLSGEVGYFRGTMQLTHPAFMVLDSASGKTVGTKS
LTSIASTSGATGDDLLAEFEKNYFPIYAATSKVQTWDIYACVRQALAVLD
PVPETLPDCFVREHDLMSEDEALRAVHLSENAEDRARAIERLTFDEAAGL
QWGLVVRRNSELGASGPPAPRRGGGLVDAMTAQLPFELTAGQQEVLAVIS
EELGAARPMNRMLQGEVGSGKTVVSLLAMLQMIDAGYQCALLAPTEVLAA
QHASSIRSMLGALAGAGELGGAEQATRVSLLTGSMSAAQKRDARREVASG
VAGIVIGTHALLSDSVEFDNLGMVVVDEQHRFGVEQRDRLRAKAPAGLTP
HLLVMTATPIPRTVALTIYGDLETSTLRELPRGRRPITTNTIFIRDKPAW
LDRAWTRIAEEVAAGRQAYVVASRIDENDTADGKADGKAKKAKKTSESDQ
QGPPPVTVVDLLARLQRGPLSGVRLGLMHGRLSGDEKDAVMAAFRAGDID
VLVCTTVIEVGVDVPNATVMVVMDADRFGISQLHQLRGRIGRGEHPSLCL
LATNLPESSKAGQRLTAVAATQDGFELAELDLRERSEGDVLGLFQSGRPV
TLRFLSLADHVEIILSARELCETVYASDPLDPGMAALSAPFTDSDKVQYL
DMS
315445120YP_004077999.1 hypothetical protein Mspyr1_35540 [Mycobacterium gilvum Spyr1]MSRKQTLWLAVAVVLAVIVAYQTVENSAQRSAQFVADADVPTVAPGEDVL
AGVAVVPLRLRGHDYRRDAFGDAWTDDNDAPGGRNGCDTRNDILDRDLVD
KTYVAISRCPTAVATGILHDPYTSLIVPFTRGNQTGAAVQIEHIVPLAYA
WDQGARFWTDQMRVRFANDPANLVAVQGEVNQDKGDKEPALWMPPNAAFH
CQYAMQFIAVLRGYRLPVDAPSVPALTRAAETCPTR
315445119YP_004077998.1 hypothetical protein Mspyr1_35530 [Mycobacterium gilvum Spyr1]MQRGSPGPVGAPGSAHAPGVAAAASAANAKTVTARHTTTIDIVMSTTPS
315445118YP_004077997.1 hypothetical protein Mspyr1_35520 [Mycobacterium gilvum Spyr1]MMPGMPAPPDIVGEIDGVAIVGAALIGGAMMGGGAMGAIGGAAIGGGAIG
GGAIGGGAIGGGAIGGGAAAAGGWTIGGGGGKYGLPVHAASAGLDMHAGS
RGPVGAAGAIAYGPP
315445117YP_004077996.1 dyp-type peroxidase family protein [Mycobacterium gilvum Spyr1]MGEPSRPRGFNRRRLLLTGGAALAVTTTLTRCGRAESATAATGFGSNTEP
FHGAHQGGVDTPAQAHALFVALDLVATPDRAPRDTLASVLRLWTADAARL
TQGRPALADTEPELAARPSRLTVTVGLGAGLFERAGLAHRRPDSVTELPA
FSTDRLESRWCGGDLLLQICADDPLVVAHTARVLLKNVRTMTTQRWQQRG
FRSARGSDTSGATMRNLMGQVDGTVNLRTATDVDRLLWDDGAGQPWFAGG
TVLVLRRIRTELDSWDELDRTSRELTVGRRLDTGAPLTGTHEFDEPDLDA
AENGIPVIPPNSHVALARHRHDGERFLRRAYNYDDPPTDATTDAGLIFAA
YQRDPAQQFVPVQQRLAASDALNPWITTIGSAVFAILPGAADGGYLGQSL
LE
315445116YP_004077995.1 hypothetical protein Mspyr1_35500 [Mycobacterium gilvum Spyr1]MSGNRNRFALTVLAAAISLTACTSSGSGPDASMASAVTFDESWARAADSG
MTAVFGTFTNGGDRDAVIVSGESAAANRVELHEVTHNSGGAMMRPKDGGF
SVAAGGTKDLLPGGDHLMLIDLTQPLQPGDDVALTVTFADGSALPITAQV
RDFAGGDEEYAPGAHHHG
315445115YP_004077994.1 iron-regulated membrane protein [Mycobacterium gilvum Spyr1]MTLPEGTHDPTTLTNQAPEAIPKHRWRALLVRLHFYAGVLVGPFLVIAAL
TGALYAMAPTVERVVYRDLLFVEPGDRVLPLDDQVAAARRSYPALTVTGV
RPPAAENESVRVYFADPALAPDLGRAVFVDPYTGRVLGDEVTWLGYLPVS
TWLDGLHRHLNLGEPGRLYSELAASWLWVVASGGLYLWLVNAAGDRRRGR
KPRILTVDRTAGGRSRNLNWHGATGVWLLGGLLFLSATGITWSTYAGAHV
SDLRAAFEWQRPQLDTATHGDHGDHAPAAGHTAGPQSVDFDGVLAAATTA
GVDLPVEILLPAEHGAAVTVSEIDKPYRWTTDAAAVNPGDLTVTGTVDYW
RDYSLIAKLADWGIRGHMGFLFGLLNQLLLLGIAVGLLAVIVRGYRMWWQ
RRPTRGSRWAVGRPPARGGLRRLRPLTVTALVAGAVTVGWFLPLLGLTLA
AFALTDLILGSIKKNASLKKNASLKKNASLKKNASLNENTENSHVR
315445114YP_004077993.1 hypothetical protein Mspyr1_35480 [Mycobacterium gilvum Spyr1]MNTPKMRARWARGALVGASSAAMTLGAHAAAGGGALPLGSSLVLALLVCA
TVGALAGAVRSDDRRVRWLATTSALGGAQFLGHIALALTGHHHDALVPTP
GPSMIVAHIAAAVLLGGAISAAEYLYAVCASVLHWLRLFILQSPRPMPRA
RRRATRIVVPRPVLATGLGMRAPPHATVTA
315445113YP_004077992.1 aldo/keto reductase- diketogulonate reductase [Mycobacterium gilvumMTSAAAIPTVTLNDDHTMPVIGLGVGELSDAETEQAVTAALEAGYRLIDT
AAAYGNEAAVGRAIAASGVPRDELFVTTKLATEDAGFQSSQDALRASLER
LGLDYVDLYLIHWPVSQQGKHVDSWGGLMKSKEVGLTRSIGVANFHGHHL
DDIISLSFFTPAVNQIELHPLLNQAELRAVNAEHGIATEAYGPLGVGNLL
SHSAVNAIAEAHGRTPAQVLIRWSLQLGNIVIPRSSSPERIRSNIDVFGF
ELSEEQMSTLNGLDDGTRFRPDPETYSGS
315445112YP_004077991.1 esterase/lipase [Mycobacterium gilvum Spyr1]MTDVAAGHTPETTPRVRTRPAGGAVEKLTNTLAGVTLRALPRIPDPVKRL
LLGRRTITLDGNTLDTTLHLMLAGQRLMGIEGLVADDDVTVARAQLEVLA
AAFKQHIPVAAVTNLTVPGAQGPLDARHYRTDEPDAALLVFFHGGGHVIG
SLDSHDDLCREICRAGRIHVLSVDYRLAPEHKAPAGAQDAYSAYLWAREH
AAELGADPERVAVGGDSAGGNLSAVLTQRARDEGAPLPALQVLLYPATEV
GIQTRSQTLFSDGFFLTKRDMDWFMDHFLDGADVADTDPRVSPLRTDDMS
GLPPALVVTAGFDPLRDEGRLYAEALREAGTPVDYREYGTVVHGFANFFP
LGGDSATAMADVISAIRAHLTRAG
315445111YP_004077990.1 protein-disulfide isomerase [Mycobacterium gilvum Spyr1]MASKPKKNARYDLKAADRKRNLLIQIGLTAVVVIFAVALVLYIVGSADDK
PTAGESRGIRVESTSVIKKEGTDEPKAVVSMYEDFLCPHCGAFEQQFGPT
INKLVDAGAIAADYYMVGILDRPQNQNYPARAGGAAYCVADESIDAFKRF
HAALYAQQPGETGSTYPDNARLIEIARQSGATGGVPECINKGTYVDMVGG
LARATEIKSTPTVRINGEEYQYSTPDALVAKIKEIVGDVPGLEAAPPAPA
PQPAPAS
315445110YP_004077989.1 hypothetical protein Mspyr1_35440 [Mycobacterium gilvum Spyr1]MTVTATDSVDHADPSADEATGVAVARGSALWVLIAGVVGLAAALTLTVEK
IELLIDPDYIPSCSINPVLSCGSVMITPQASLFGFPNPLIGIVSFTVVVV
TGVLALAKVSLPRWYWAGLAVATLLGTVFVHWLIFQSLYRIGALCPYCMV
VWAVTIPLLVVATSVAVQAQRSGNAAVRLIYTWRWSLVTLWFTGVLLLIL
ERFWNYWSTLI
315445109YP_004077988.1 transposase [Mycobacterium gilvum Spyr1]MTTGQVWAGVDVGKEHHWVCAVDDSGKVVLSRRLVNDEQPIRELVAEIDE
LAERVSWTVDLTTVYAALVLTVLADAGKTVRYLAGRAVWQASATYRGGEA
KTDAKDARVIADQARMRGQDLPVLHPDDDLISELRMLTGHRADLVADRTR
TINRLRQQLVAVCPALERAAQPSQDRGWVILLARYQRPKAIRQSGVSRLT
KVLTDAGVRNAASIAAAAVAAVKTQTMRLPGEEVAAGLIADLAREVIALD
DRIKTTDADIEGRFRRHPLAEVITSMPGIGFRLGAEFLAAVGDPALIGSA
DQLAAWAGLAPVSRDSGKRTGRLHTPKRYSRRLRRVMYMSALTAIRCDPD
SKAYYQRKRDEGKRPIPATICLARRRTNVLYALIRDNRTWQPDSPPVTAA
A
315445108YP_004077987.1 transposase IS116/IS110/IS902 family [Mycobacterium gilvum Spyr1]MSVHVAPVTSSTIVVAVDVGKTSALLSVTDASRHRLFGPSEFAMNRTGLA
AVTAEATASIPLSGQVKVGVEAAGHYHRPVLDHRWPPGWEVLELNPAQVA
EQRRVQGRRRIKTDVIDLEAITDLVLAGYGRSVSDRDVVIGEVSAWAVHR
SRRTATRTATKNQLLGQLDRAFPGLTLALPDVLGTKIGRLVAAEFTDPAR
LAGLGVSRLIRFAATRDLQLRRPVAERLVAVARDALPTRDAVIARRILAA
DMALLADLDAQIDAAETELGSLLPRSPYATLTSVPGWGVVRVSNYAAALG
DPQRWPGPRQIYRASGLSPVQYESAHKRRDGGISREGSVALRRALIDLGI
GLWLSEPAAKTYAHGLKDRGKHGGVVACALANRANRIAHALVRDHAVYEP
TRWA
315445107YP_004077986.1 pyruvate carboxylase [Mycobacterium gilvum Spyr1]MAGQITKVLVANRGEIAIRAFRAAYEMGIATVAVYPYEDRNSLHRLKADE
SYQIGDVGHPVRAYLSVDEIMRVALDAGCDAVYPGYGFLSENPELAAACA
SAGITFVGPSAHVLELTGNKARAIAAARSAGLPVLASSEPSASVEELVEA
ARTMEFPLFVKAVSGGGGRGMRRVAEPEGLAEAVEAASREAESAFGDPSV
YLEQAVLNPRHIEVQILADSRGNVMHLFERDCSVQRRHQKVIELAPAPNL
PEELRQQICADAVAYAREIGYTCAGTVEFLLDERGHHVFIECNPRIQVEH
TVTEEITDVDLVASQIRIASGQTLADLGLSQEDLVIRGAAMQCRITTEDP
ANGFRPDTGRITAYRSPGGAGIRLDGGAVLGGEIGAHFDSMLVKLTCRGR
DFATAAARAHRALAEFRVRGVSTNIPFLQAVIDDPDFRAGRVTTSFIDER
PGLLTSHTPADRGTKILNYLADVTVNQPHGPRPSTVYPQDKLPQIDLNTM
PPRGSKHLLSEVGPEGFARWMRESKAVGVTDTTFRDAHQSLLATRIRTSG
MLMVAPYVARMTPQLLSIECWGGATYDVALRFLKEDPWERLAALREAVPN
ICLQMLLRGRNTVGYTPYPESVTHAFVQEATATGIDIYRIFDALNNVDSM
RPAIDAVRETGTAVAEVAMSYTGDLSDPAENLYTLDYYLKLAEQIVDAGA
HVLGIKDMAGLLRPQAADTLVRALRSRFDLPVHVHTHDTPGGQLATYLAA
WQAGASAVDGASSPLAGTTSQPALSSIVAATAHTEFDTGLSLEAVCDLEP
YWEALRKVYAPFDVAAAGPTTPTGRVYHHEIPGGQLSNLRQQAIALGLGD
RFEQIEASYAAADRILGRLVKVTPSSKVVGDLALALVGAGVSADEFAADP
ERFDIPDSVIGFLRGELGDPPGGWPEPLRSKALAGRAPAKPATELSAEDT
AALADAGATRRATLNRLLFPGPTKEFEAHREQYGDTSSLSANQFFYGLRH
GDEHRVTLEKGVQLLIGLEAISDADERGMRTVMCILNGQLRPVVVRDRSV
ASEVPAAEKADRNNPDHVAAPFAGVVTVNVAEGDQVETGQTIATIEAMKM
EAAITAPKAGAVGRVAVSATAQVEGGDLLVVIGSAGAKVSSDGAGESS
315445106YP_004077985.1 methyltransferase [Mycobacterium gilvum Spyr1]MPQQKSGRGTRPTTDRVREAMFNLLSARIDFSGIRVLDLYAGSGALGLEA
LSRGARSVLFVESDARAASVIEQNIAALGARGATVRRGSVAAVLSAGAAT
PVDLVLADPPYEVDAAQVADMVDALDNAGWASPGTVAVVERPASASEIDW
PARWSAWKARRYGDTRLEMASVID
315445105YP_004077984.1 phosphopantetheine adenylyltransferase [Mycobacterium gilvum Spyr1]MSGAVCPGSFDPVTLGHIDVFERAAAQFDEIVVAVMVNPNKSGMFTLDER
IALIEESTTHLPNLRVESGQGLIVDFVRERGLTAIVKGLRTGTDFEYELQ
MAQMNKHVAGIDTFFVATAPSYSFVSSSLAKEVAMLGGDVTALLPAAVNT
RLTAKLAERG
315445104YP_004077983.1 hemerythrin HHE cation binding domain-containing protein [MycobacteMPETFVQSTDDVVAFLKDQHNLIRDMFDDVIHASDPKAREKAFTELRQLL
AVHETAEEMVVHPRIRREVDEGDDIAEALLAEEHASKEKLVALENLDIAS
DEFLRELTEFRDTVLAHAEHEEIEEFTKLSRELGADDLKRMAGAVQAAEA
IAPTRPHPGVESATLNFAVGPFASMLDRARDVIGAALK
315445103YP_004077982.1 cell division initiation protein [Mycobacterium gilvum Spyr1]MYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGELD
DAQDVLDARDAMLREAKDHAESTVSTANAEADSMVNHARTEADRLLADAK
AQADRMVAEARQHSERMVGEAREEAARIAATAKREYEASTGRAKSEADRL
LESGNLAYEKAVQEGIKEQQRLVSQTEVVATATAEATRMIDSAHAEADRL
RGECDIYVDSKLAEFEDFLNGTLRSVGRGRHQLRTSAGTHDYAAR
315445102YP_004077981.1 metal-binding protein [Mycobacterium gilvum Spyr1]MATHASAAARRSSRSPLVIDITRLGRRPGSMITVDTTVPSPTRIGVELIA
IEEGAPLELDLRLESVSEGVLVTGTMSAPTSGECGRCLKPITGEVSIDLT
ELFAYPDSTTDETTESDELPRVGRERGTETVDLEQSVIDAVGLALPFSPV
CGPDCQGLCPDCGVALEDAEPGHHHEKIDPRWAKLAEFGEKDGDDA
315445101YP_004077980.1 RNAse III [Mycobacterium gilvum Spyr1]MTVDRALLLKALGIDLPAELLTIALTHRSYSYENGGVPTNERLEFLGDSV
LGLTITEELYHRHPDRSEGDLAKLRASIVNTQALADVGRNLSEHGLGAYL
LLGKGEENSGGADKSSILADGVESLLGAIYLEHGAVAAREVILRLFSDLL
DTAPTLGAGLDWKSSLQELTASLALGAPSYHVTSTGPDHDKEFTAVVIIA
EREHGTGVGRTKKEAELKAASAAWNALQRAHPDA
315445100YP_004077979.1 bifunctional DNA-(apurinic or apyrimidinic site) lyase/formamidopyrMPELPEVEVVRRGLAAHVTGRTISAVRVHHPRAVRRHEAGPADLTARLLD
SVITGTGRRGKYLWLTLGDGSAVVVHLGMSGQMLLGPVRNENHLRIAVLL
DDGTALSFVDQRTFGGWMLADLVTVDGSDVPAPVAHIARDPLDPLFDRAA
VVNVLRRKHSEIKRQLLDQTVVSGIGNIYADESLWRAKINGARLASGVSK
AKLAELLDAATDVMTDALAQGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EPCRRCGAIMRRDKFMNRSSFYCPRCQPRPRV
315445099YP_004077978.1 redox protein- regulator of disulfide bond formation [MycobacteriumMTELWVERTGVRRYTGRSTRGAEVLVGSEDVEGVFTPGELMKIALAACSG
LSSDQPLRRRLGDDYRAKIRVSGAADREQERYPLLEEKLEVDLSGLSDDE
KARLVTVVERAIDQVCTVGRTLKSGTEVTFEVGDAGGE
315445098YP_004077977.1 acylphosphatase [Mycobacterium gilvum Spyr1]MPGASDVRLTAWVHGQVQGVGFRWWTRSRALELVLTGFAANKPDGRVQVV
AQGPREACERLLGALQGGDTPGHVDKVIYDWSEPADAIAGFTER
315445097YP_004077976.1 condensin subunit Smc [Mycobacterium gilvum Spyr1]MHLKSLTLKGFKSFASPTTLRFEPGITCVVGPNGSGKSNVVDALTWVMGE
QGAKTLRGGKMEDVIFAGTSSRAPLGRAEVTLTIDNSDNALPIEYSEVSI
TRRMFRDGAGEYEINGSRCRLADVQELLSDSGIGREMHVIVGQGKLSEIL
ESRPEDRRAFIEEAAGVLKHRKRKEKAVRKLDSMAANLARLTDLTTELRR
QLKPLGRQAEMARRAQTIQADLRDARLRLAADDLVARKAEFDDTDQAETT
LRREHDELTERLQERAAELDAHETAVEDLSERADAAQQRWFRLSALAERV
SATVRIASERAQHLDGDPDFSAGPDPDELEAQADAVAEQEQQLLDELAES
QERLEAAREELAEREQAAAEAERAHMAAARAEADRREGLARLSGQVDTMR
TRVESVDETVARLTANIDDAAARAQLTQAEFETVQARVGELDAGEVGLDE
HHDRSVAALRLADERVAELLAAERAAERQVASLQARIDALSVGLDRRDGA
AWLQENHSGAGLFGSIANLVKVRAGHEAAIAAVLGAAADALAAEDFGAAR
AAVAALKESDGGRAALVLGDWPAQEAVTGQLPAGAAWAVDLVEPSDRVRG
AVTAMLSGVAVVENLTAALDLVAAQPRLRAVTADGDLVGAGWVSGGSDRK
PSTLEIQSEVDRARSELVDAERRTGELSAALSGALAEQAARQDAAEHALA
ALNESDAAISAIYEQLGRLGQDARAADDEWQRLIRQRDEMEAGRNRTVSE
LAELELRLQNAQQEPMFDAEVVDRTEYTAAAEAARSAEVEARLSVRTAEE
RANAVRGRADSLRRAAVAEREARVRAQRAREARVHAAAVAAAVAESGRAV
AQRLADAVSVASRIRDEVAAERQVRAGALTKAREEVNELTARITALTDAL
HRDEVAKAQAALRIEQLEQQVLEQFGMAVADLVAEYGPDVALPPSELEMA
EYEQARERGEQVTAPAPMPYDRPTQERRAKRAERELKELGRVNPLALEEF
AALEERYNFLSTQLEDVKAARKDLLDVIAEVDTRILQVFTEAYMDVEREF
TQVFSTLFPGGEGRLLLTNPSDMLTTGIEVEARPPGKKIKRLSLLSGGEK
SLTAVAMLVAIFRARPSPFYVMDEVEAALDDVNLRRLISLFEQLRERSQL
IVITHQKPTMEVADALYGVTMQGDGITTVISQRMRGQELVTSSS
315445096YP_004077975.1 isopentenyl-diphosphate delta-isomerase [Mycobacterium gilvum Spyr1MTPDPASALQHRKRRHIDVCLTDPVDYQTLTTGFERYQLPYNALTQTDLH
SVDLGTEFMGSRLRAPVLIGAMTGGAALSGIINRNLAEAAQQLGVGMMLG
SQRVMIDDAVAAESFDVRGVAPDVLVIGNIGLAQLQPSMVPALAAALDRV
GANGLAVHTNPLQEAMQHNGDTDFSGSMSRLREVVDSLGYPVMLKEVGHG
IGASAAAQLVDCPVAAVDVAGAGGTSWARIEQFVRYGEVRYPALAEWGIP
TAQALTEVRGILPDVPLVASGGIRTGMDAAKALAMGAEVVAIARPLLAPA
VESVGAVVDWLQRFIDELLVCLHGSGAANLSALRERGVTELP
315445095YP_004077974.1 signal recognition particle-docking protein FtsY [Mycobacterium gilMTVSEGLWIAIAVIAVLLVVALVVGLVRYRRRQIKLSAPDTATPVDRSGG
YTASSSITFTQSAPVKEPPAPPKEPQRPRRLDTTGLPAVGDDATIPRDAP
KRPIADVRLPEPPVVEPAPAPAPPEPVAEPEPVAEPEPLPEIQVPEPVAE
PEQVTEAPAPDIDAIAPTEGRLDRLRGRLAKSQNTLGRSMLGLIGGGDLD
EDSWEEVEDTLLIADLGPVVTESVVTALRAKMASSKVRTEADARAVLREV
LIAELQPDLDRAIRALPHADKPSVLLVVGVNGTGKTTTVGKLARVLVADG
RRVVLGAADTFRAAAADQLQSWASRVGAQVVRGPEGADPASVAFDAVDTG
IASGADVVVVDTAGRLHTKTGLMDELGKVKRVVSKRAEVDEVLLVLDATI
GQNSLPQARVFAEAVDITGVVLTKLDGTAKGGIVFRVQQELGVPVKLVGL
GEGPDDLAPFEPAAFVDALLG
315445094YP_004077973.1 ammonium transporter [Mycobacterium gilvum Spyr1]MLLALPDEAFLPFGPEGLSAGDTAWVLTSAALVLLMTPGLAFFYGGLSRQ
KSVLNMMMMSFGSMGVVSVIYVLWGYSMSFASAHTGESDFFGVFDNPFSL
FGVSQLTEVREIGGVDTFVSGGFGTVPAIVWVAFQLTFAVITVALISGAV
AERMKFGTWLVFGGIWVTLVYFPLAHMVWGGGLLSGAEDGIAAKLFGVDE
EGAANVSPIDFAGGTVVHINAGMAALVLAILLGKRAGFGRTPYRPHNIPF
VMLGAALLWFGWFGFNVGSEGAADMLAGAVWVNTTAATAAAMLGWLLVER
IRDGHATSVGAASGIVAGLVAITPACGSLSAIGSLILGAVAGVLSALAIA
LKYKFGYDDSLDVVGVHLVAGLWGTIGIGFLALETGLFYGGGFEQLVVQI
VIALVAVVFTAVMTAIIAFIVKPLGWRVSKEDEDTGIDETEHAETAYELA
315445093YP_004077972.1 nitrogen regulatory protein P-II [Mycobacterium gilvum Spyr1]MKLITAIVKPFTLEDVKTGLEQTGILGMTVSEVQGYGRQKGHTEVYRGAE
YSVDFVPKVRVEVVVDDAAVDKVVDVIVQAARTGKIGDGKVWVSPVETVV
RVRTGERGADAL
315445092YP_004077971.1 (protein-PII) uridylyltransferase [Mycobacterium gilvum Spyr1]MKDSTSKPAAGASRWERPAAVSSRPATDLVAAAEQLLAGGARPLDSAALR
DALLDLHDFWLTTKATEIGITATSGFAIVATGGLGRGELLPYSDLDLMLL
HDNMPAEIVGEVAELLWYPLWDANIRLDHSVRTVPEALRVAGEDISAGLA
MLEARHIAGDADLSSLLIGGARRQWRTGIAPRFEELVEHARARWQRSGEI
AHRAEPDLKCGRGGLRDVQLLNALAIAQLADVYPSRSLASPTETLGEANL
ALLNVRTELHRVAGRGRELLLAQHADEIGASLRIGDRFDLARTLSDAART
VSYYVDAGIRTAANSLPRRGLAALRRPVRRPLDEGVIEFAGEVILARDAR
PERDPGLILRVAAASATTGLPIAGSTLSRLVEAAPELRTPWPRQALKDLL
VMLAAGPSAVGTIEALDRTGLWGRLFPEWGAVRDLPPRDVVHIWTVDRHL
VETVSRASAFTTRVSRPDLLLLGALVHDIGKGRGGDHSVIGAELAHQIGS
RLGLWPSDIKILAQVVRYHLLLPHTATRRDLQDAATISAVVDALDGDPAV
LELLHVLAEADSLATGPGVWGDWKASLLGELVRRCRMVMAGEPLPHPDPV
DPRFISLAGQVGVHVELTPTDTPHIYQVTMIAPDSRGVLSKAAGVMALNS
LRVHSASVNGHEGSAINSFVVSPRFGTPPAAELLRQQLILAIDGELDVMG
ALEKKEAESVATGRAGEVRAAVPINAPTAPPKVLWHEPSGSGHVVAEIRA
TDRTGLLAVLTRVFERAGVDIAWAKVTTMGSSVIDVFGIVLPAGEDAVRE
SLEKQLLAVLPAPPQPKPVREEAS
315445091YP_004077970.1 signal recognition particle subunit FFH/SRP54 (srp54) [MycobacteriuMFESLSDRLTGALSGLRGKGRLTDADIDATAREIRLALLEADVSLPVVRA
FISRIKDRAKGVEVSAALNPAQQVVKIVNEELVAILGGETRQLAFARNPP
TVIMLAGLQGSGKTTLAGKLAKWLKAQGHTPLLVACDLQRPGAVNQLQIV
GERAGVHVFAPHPGVSPAGETIEQMTAHARSETAGAGDPVSVAAAGLAEA
RSKLYDVVIVDTAGRLGIDQELMAQAAAIRDAVNPDEILFVLDAMIGQDA
VTTADAFREGVGFTGVVLTKLDGDARGGAALSVREVTGQPILFASAGEKL
EDFDVFHPDRMASRILGMGDVLTLIEQAEQVFDAEQAEATAAKIGSGELT
LEDFLEQMLAIRKMGPIGNLLGMLPGAGQMKDALAAVDDSQLDRVQAIIR
GMTPQERADPKIINASRRLRIANGSGVTVAEVNQLVDRFFEARKMMSQMA
GQMGMPFGRKNTRKAAKGKNKQAGKKKGGRGPTPPKNRNPLGAGMPGMAG
LPPGFPDLSNMPKGLDELPPGLADIDLSKLKFPKN
315445090YP_004077969.1 Pro-Hyp dipeptidase [Mycobacterium gilvum Spyr1]MDGTPLHVRGRSLPDGEPVEWWIVGGRLSADPVAGAETVFGADGDGGWVL
PGLVDAHCHVGLGPGGPTGLDEAIGQAETEREVGALLLRDAGSPVDTRSL
DDRADLPRIIRAGRHLAKPKRYIPGLPIDIEDELQLPEYVVQQARSGDGW
VKLVGDWIDRGIGDLAPLWSDEVLEAAIAAAHANGARVTAHVFGEDALPG
LIKAGIDCIEHGTGLTEDSIGLMVEYGTALVPTLINIENFPGIAEAAGKY
PTYARHMRDLYASCRDRVAAARDAGIPIFAGTDAGGMIAHGRIADEVEAL
KGIGMTPSEALGAACWDAREWLRRPTLRHGASADLVCFTGDPRTGAEVLA
NPTRVILRGVVY
315445089YP_004077968.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium gilvum Spyr1]MRRRLAGLAFALGALLTASVSVAAPGVAQPAAQPAAAQPIPDGPAKAWLV
ADLDTGRVLASKDPYGTYAPASTIKVLLAMTVLDHLRPDSFARANESHTK
IECSCAGLTPGQAYTTAQLVSAILMVSGNDAATMLGDMLGGQRVAVAAMN
RKAALVGARSTKASSTSGLDGPGWESVTTPHDLAVIMRAALKYPLIAQIM
RSPTAPFPGKTLHNQNELLSRYPGDLGGKTGFTNLARKTYVGAAQRGNRR
LVVVQMYGTGDLYGQAMQLLDYGFSQP
315445088YP_004077967.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium gilvum Spyr1]MTRLLASLGAALCLILAGSGVVSPTASAVPVTGIVQPAGSVPVPDGPAQA
WVLADMDTGAVLAARQENGRFAPASTIKILLAMVVLDELPLDATVVANEA
DTRVECNCAGVAPGTTYTTRQLLEGLLLVSGNDAANTLATMLGGRDAAVA
KMNAKAAGLGAHGTRAGSPSGIDGPGIDIWSTPRDLAVLFRAAMAYPVFA
QITAQPTAVFPTKSGDVVLVNQDEMLHRYPGTFGGKTGYTDLARKTFVAG
ASRNGRHLVVAMMYGLVTEGGPTYWDQASALLDWGFALGPNAGVSRL
315445087YP_004077966.1 hypothetical protein Mspyr1_35210 [Mycobacterium gilvum Spyr1]MTLEEISDRLEIQQLLIDYSTAIDAKRFDDLDSVFTADAYIDYRVSGGVD
GRFPDVKAWLAEVLPNFPAYYHMLGNVDVRLGSDGNTATSRAICFNPMVM
GGDAGQIYFVGIWYVDEFVRTEQGWRMSRRVEEKAFDKLV
315445086YP_004077965.1 hypothetical protein Mspyr1_35200 [Mycobacterium gilvum Spyr1]MTDAAVTVLEIEAIKTLKARYCRYLDTKDWESWRTLFSDDFRSDTSRAGG
KVIVGADDFVAFTRRSLRTNATVHQVHAPEITLTSPTTADGIWALEDVVR
LAPGLNLRGYGHYTESYEKLDGRWLITESTLTRLREDIFNVAVSVYVSPR
MKRAIGALARRVAH
315445085YP_004077964.1 Mg2+ transporter MgtE [Mycobacterium gilvum Spyr1]MADITAPPSETQLKSLLRALDDLDLPALTALLRPLSAIQVVDVLERLDVH
ERAVLYRILPKDRALEVFEILPPSLQGDLVGALQDDAVAALFADMDPDDR
VELLDELPATVAGRLMHGLPPDERELTAVVLGYPQRSIGRRMSPEFVSVR
PTMTTAEALTRVSAGLDDAETVYMLPVVDDERVLIGVVSLRRLLTAVPGT
TIVEVMRPPHWARATEDAETAARRCADLRVLALPIVDNETRLVGILTVDD
ALQILETAESEDQARIAGTEPLRRPYLTAPVVSLVRSRVVWLLVLAIGAT
LTVQVLEVFEATLSEVVTLALFVPLLIGTGGNTGNQAATTVTRALALGDV
GPRDLGRVLLRELRVGLSLGLLLGGLAFAVTSLVYDRSIGTVIGLTLVSL
CTMAATVGGAMPLIARAIRVDPAVFSNPFISTFVDATGLLIYFTIARAVL
GI
315445084YP_004077963.1 30S ribosomal protein S16 [Mycobacterium gilvum Spyr1]MAVKIKLARFGKIRNPQYRISVADARNRRDGRAIEVIGRYHPKEDPSIIE
IDSERAQYWLGVGAQPTEPVLQLLKITGDWQKFKGLPGAEGTLKHKEPKP
SKLDLFNAALAEAEGGPSTEATTPKKKKAPAKKDEQPTEKAAEPAAEAPA
EAAAESEAPAAE
315445083YP_004077962.1 RNA-binding protein (contains KH domain) [Mycobacterium gilvum SpyrMSSVVVDAVEHLVRGIVDNPDDVRVDMVTNRRGRTVEVHVHPEDLGKVIG
RGGRTATALRTLVAGIGGRGIRVDVVDTDQ
315445082YP_004077961.1 16S rRNA processing protein RimM [Mycobacterium gilvum Spyr1]MDLVVGRVAKAHGVTGELTVEVRTDDPQGRFVRGAVLRGRPPRGGAEREY
VIESVRTHGDRLLVRFDGVADRDAADALRGTVFLVDSADLPPIEDPDEFY
DHQLEGLTVITTSGGEVGKVAEVLHTAAGELLAVRTADDTEVLVPFVSAI
VLSVSLDDQLITIDPPDGLLELD
315445081YP_004077960.1 tRNA (Guanine37-N(1)-) methyltransferase [Mycobacterium gilvum SpyrMRIDVVTIFPAFLDALRQALPGKAIEAGIIDLAVHDLRDWTHDVHRSVDD
SPYGGGPGMVMKAPVWGAALDEICSPETLLVVPSPAGRLFTQATAQRWST
ERHLVFACGRYEGIDQRVVEDAATRMRVEEVSLGDYVLPGGESAAVVMVE
AVVRLLPDVLGNPASHQDDSHSEFVGGLLEGPSYTRPASWRGLDVPDVLL
SGDHARIAAWRHQQGLERTRERRPDLLPPDAS
315445080YP_004077959.1 hypothetical protein Mspyr1_35140 [Mycobacterium gilvum Spyr1]MPRPRRLITATALASAVATVLAGCTPAVHGAPPVSAGPHLTVVAPLGRLA
PLPEAPPDEPPAAFTRLADLERQATSKAAAAGADITAAVLDRNTGELVTN
GNDMTMAIASVVKVFIADDLLLQVAQRRTGLSPQDRKSLEVMLRSSDDSA
AEVFWNRSGGAAIIDRVVKRYGLTSTRRPTDGRWFNTISTATDLVRYYDM
LLSGAGGLPRAQADVIVSNLAASTPTAPDGMVPGGVYPQRFGIPEGLFAE
PVAVKQGWMCCIGADWMHLSTGVIGRDRRYVMVIGSMQAGGDDAARRTIT
DAVKTMFPDGRI
315445079YP_004077958.1 50S ribosomal protein L19 [Mycobacterium gilvum Spyr1]MNTLDFVDQSSLRDDVPAFGPGDTVNVHVKVIEGSKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIDIVTRGDVRRAKLYYLR
DLRGKKAKIKEKR
315445078YP_004077957.1 signal peptidase I [Mycobacterium gilvum Spyr1]MTPSPEPSGPSGPSGIPEDSPTGRTLEDPVPADEPADEEKTGKKRGALRE
AAILISIALVLYYVTLTFIARPYLIPSESMEPTLHGCNGCVGDRIMVDKM
SYRFGSPEPGDVVVFKGPPNWSIGYKSIRSDNAAVRWIQDTLSVVGFVPP
DQNDLVKRIIATGGQTVQCRVDTGLTVDGKPLNEPYLNAETMMADPAVYP
CLGNEFGPVTVPEGRLWVMGDNRTHSADSRTHCTNEPADVQKGLLCTGDP
TAGTIPVENVIGKAQFIAWPPGRWGGVNSVNPQS
315445077YP_004077956.1 RNase HII [Mycobacterium gilvum Spyr1]MPAVWPPRTVIRKSSGLRTLESALYRAGLGPVAGVDEVGRGACAGPLVVA
ACILGPNRLESLSALDDSKKLNESERERLFPLIRRYAVAFHVVFIPSVEV
DRRGVHVANIEGMRRAVAGLAVRPGYVLSDGFRVPGLPMPSLPVVGGDAA
AACIAAASVLAKVSRDRLMVAMDQEHPGYGFADHKGYSTRAHSAALNDLG
PSTQHRFSFINVRRLVVDGEPGQGGELECGKLAVDVPVDMPVDRVLREGQ
LSR
315445076YP_004077955.1 hypothetical protein Mspyr1_35100 [Mycobacterium gilvum Spyr1]MSAEDLEKYETEMELSLYREYKDIVGQFSYVVETERRFYLANSVEMIPRN
ADGEVYFELRLGDAWVWDMYRPARFVKQVRVITFKDVNIEEVEKPELRLP
E
315445075YP_004077954.1 hypothetical protein Mspyr1_35090 [Mycobacterium gilvum Spyr1]MARRAVTVAACALVLAGGVGDVAPAHAESDVALNGVFTARSDGLWAKTNE
IMVYQQDVVATWTITSSCTTFQDCTGTVVSDQGWTADLVYQSQRWKAVHT
IENWQRCPDGSTARGEQSFTFWAARLDAADRHDRLTGWDQTIGPSGACGV
NRSLNIRMPFELTRKP
315445074YP_004077953.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MLTRLVRIQLTLFAIASVVGIAVMVLQYIRVPTLLGIGRIEVTLQLPEAG
GLYRFANVTYRGVQIGKVTALDVDRDGAEATLSLSGTPRVPADLRAEVRS
VSAVGEQYVDLQPRSRSGPYLESGAVIPSSAVTVPQRVAPMMQNLSDLIT
DIPKDKLAQLLDESFAAFDGSGYELQTLAESMTRISADMDRVAGRTSSLI
EDTAPVLDGQAASADALDTWAADLAAISAQLVDRDPEIRRILTTGTPAAQ
QVTQLIEQVRPTLPVLLANLTSLGQVGLTYRAGLEQLLVLLPPASAFYQS
AVGSNNATGIPVGDFRISVDDPPACTVGFLPPSAWRSPADTTTIDTPDGL
YCKLPQDSAIAVRGVRNLPCMDVPGKRAPTVELCRSDEAFQPLAARPHAL
GPYPFDPSLVAQGVPPDDRVTRDERLFAPPGGTPPPGSPPPPLAVATYDP
QTGRIATDDGTAVQQTDLVAPARTWKDLIWPAAP
315445073YP_004077952.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MRPVRAARRAVAIAAAVLMTTTACSFDGVSSLPLPGTVGRGDGATAYTVA
LANVGTLEPNSPVMIDDVVIGSVSRIGIVDRHAEVGIRVKAGVEIPANAI
ATVGQTSLLGSMHLELAAPLGEPAVGVLAPGSSIGLDASSTHPSTEQTLA
ALSTVVNGGGLGQIGDVVHSFNDVFAGHQNDIRELLGRLDRFVGILDTQT
DDIIATITELDRFSATLAQQRDVVSRALREIPPALDTLVRQRPRFTEALD
ALRRFSDTAGTVIDAVHTDLVTNLANLEPALRAVADLGPDISTGLGYALT
FPLNQNIIDRGVRGDYMNLFVTVDLTLGRFKRGLLAGTSFGDENAPLVPA
PGDPGYETFYSKNPLGEAVAPPPGVMGPDRLPTGGR
315445072YP_004077951.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MTRPTLIRLTAVALGTLLVASAGVIAAARLFPPTTLTAIFANANAIYPGD
DVRIAGVRVGTITAIEADGTQTVFTLQVDHGVRIAADVKAVVVAQNLVSA
RFVALTPRGGSGPVAESGAVIPRERTAVPVEWDEVKERIDRLAADLGPTA
ELTTGSVGRFVDSAADAMAGNGQKLRTAITQLAGISRVIAEGSGDITEML
SHLQTFVAVLRDSNEQIVRFEERLATLSSVLDGSRGDLDAALIHLAEAVG
EVQRFVAGTRDRTGEQVARLAGVTQNLVDHRADLEQVLHVAPSAMANAYN
MMDPRTGGASGVFVLNNMADPTAFFCGMLGALANVTAPESSKLCAQYLGP
GLDTVNFNYLPFPVNPLLTPIPSDSKLIYSEPDLRPGGPGTRSGPTAIAP
GDSAYQAQQPTVPQMLLPAERPTP
315445071YP_004077950.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MLKYRRASTVRAGFIGVVLIVLVIAVGLAPERITGWATAIRYQAVFADLS
GLSVGNDVTVSGMTLGKVTAVQLQDPNALVTFTVDDTTPLGSQSTAHIRT
GTLLGQRVLTVQSEGDGSMSAMDIIPLTRTSSPYTLTEALGDLTTNSTGT
DTAALNEALNTLSDTIDQISPQLGPTFDGLARISEALNTRNTALRRLFGS
GRDVTAVLAERSEEVSALILNADDLVAMLAERRHTIVELLAHISAVARDV
TGLVHDNEQQLAPTLEKLNTVLAMLERQRDNIALALPRLAKYQVTLGETV
ASGPYYSAYIPNLDLPPILQPFLDYAFGFRRGVDAGQPPDDAGPRAELPF
PRNGIPERPPR
315445070YP_004077949.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MRRQRGAGLKFALFVTVMALLTGCLFAVFGQYRSGSTNVYSAVFKDVSNL
RAGESVRFAGVRIGTVKDLSMQPDKTVVVTFDAERGLVLTSGTRAVVRYL
NLVGDRFLELVDDEGSTRILPAGARIPVEQTAPALDLDLLLGGLKPVIKG
LDAQEVNNLSAALIQIVQGQGGTLESLLSRTSSFSNALADRTEVIDRLIV
NLQTTLGTLADQRDDFSEGLTRLHRLVTELSAERQPIGAAIDSLSAGTAS
LSDLLTDTRPPLADTVDQLHRLAPNLESKLDRLETAISKAPENYRKLVRI
GSYGSFVNYYICSLGVRVTDLAGRTAVFPVFRQDNGRCAEN
315445069YP_004077948.1 virulence factor Mce family protein [Mycobacterium gilvum Spyr1]MKSAVIRPVIGLISLAAVASLTAVSVTLFRDSFAESVPLNVISPRAGLVM
NPDAKVQLHGVQVGKVVSIDYRDDGTAALHLAIDPARQNIIPADVTVDIA
STTVFGAKSVRLVPPADPSPSPVHAGQILGADRVMIEANTLFEQLVAVLD
TITPEKLNQTLGAIATAMRGRGTMIGQGLADLNSALAQIDPSLPALEHDL
STAPAVLRSYADAAPDLMSIVAAATEIGSSIVETENELDALLVSAVGLGE
VGSEVLADNGPPLTEVLRLLAPTTELLRDYHPALSCGLGSLTVMANNPPL
DVPGVEVLAGFFWGQDRYRYPADLPRVAATGGPQCTDLPKIPYGKAPPFV
VTDTGANPWKYGNRGPIVNSDLLKQIMFGPIDGPPRNSAQIGQPG
315445068YP_004077947.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAADAAGQKPGRGRRSGRKRSGSAELAAVRDAAPADTTRRAEILKTANTV
IAATGLRSSLQQIADAAGILAGSLYHHFDSKEAILVELIRLYHDDLDRIG
DLALRKLDEPDPEPVSAQITALGCAIARCAVEHRAALQMSFYEGPSADPE
LQALSARAPEKVQAAMLQALRAGRWSGEIRSDVDLPTLADRLCQSMLHVG
LDVIRHKARTDDLATLKCRIALNGLASEAPSDASLDRSKAFAAAQSVIST
WADDEDETDLKAAHLRAVARAEFGRRGYEMTTIRDIASAAGLGTGTVYRI
IGSKDELLMSIMLEFGRKVGGAWSDIVRTDSTTVEKLDALSWLNINALDQ
FPDEFRIQLAWLRQSPPDSANPAWSFTTRIRQMKSLLSEGIRAGEIHIDS
PTADMLARCIIGEQWIPENILQEVGPRNALILARDTILRGVAVRT
315445067YP_004077946.1 hypothetical protein Mspyr1_35000 [Mycobacterium gilvum Spyr1]MIDFTGQVVVVTGAGRGLGRLYALELARRGAAVVVNDIGATMHGEGHDTT
VADTVVDEIRAHGGQAVASHESVGSPEGGQAIIDTALTRFGRVDVVISNA
GIFTSIPFESLTAERWRQMLEVHLDGAFYLSRPAYAAMMRQGYGRFVFVS
SSAGNFGQPMEAHYGAAKTGLVGLSNVIAIEGAAHGILSNTVLPTGFSRM
VTETVGDEKFLAESGFLRAIRPELVVPLVTFLASRECTVTHHNYSACAGR
YARVFTALADGWLADTANEPTAEDIERRFGTVSATEPFIVPDSIVDEVLQ
VCDRRGISAMPDNAAVTFPKGPGR
315445066YP_004077945.1 nitric oxide reductase activation protein [Mycobacterium gilvum SpyMTDDTGGERCSGLGMLASALAGRAVAVDSVAGGKPAWTDGETVYVDASAP
LRTQYETVAVQASMIAAGSLTPEVVRALVRHPRLAKRYLAIEGHRALLDN
SALLPSVLAAAMVPDIGRRSDSAERSLALARGREGPAEAPASFGAIQAKK
VLAVRALADKQAGDDVGHVPRRQGGQELAEFDDDDPDNWDDTDDPDLFSS
PVGGGGVIGRWLQKLLSSSRKSGGDGAGPPGADAPTHRTTSTTRGAHAVS
SLAAVSSEEIVDVTTEGVKYPEWNVDRHTYRLDWCTVREVEPEMHAAATQ
QIEDAISVRRPLARLGMGLHRRPRQPQGDDIDIDAALEARVEVRAGSVPD
EAVYLDSLRRQRDLSVLLLLDISGSAAEPGTVGRTVHQQQRTAVAHLMVA
LHDLGDRVSLYAYYSQGRDAVSMVPVKRFDEHLDARVIRRLNSLEPGAYS
RLGAAIRHGSAVLEERGGTSRRLLVVLSDGLAYDHGYERAYGAADARRAL
GEARRRGTGCVCLTVGASTDVDALRRVFGSTAHATVSDPDQLAGVIGPMF
RSAVRSAEVRRRVS
315445065YP_004077944.1 ATPase family protein associated with various cellular activities (MAIESGFAHKNGAGGRLEGRRPYYTPVGNEDTVFKAAYRQGLSIVLKGPT
GCGKTRFVEAVAHDLDRPLITVACHDDLTTADLVGRYLLKGDETVWVDGP
LTRAVREGAICYLDEVVEARQDTTVVLHPLADHRRQLPIERLGVTLDAAP
GFGLVVSYNPGYQSVLKDLKDSTRQRMVAIEFGFPAPEVEVGIVAHEAGV
DERTAAELVRFGQAIRRLETGGLREVASTRVLIAAARLIAEGLPVAVAAQ
VAVAGPLTDDIAVARGLNELIEVYLGETAAND
315445064YP_004077943.1 amino acid ABC transporter substrate-binding protein [MycobacteriumMSYESTAEPIKVGYLMDFTLPPGFPEELRASFTRTFDLVFAEAVEQGLMD
RGVQMIYREVEGLPKGSVKAVIDAYGELVDEGCLVVFGPNITDNCVPLRE
AIEDRFKVPAISVTGTDDWLGEWTFAFPQGSMTDEPIFLIDLVAKRGLKE
IGVLVEQNLIGESYLRNLRSAAARKGIRIVAEEAIAQTAQDIDGAVRALH
EAKSEAIVHLGFGFGIVFINPALEAVDWDPPRFTSTAFQNAWVNPIMWNA
FLGWVGVDQYDEGNRIGQAWLDRYADRYDGSRPEYCVSVVNHDVAATLVR
AFTDAHPLSPRGVKEALERVKMMPAASGAPGTRVSFGKWTRRAWMGAGYL
VARTLDADGVNSHLVDRFGEEA
315445063YP_004077942.1 hypothetical protein Mspyr1_34960 [Mycobacterium gilvum Spyr1]MTTQKAGAPLPQAKPDAGASPRKGPNWGRWISAFALLGFFGLFTAFSRTE
LDPRVANPNVEGRPRPVEFLFGWDGWLWVHQIGCVILLVVLVAIFVRGWR
RDPGSPVMLMFLCTTLIVWQDPIMNWAPFAVYNPELLHWPENWPLIMLSP
TVEPFIVFGYVAFYFAPFFPAIWCLRKLQAKHGPTAFVSRHPLISLGALT
LVIGFIFDAILEVSLVRTGLYIYSQAIPFGTLFPGTTFQFPLIWESLAVT
FVMVPAAVLCYRDDTGKAVAEKLAARAKLFPSKPVLGTFLVMFFIINIAY
FAYGSWFAAIKASGLATAVACPWPYPEAKVYDPQGYFEKEGAQGPFSVGK
WATWQSGLPNGRPEVTPPPPGEGDCAPENADG
315445062YP_004077941.1 hypothetical protein Mspyr1_34950 [Mycobacterium gilvum Spyr1]MAERAGAQRRVALITGASRGLGFASAVRLYREGWGVVAAMRTPERGMPRL
REATGASEDDDRLVGVQLDLMDAASIAAAAKSIDEAVGAPYAVVHNAGIS
AAGVVEETDIELWERMFTTHVMGPVALTKALLPSMRAAGQGRIVLVSSAS
GVRGQPATAPYSAAKGALERWGEATAVEIAPFGLGVTILVTGTYDTDIIT
DAGTTDNRDLAGPYARIHQTMDSRGRFAMGMARPPERFTDGLVKALEDTA
AFRRHGVGPDASMLLLSNRILPAAGMHHMSRVVLGIPRQGAMRDGAWPLT
TAQRAMVAAAKVIPQPVMQRLVQWSTRRAAGSGGGTSEG
315445061YP_004077940.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium gilvum Spyr1]MKADTDTQHAATHESRMLIDGKLVDGEAGSFVNINPATEENLGEVSDASK
ADMLRAIDAARRSFDETGWSTDHQLRRRCLEQLHDAIESEKEELREELIR
EVGAPRAVTHGPQLDAPLADGLRYPARLIDTFPWETDLGDQVVSVTGVNT
TRKVWHEPVGVVGAITPWNFPFEVVLNKLGQALATGNTVVLKPAPDTPFN
ATRLGRLIAEQTDIPAGVVNVVTASDHFVGEELTLSPKVDMISFTGSTAV
GKRIMEKGAATMKRLFLELGGKSATIVLEDADFEFACMLGIGPLMHAGQG
CAAPTRMLLPRSRYDEGVAILKNLYENIAAGDPQDPGTLCGPVISARQQA
RILGYIGRGVEEGATLLVGSAEAPARFDRGFWVDPTLFTDVDNSMTIAQE
EIFGPVLAVIPYDDEDDAVRIANDSAYGLAGNVMSGSLERSLRVARRLRA
GFIGLNGTVGYGADTPFGGYKDSGVGRQNGLAGFGQYTEIKSVAYPAQ
315445060YP_004077939.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MSQLFEDLEDFGSFDDAVSGDVRDPYPELARLRREEPIQRIDMSAMPGEE
GKPVFIVYRYEDAQQMLRDNVTFSSSGVIAAFGPVLGERVMLGMDEPVHG
RLRSLVSKAFSQKGLARWQDELVGRVGNELIDRFQADGKADLVKQFTFDY
PSRIIAGLLGLPEQDYPQFQRWSISLLSWILNPERGLAAAAALCEYFAPI
LEARRTDPQDDLISLLAEAEIDGEKLTDEEIFSFLRLLLPAGVETTYRSL
GNLLFALLSDTAQLDAVRADRSLLPQAIEEGVRWNPPLLTITRTTTCDTE
LGGVPIPAGCSVLPMLGSTNRQEDRWEDPDEFNLFRAQKANLGWGYGVHV
CLGMHLARLEMRTAVNLLLDRLPGLRLDPDGDDPHIRGQVFRSPTSLPVL
FDAVGSDA
315445059YP_004077938.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MTDHPDADGIDFETVDYFTDAALVPDPYPYFDHLRSKCPVTQATPFNVLA
VTGYTEALSVYKNPAFSSCNSVAGPFSGMPFGPGESDDVTDLIEQHRAAV
PMAEHITSQDPPLHTRTRGLLSRLITPKRLKENEDFMWRLADRQLDTFIG
RGSAEFLTDYAKPFSLLVIADLLGVPAEDHEQFKAVFAGETVGELGKEAP
TTHNPLQWLNDKFHAYIEDRRREPRDDVLTELAQAKHEDGSTPDIEDVMN
LSTFLFAAGTETTTKLVSSAVRIIADNPGYEAMLRRDRSKIPAFLEETLR
LESPVKSHFRMAATSTTIGDVDVPAGTTVMVLPGACNRDARKFADPNSFR
PDRQNVREQIAFIRGAHSCPGAPLARAEGRISLERILDRMQDITISEDHH
GPAGDRRYAYEPTFIMRGLSELHITFTEKEH
315445058YP_004077937.1 hypothetical protein Mspyr1_34910 [Mycobacterium gilvum Spyr1]MTGKLEGKVAFITGAARGQGRAHAIAMAREGADIIAVDICRDIPSNPYPL
ATRDDLAETERSVKETGRRVVARVADVRERHELREAVEAGVVDFGKIDIV
VANAGILPMAMGNPDPMGFVDASDVDLVGVMNTVAVAIPHLPDGASVIVT
GSTAGMIRGTTTSPDMGPGGAGYGWSKRIVIEYIEEMSLQLAPRMIRVNG
IHPTNCNTHLLQNEGMYGVFRPDLKMEGKTPTREDAEPLFSLFQAMPIPY
IEPEDMANLGVFLASDDSRYITGQQIRVDAGSLLKWPNGPGG
315445057YP_004077936.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MPVPQRNSPQKPQADVRNGRRPRGEARRLLLDAARELFARKDYRATTTRE
IAEAAGVSEYLLFRHFGSKAGLFREALVVPFTSFLDQFRSTWQSVIPEET
DEEELSRQFVGRLYDVLVDHRGLLLTLVAADGLSAEDIEAAGIADIRRSL
RVLGQISAEGMRLRGLHSEQPDLPAHSTVATIVGMVAMRSTFFGEDPPSR
EIIVDELVQAVLHGFLHRPDREPLSPRPVRPLQQ
315445056YP_004077935.1 hypothetical protein Mspyr1_34890 [Mycobacterium gilvum Spyr1]MGGELSPALIAGLSFAYIGGVVFLAFGVYLSIRRGRLHPLLLVSISAISF
SWIEAPYDWAVYAQFPPELPRMPSWWPMNMTWGGGLPSAVPIGYIAYFVL
PAVIGAALGRRVIARFGWRRPQALLIVGFLVGFGWALLFNGFFGPRLGVF
VYGYVIDGLAIFEGSRYQYPVYDAVAMGLQMMVFTYLLGRVDEQGRNVIE
VWSDRRSSSKIGSSLLSIAAVVVVGHLMYGAVFAPHLATKLGGYVTEGPT
EQLWPPIENQPR
315445055YP_004077934.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MPAHDTVELYYDPYDFAIDDNPYPVWRRMRDEAPLYYNDKYNFFALSRYA
DVSRALPDWQNYRSGKGTTADILFNGIEVPPGILLFEDPPLHDIHRRLLS
RVFTPRRMLAVEDLVRGFCARALDPLRDGDGFDFVGDLGAFMPMRTIGYL
LGIPEEGQEQIRRRTDQNIAVGDAAGDVSATVFAESLALFAEYIEWRSTH
PSDDLMTELLNAEVDEPGGSRRRLERNEVLAYTAMIAGAGGETTARLIGF
MGELLGNHPDQRRELVADPSLIPSAVEETLRFEPPSPVQARYVAHDVEWY
GQTVPEGSFMLLLNGSANRDDARYTDPDTFDIHRTGGHLSFGQGLHFCLG
SALARLEARVAFEEVLTRWPDWEVDYDNAERARTSSVRGWARMPVLAR
315445054YP_004077933.1 acyl-CoA transferase/carnitine dehydratase [Mycobacterium gilvum SpMTEPAPDPARPLAGVRVVEISSFVAVPLAGMTLAQLGAEVLRVDPVGGAA
DYRRWPLTESGDSIYWAGLNKGKKSLAVDMRSGQGQALVARLIADAGVFI
TNVAGRQWHSYDVLRTDRPDLIHAEVSGRHDGGTGVDYTVNAAIGFPLVT
GPPELSTPVNHVLPAWDVTCGIYTALSVVTALRHRDATGHGQQISIPLEN
VALATAGNLSLLTEAMINGTSRQRIGNAVYGTYGQNFTSSDGVSFMVVAL
TGRHFRDLNALTGTTESVAALSRSLDVDFSDEGERYRHREALGGLYAEWF
SAHTGAEISAALSATSVLWERYQTFAETAADARVTDNPLFTELDQPRVGT
HLAAGLPVSIDGVYPRAVPAPALGDDTDSVLGDWLSLDAARIDELRETGT
VA
315445053YP_004077932.1 acyl-CoA thioesterase [Mycobacterium gilvum Spyr1]MSRLLELLEVTQAQPPTWRGPASGPQGKRAYGGQLAAQSLAAAARTVDRS
KAPTAMHLQFLRGGVAGDPTDYAVVNVHDGRTAASRRVDATQGERLLTTS
TVSFAVALPGPEHGRRELPAEDPESLPQTGPPGPAPSLPLDELDLRYVDY
GSGEGFVRRLWWRTVVDLPEDPLLHALIAVYVTDVYLIDPALQVHGHSMR
ARTHRSGTTDSSIWFHHEVRAGEWNLLECRSPAAARGRGVVTANLIRRDG
VLAATLVQEGLIADREPTPPA
315445052YP_004077931.1 acyl-CoA synthetase [Mycobacterium gilvum Spyr1]MTRLADHLRKHGDRIAVMTASAQVSYSELADRVDRFAGGLGTRRQLVLIE
TRNDLSTLVGYLGVLAGGHVAIPVPAAGDHSHILATYRPDVVVDGSGVHV
RSEGAHALHDDLALLLSTSGSTGSPKLVRLSRANLIANATSIAGYLGIDE
TDRAATTLPMSYCYGLSVVHSHLLVGAALILTERSVADPEFWELFARHRG
TSFAGVPYTFELLDRIGFTSMDLPHLRYVTQAGGKMSPERVRRYATAARH
RGWQLFVMYGATEATARMAYLPPDLARERPTAIGVPIPGGEFSIEPVEDW
PDTSSGELVYRGANVMMGYAHGPGDLVLDAGPDVLRTGDIARRGADGLYE
VVGRRSRFVKIYGLRIDLQRLETSLRDAGIPALCTDSGDRLAVVATAEHE
PDEVRRTAAGAAGLPPAVVDVACVPELPKLPSGKPDYPAARTLAAAASAP
APHDGDLRGVFADVLHLDRAEVTEDSSFVDLGGNSLTYVMMSLRLERALG
RLPADWQRMSLRELQNLPAPKPRRWKSWGATLETSVALRAVAIVLIVGSH
VELFELWGGAHILLGVAGYNFGRFCLTPLPRTTRIRHLRTTIAWIAVPSV
LWIAFASLITDDYHASNLLLANKILGPHDSMTAGRLWFVEVLVWTLIALA
ALFCTPAMDRLERRLPFTLAMGFLGVGLALRYDALGITMGDDAMFSLLAF
WFFAAGWAASKATSAWQRAAVTAVLVVGLVGYFDEPSRHLMVLTGLALLI
WVPAIRCPAGVAVVAGVIAEASLYVYLTHYQVYPLFGSHELVGVVAAIVV
GVSVSAAVTLARQRLGRLGSGGRGGLPVGDEPLLDQGRSEDAVAPDQVRG
DDAATARRRR
315445051YP_004077930.1 hypothetical protein Mspyr1_34840 [Mycobacterium gilvum Spyr1]MAVRTPGGSMPRSLHGAADRAADSNALEKLARVGFAASGVLHLLVAYIIA
KLAFVGGGAGGGGNADQSGALATVAGQTGGAVMLWVIAAGLVALGLWYVA
EAVLGSKPKERSNEDKPAWKRVKPLGLAIVNFALAFSAARYAMGSGQSNA
QQNAGWSAQLMQSTGGKALLIAIGIGVAAVGAYHIYKGASEKFLDELRGS
YGKSVTVIGVTGYAAKGLVLAGAGLLVILATVQADPTKATGLDAAVKTLG
QAPFGKFLLIAAAVGIAAFGLYSFVRSRYGRM
315445050YP_004077929.1 hypothetical protein Mspyr1_34830 [Mycobacterium gilvum Spyr1]MTRTDTRAGVGALGEQLAVDYLQGLGLRVLARNWRCRYGELDVVVADDAV
QAVVFVEVKTRTTDRFGGVAEAVTPVKVRRLRRLAGLWLSEQDARWESVR
LDVVTVRIGQGRSPELTHIEGVG
315445049YP_004077928.1 Mg chelatase-like protein [Mycobacterium gilvum Spyr1]MALGRAFSVAVRGVDGEIVEIEADISNGLPGVHLVGLGDAALRESRDRVR
AAITNCKFDWPQARLTLALSPATLPKTGSLYDIALAAAVLSAQTKKTWPR
LDKSVLLGELALDGRVRPVHGVLPAVLAAVHQGWPAVVVPVENLAEASLV
DDIDVWGVRSLGQLQSWLEGRGDLAPRVDSPLRGPEVSADLADVVGQTQA
RYAVEVAAAGGHNLLMTGPPGVGKTMLAQRLPGLLPPLSHKDALEVTAIH
SVAGLLSGDTPLITRPPFVAPHHTSSVVALVGGGSGMARPGALSRAHRGV
LFLDEFPEINSGALEALRTPLEDGEIRLARRDGVARYQCRIQLVLAANLC
PCAPPDPRDCVCGAAERRRYRTKLSGPLVDRVDLRVEMHAAREGTFTDEE
GESTALVRERVWAAREAAAERWRPYGFTTNAEVSGALLRRRFRLGTEAMK
PLRTAVDRGRLSIRGRDRTVRVAWSLCDLAGRVSPSKEDVTAAMSFRGLG
EA
315445048YP_004077927.1 DNA protecting protein DprA [Mycobacterium gilvum Spyr1]MDVMDEATRRAWAYVSRVAEPPHRLLSELVATEGVVAAAERIRRRDIDPK
LLRATEARYDLDCARDDLEVLDRMGGRLLTDTDEEWPHLAFAAFRGVDHA
RRPQGRPPLVLWVLGPLLLCDVAERSAAIVGTRAATSYGEYVAADLAAGL
VERDFAVVSGGAYGIDGAAHRATLAADGDTVAVLAAGLDVPYPAGHSALL
HRVGKHGLLVSEYPPGTRPTRRQFLTRNRLVAALGRATVVIEAGVRSGAA
NTAGWADALGRQVCAVPGPITSASSVGCHELLKRDGVTLVTRAADIVELV
GRSGEFAPDLDRPTTGLDDLDDVELAVFDALPGRGMSTVDEIAVTAGLPA
TDVLGPLTMLNVRGLAVQENGGWKLAKRWPPAAQLPLV
315445047YP_004077926.1 siderophore-interacting protein [Mycobacterium gilvum Spyr1]MAGRPVHTFEVVRTEQLTPHVIRVVLGGNGFDTFTPGDHTDSYVKLVFVA
DDVDVSSLEQPLTLDSFNALPAQHRPTVRTYTVRKADPERREITIDFVVH
GDHGVAGPWAASATPGRRLFVMGPSGAYSPDPAADWHLFAGDESAVPAIS
AALESLPANAIGKVFLEVAGPEDEIELQAPAGVEVSWIYRGSRADLAPEE
SAGDHAPLIDAVKETPWLPGQVQVFIHGEAQAVMHNLRSYIRKERGVDAT
WASSISGYWRRGRTEETFREWKRELAAAEAK
315445046YP_004077925.1 alpha-hydroxyacid dehydrogenase [Mycobacterium gilvum Spyr1]MTFGNYQLEIYLQGLSGIMPAYPMDFAGWEARAQASMPPSVWSYVAGGAG
DENTQRANRTAFDRWGLMPRMLVGTTERDLTVDVFGLTLPSPIFMAPVGV
AGICSQSGHGDLEAARAAARTGVPMAVSTLTEDPLEDVAAEFGDTPGFFQ
LYTPTDRDLAASFVQRAEAAGYKAIIVTLDTWIPGWRPRDLSTSNFPQLR
GRCLSNYTSDPVFRGLLPQPPEENMQATVLQWAGMFGNALSWDDLPWLRS
LTDLPLILKGLCHPDDVRRAKDGGVDGIYCSTHGGRQANGGLPAIDCLPV
VVEAADGLPVLFDSGVRSGADIVKALALGATAVGIGRPYAYGLALGGTDG
LVHVLRSLLAETDLIMAVDGYPTLADLTPDTVRRVT
315445045YP_004077924.1 tyrosine recombinase XerC [Mycobacterium gilvum Spyr1]MDTVLEEFDRYLELERGRSEHTRRAYLGDLRSLFAFLDERSPGTGLGGLT
LPMLRSWLAAHAAADTARSTLARRTSSVKTFTAWAVRRGLIGDDPASRLQ
VPKARRTLPSVLRQDQARDALEAAESGAQQGDPLAVRDRLVVEMLYATGI
RVSELCGLDVDDVDTSRRLLRVLGKGNKQRTVPYGEPAHAALTAWLHEGR
PALATADSGPALLLGARGKRLDPRQARTVVHQTVSAVGGAPDIGPHGLRH
SAATHLLEGGADLRVVQELLGHSSLATTQLYTHVTVARLRAVHDQAHPRA
315445044YP_004077923.1 metalloendopeptidase-like membrane protein [Mycobacterium gilvum SpMRVLVLVATLVAICTAPAEADDGRLEWPMRPRPAVVRAFDAPAPNWQRGH
RGVDLGGAEGQVIQAAASGTVVFAGELAGRPLISVAHPGGLRTTYEPVSP
VVRRGQVVSTGTALGHLVAGHPGCAAAACLHWGAMWGPSSRADYVDPTGL
VVTVTVRLKPLR
315445043YP_004077922.1 30S ribosomal protein S2P [Mycobacterium gilvum Spyr1]MAVVTMKQLLDSGAHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTYI
DSAYEFVKETVAHGGSIMFVGTKKQAQESIAQEATRVGMPYVNQRWLGGM
LTNFQTVHKRLQRMKELEAMEQTGGFEGRTKKEILMLTREKNKLERSLGG
IRDMAKVPSAIWVVDTNKEHLAVAEARKLNIPIIAILDTNCDPDVVDYPI
PGNDDAIRSAALLTKVIASAVAEGLQARAGAGADKAEAGQDGAAAEPLAE
WEQELLAGATTAAPEAAAGEAAAAPEQSS
315445042YP_004077921.1 translation elongation factor Ts (EF-Ts) [Mycobacterium gilvum SpyrMANYTAADVKRLRELTGAGMMDSKNALVEAEGDFDKAVELLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNSETDFVAKNAEFQAVAEQIVAAAAAAK
ATDVDALKAAKLGDTTVEQTIADLSAKIGEKLELRRATYFDGQVETYLHK
RAADLPPAVGVLVEYTGDDKSAAHAVALQIAALKAKYLTREDVPEDIVAN
ERRIAEETARAEGKPEQALTKIVEGRVTGFYKDVVLLDQPSVSDNKKSVK
ALLDEAGVTVTRFARFEVGQA
315445041YP_004077920.1 exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferasMLFVNALSRAELTYSAWRNAKTVLVNVTNTVDTARTAKAVTNGRTSEVAP
ADGGQLHKRRGWEPFLAAAIDLSTGSLAVAVGMTWATASDLELPPTWMLF
FFAPTLVGLCAMRGLYRRSLRRTFLDELPTIESSTALAAMLLLSGLILNP
FLPESEGSSVGRLWMCAAILVPLGRLLWITIKNYHYRHDRLTAPTLIVGN
GRVAAKVVDRLKVTPEYGMTPVGIVDDEMPMMGTDRDKPASIPYLGKLAD
LDSAIAATGAECLIVAFSRTRDEAMSAAVNLAHERGMSVWIVPRIFDTIG
VRSHIDHIGGLPLIAVAHTNPRGWQFTAKHVSDRVLASVGLLLISPLFLT
LMLLVRLSSPGPIFFGQPRIGRDGREFSCLKFRSMREPKESDAAFVRSAD
SAPGGVEGEDRRTTIGKIMRSTSMDELPQLLNVIKGEMSLVGPRPERPEY
VDLFNIQIARYGDRHRVKAGITGWAQVHGLRGKTSIADRAEWDNYYIENW
SLWLDFKILAMTVGAVLRPAE
315445040YP_004077919.1 amidase [Mycobacterium gilvum Spyr1]MTYRHTMERIAAFGDDALADSDAVGLVEALRAGTVSPTELLDAAIARLEK
VDPHLNGLAHAAYDGARARAAQHRRYGGFFDGVPSFLKDNVAVAGMPTMN
GTDAWAPSPAAAHGDFARAYLATGLVPVGKTQMSEFGFSAAAEHPRLGAV
RNPWNTDHTAGASSSGSGAFVAAGVVPIAHANDGGGSIRIPASCNGLVGL
KPSRGRLPLDRDMRQMPLRIVANGVVTRSVRDTAAFYREMEKISAGPKLP
PIGDVTGPGVRRLHIAVCTQSIIREASAEVRDATLATAALLEGLGHRITV
IDNPVPKNFIDDFVLYWSFLAFALVRGGRRTFGASFERTRLDNLTLGLDR
HAARNLHRVPAATARLARTRRITAGLYGTYDALLTPTLAETTPPIGHLDP
TAPYEQIIDRLIEWVAFTPLQNATGEPAISLPLAQSATGLPIGLMFAAPV
GHEARLLELAFELEAAQPWPRLAA
315445039YP_004077918.1 ABC transporter involved in lipoprotein release permease [MycobacteMETSRVGNVPTAIRAPQPAAGSGNTVTCLIRFALANIRRRPERFVLAVLG
IALAIACVTVVRTISASFAATGEESVADVLGSAALWVVPAAGVHYDAQAG
ALIADGDAPEISIPGGWTATRVLSGLVDIDGEGVSLRGSDEIASGTATVG
HALAERLAVVDGGTVTVGGQRLQVSVEAAGQSLTVQTALARSLVGERGWW
LVNAPPGGEHRRDLGAAFGAAVGLPFTPDPAVRPDGDGAGLIYDTVGGSG
PLTFEQKYSALFSGKVTSSTLGLISTIGLGLGFVIAVSSFLAAVTERRRE
FGIMSSIGLADEVLYFFLVESAVIFVTAYLVGVTAAGIAVAVVIPGIASV
ASWLQGAALTAMFLPAMAIVGALVPVHRLLQQRPVSLLGDR
315445038YP_004077917.1 ABC transporter involved in lipoprotein release permease [MycobacteMVLPAITTATGAYLVVLVFGMSAGIREQSESLGYADEISRAVVLIAVTVL
LVGVAEVAVVTTRTVAHRTRELGVLAANGVPRAPVVAALLVEPLLAAVLG
ALAGVLLAVVTGIVLGIAGLVATGVSSAGLAAGSGIAVVVSVAAAVATSV
VPTWKAASRPPVQSLASGA
315445037YP_004077916.1 ABC-type antimicrobial peptide transporter- ATPase component [MycobMTVVDETPDTPTGPVADPAPVIEISDVWKLHKLGDEVVKALMAAELTVMP
GEFVCLMGPSGSGKSTLLNIIGGLDRPTKGNVRIAGTDTATLTESQYAAL
RHDTIGFIFQSYNLIPFLSAMENVELPLMFEPYDRKALRKRAIELLELVG
LGHRINHQPTRMSGGEQQRTAIARSLISNPALVLADEPTANLDHRTGETV
VRMLRDLCSTMGVTVVASTHDPTVADEASRVVRMKDGQIVN
315445036YP_004077915.1 amino acid transporter [Mycobacterium gilvum Spyr1]MTQTEPSPSAGRDKLMTTELVPEQILPKVMTTFGLTAAYVFIICWITGSS
VMAGGGWTAIPMWVLGILTFLVPAGMAVVELGNLWPGQGGVYIWATRTMG
ETWGFIGGYLSWVPVILNAASSPAVVLQLLLLAFHAELGLTTSIILQLVI
LWTVIGLALAKLAANQKIMNVVFVVYGVLTLTIFISGLMFAVENGSATPF
SWAEATIPNFAVAGFLYGTVLLYLLGVETPYNMGAEFLSVRKSGPKMILW
GSAALVAIYLLTTLGTMMALPGDQIDPVTGVIGMLDVAGFPGLMEIGAVV
LAFIVIVALMTYQVAYSRLIFVSGLERHLPRIFTHLNPRTRNPVTAILIQ
GVISSLILVGLYSQSSMANVTVYLQGGLSTVWLLSGFFFLIPVVVARKKY
ADRYESEQFWRIPGGMAGVWTTVVVGSLATAGGIYYSFVTPWIDVPSSTW
MTWVGSISLGMFALGLTVYIFGRRSAHKVSQEDSLAHLAVFDLTNKEEEP
TK
315445035YP_004077914.1 Cu2+-containing amine oxidase [Mycobacterium gilvum Spyr1]MTMEDTRIGADPAAGLAPYPLDPLTAPEIESAAAVVRASDYATPTLKFVM
IQLAEPAKTPSLTFADAPDTPRCAFLTMYDAAAKMIYEAVVDLRAGLIES
WTPIPGRFPSYLVEHMTGVEEKVREDPRWQEAMRRRGVTDFSLAMIDPWP
AGYYGAQDHYDNSPLVCRPLTFMRAAPSEHGYARPVEGLIVTFDLDAMAV
IDVEDHGVVPLPPTAGNYSEAFMFDPNNRPAFTAFRDDVKPIEITQPDGP
SFTVDGWNVKWQKWSLRIGFNPREGITLHEVTYTDRGETRPVLYRASLSE
MVVPYGDSAPTHWNKNVFDMGEVGVGFSANPLTLGCDCLGEIHYFDGTVN
DSAGNAVTIPNAICMHEEDFGISWKHTDFRTEEVEVRRSRRLVISMICTV
GNYEYGFFWYFYNDASIEVEVKLSGVLTTGAVEMAPGEQPRWGKMVAPGI
YGPNHQHFFNFRLDMSVDGPGNSVYEVDSIPEPDPARNPHRNAWITRDTL
VASESDGARDWNWSTGRYWKIANPSRRNELGIPVAYKLVPKDVVPVMVQE
GSYIYDRARFLQHNLWVTRYDPAEKFAAGDYMYQSADTQGLPEFVAGDEP
LEDSDVVLWYTLGAHHVVRPEDWPVMPCAYTGFHLKPIGFFDGNPALDLP
PSPPKACHATRAGLPVAERALES
315445034YP_004077913.1 uridylate kinase [Mycobacterium gilvum Spyr1]MADPVTDQTPESRRAYTRVLLKLGGEMFGGGQVGLDPDVVALVARQIAEV
VRSGAQVAVVIGGGNFFRGAQLQQRGMERTRSDYMGMLGTVMNSLALQDF
LQKEGIDTRVQTAITMGQVAEPYIPLRAVRHLEKGRVVIFGAGMGLPYFS
TDTTAAQRALEIGAEVVLMAKAVDGIYTDDPRLNPAAEMLTAISHREVID
RGLKVADATAFSLCMDNGMPILVFNLLTDGNIARAVAGERIGTLVTT
315445033YP_004077912.1 ribosome recycling factor [Mycobacterium gilvum Spyr1]MIDETLFDAEEKMEKAVSVARDDLASIRTGRANPGMFNRIHIDYYGASTP
ITQLSSINVPEARMVVIKPYEANQLRPIEDAIRNSDLGVNPTNDGNIIRV
SIPQLTEERRRDLVKQAKSKGEDAKVSIRNIRRKAMEELARIKKDGDAGE
DDVTRAEKDLDKSTHQYTSQVDDLVKHKEGELLEV
315445032YP_004077911.1 CDP-diglyceride synthetase [Mycobacterium gilvum Spyr1]MTDQHSTPVGPQPVDEPPKKSSRAGRNLPAAIAVGVLLGGGLIAILIFAP
YLWLALLSAAVAMATYEVSSRLGEAGYRIPFVPLLVGGQATLWLTWPFGP
SGALGGFAATVVVCMIWRLVGHGLNHAPQNYTRDIGATVFLATWVPLFAS
FGALLIYPDDGANRVFCLMLGVVFSDIGGYVAGVLFGRHTMAPAISPKKS
WEGLAGSLLFGVTASVLAVVFLLDKPWWAGVALGLMLVITGTLGDLVESQ
FKRDLGIKDMSNLLPGHGGMMDRIDAALPSAVATWIVLTLLA
315445031YP_004077910.1 23S rRNA m(2)A-2503 methyltransferase [Mycobacterium gilvum Spyr1]MPDPLPLVFDAPRRALPPRHFADLADTERAAAVADLGLPAFRGKQLANQY
FGRLISDPSQMTDLPAGVRDQVAAALFPALLETAREIECDRGETRKVLWR
AVDKTTFESVLMRYPDRNTVCISSQAGCGMACPFCATGQGGLKRNLSTAE
ILEQVRFASAELRDRDGGRLSNIVFMGMGEPLANYNRVVAAVRRITASSP
HGFGISARSVTVSTVGLAPAIRKLADEKLNVTLAVSLHTPDDELRDTLVP
VNNRWKVDEVLDAARYYADLTGRRVSIEYALIRDVNDQPWRADLLGRKLH
AKLGPLVHVNLIPLNPTPGSEWDASPKPVEREFVRRVRAKGVSCTVRDTR
GREIAAACGQLAAQG
315445030YP_004077909.1 hypothetical protein Mspyr1_34630 [Mycobacterium gilvum Spyr1]MREPGLADELEIHALLYRYARAVDTKDWDLYRSVFTEDAHIDYSSAGIPP
GSRDEIADLFSAAFEAIPWTMHYITNIEVLERGSDTASVRAMFYNPMQLP
GMAEQSSCGGYYHHELVRTSDGWRSRHLREDNVWFVNRPGGPS
315445029YP_004077908.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium gilvum Spyr1]MLSPMTTAETETGVLAGDERMLIDGELQNTGSGATFDVIHPASEQVAGVA
TDGTVDDMSRAVGAARRAFDTTDWSRDLDFRYHCMTQLHEALERNKERLR
RVLITEVGCPVSVTGSQIESPIEEVKHWAEHGRNFDYLVDNGVHDTPLGP
ARRKIHYEAVGVVGAITPWNVPFYLNIAETVPALMAGNTVVLKPAQLTPW
SGSEYGRIVAEETDIPAGVFNVVVSNANEVGAALSSDPRVDMITFTGSTA
TGRAILAAGASTVKKTLLELGGKSAHIVLDDADFNSALSMAAMMACVMSG
QSCILPSRILLPRSRYDEGIEILKNMMENFPVGDPWTPGIMQGPQISDTQ
RQKVLGLIKSGIDSGARLVTGGGIPENLPVGYYTQPTLLADVNPDSQVAQ
EEIFGPVLTVTPYDTDEDAVAIANNSIYGLSGEVSGGDLERAFAVATRMR
TGNVTINGKSHFGIGSPFGGTKQSGLGYRNGEEGYKEYLDAKTIGMPDQ
315445028YP_004077907.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MNQPADDAQTPDDVSTRQRILAATAEVLGRSGQTKLSLSEVALQAGVSRP
TLYRWFADKQALLEAFGVHEREMFETGILKATAGLRGTERVDAAMRFIVE
YQQSYSGVRLVDIEPEVVISRLAHIIPLMRAQLEKLLPGANGAVKAATAV
RVAVCHYIVRADDDDQFLAQLRHAVGLRATD
315445027YP_004077906.1 phosphotransferase family protein [Mycobacterium gilvum Spyr1]MSVLSERITSAVGLASHLGRGVRRIGTDTLIGRLLPLPRTIGDLDPAAMS
SLMGRSVTSVAVLDGDAGTSSRARLALTGDGVPATVFVKMAAETVATRLM
GELGNLADTETRFYSRLSAELTGVPRCHGSRFDPRTGRFVLILEDLADAS
AGPCEFPDTLHPIDADRAALVVELLARLHATFWGRLPGHRGAGPLGWLYS
ASEDSASLLTAPLLRTSARRLAERTALPVGRGRFIDENYRAAAALIDRGP
HTVMHGDAHPGNLYFRAGQAGLLDWQAVRRGHPSRELAYTLTTSMTVEGR
RGSQRDLLEVYRRALAAGGGPELDRDDLWDRYRQAALYPYVATLITVGMG
GMQVEDIAMKGLERALEALDDLETVALLEKNL
315445026YP_004077905.1 acyl-CoA transferase/carnitine dehydratase [Mycobacterium gilvum SpMAGPLEGVRVVELGVWVAGPAAGGILADWGADVVKIEPPTGDPARTFGRM
LGIPPQDRHHVSPPFQMDNRGKRSVVLDLASPDGRRSARELIDGADVFVT
NIRVGGLRRIGLDFEALAAANPRLVYGLITGYGTEGPDADRPAYDVAAFW
ARAGLAHLLTRPGDVPPFQRGGMGDHMAGMTLAGAICAALVARARTGTGQ
LVSTSLYRQGAYTVSFDLTTFLITGNPIAIGQREVMGNPCMNNYSAADGK
RFWLVGLQGDRHWPALCAAVQRPDWPTDERFATGRARAANAAELIAELDA
IFAGRTLAEWTDVFAAHPDLFWSPINSMEDVIGDEQFHAAGGIVYVPDDE
AGSVPMVATPADFHGTPAQIGCSAPELGAHTEEVLAELAQRTNRST
315445025YP_004077904.1 hypothetical protein Mspyr1_34580 [Mycobacterium gilvum Spyr1]MAVHITDLARPTFTPQAQVIIDGMAAMAPYCPLTAEALHEQASAQTGLTD
FGDQGYRERMSVLLKAFEELPGLTSFGRTYAFSLMLTFLKGRLQVVDHLK
RHPEVFDIDIAAPMIIAGLPRTGTTHLHSMLAADPALRSLPYWEAQEPLP
PPGEEGTFEPRRQRTGDALNISNTLMPYFALMHEMTVDHIHEDIGLMVQD
FASGFFTTLTHLPRWSDYLRDHDQTPGYQFLRMMLQVLSHQDGSTRRWVL
KSPQHLEQFVPIMNVFPDATVIVTHRDPVDVSVSMATMMTYTMRMSVDDV
DVPTVAGYWIDRIDEMLSACLRDHDKLPAERTIDVRFDEFMADDLAMVQR
VWDTAGYTPSDESRAAVAEYLAGHTRGRLGTVDYRAEDLGLDRDELRRRF
APYVERFVR
315445024YP_004077903.1 hypothetical protein Mspyr1_34570 [Mycobacterium gilvum Spyr1]MSSTESAAAWRELLSAFAEFDNQFLDGPKAVRGQTAVAEGYQNLATMLAL
SLDMHFFADPVAPRFLDTLTPFRPDRRWGGDNTDCYYGYAVVDPRRTYRV
SGTPNDSVMYSITVYNEPEPGAWPNRTVGLLYDTDMPIGEDGRFSCVLGP
RRPDGYGGPFIELAPDARGIITRDYHEHPESGARVEWDIEVVDHAGLEVV
PAKSDADVARSLRATLRFAQDMYALIPLILAERKPVELADGQSLSLNTLA
PPYRAGAATHGFSMQDACYSLGGFSLEPGEALVITSTHPRCRFWNLTLWN
QYMAALDVEYGRAGINSGSAVPNSDGSVTIVVSTEQLAHPNALSTKGHPE
GLMSFRWFLSDDLPERPVAEVVPVAQAPVSVS
315445023YP_004077902.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MGRKGWGGVPPTDDAEARDRILRAALASIERRGPRLTTLTEVAADLGITR
PTIYRHFGSTDELLAAAAEIALDHWTARIGRMAVRLEDATDFLVEAVAYL
IEKLPHEPLLATMLETDRTRVMSRQMVMPAAVRRSREMLENTRIDWASAG
FGGSRMDDLVEFLLRMIQSMVIAPPDPPRDPVALREYLRLWIGPAMAAGA
GPVS
315445022YP_004077901.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MTMPSPAPGSADPDNPTRQRILAATAEVLGRNGTTRLSLSEVAAQAGVSR
PTLYRYFADKRELLDVFVVWERQYYERAIAKATAELPAHERLDAALRVIV
EYQLSYPGMRMVDVEPDQVIRRMSRVLPLMRERLERLCTGPDAALSAATA
VRVAISQYLVRSDDSADFLAQLRHAARVRHPGR
315445021YP_004077900.1 ferredoxin [Mycobacterium gilvum Spyr1]MKVEVDLAKCTGHGICETIAEDVFEVQDDGTVVILDAVRPESDRERLQQA
VTQCPAAALRLRES
315445020YP_004077899.1 hypothetical protein Mspyr1_34530 [Mycobacterium gilvum Spyr1]MSDSYYELVDADDARGERFAATDLVRSTWSASIQHAAPVSALLVRALEHC
ERRDDTRLSRVLVDLLGPVPAEGDLWVRARIERPGRQIELLVTELLAPGP
DGEPRPVARASGWRLQTLDTVAVLHAPAAPLRPLSQARSRDMKKDWDRNY
VHSLDWRWLTAPMADGPGESWIRPEVDLVGGEAMTPLQRLFAVADDANGI
GTRLDIRRWTFLNTDLAVHIHRLPAGEWIGIRAETSYGPDGIGTTIGTLF
DQTGAVGAIQQSVLVRPR
315445019YP_004077898.1 gluconolactonase [Mycobacterium gilvum Spyr1]MTLTPLADGFCFGEGPRWFEGLVWFSDMLGEAVHTVTLDGATSTLALPGH
APSGLGFRPDGTLLIVSTELRQVLGYDGETVVTVADLSALVPANLGDMTV
DRHGCAYVGSQARDGGVIVRVDPDTGRATVVAENLQFPNGMALTADGATL
IVAESTGRRLTAYSVADDGTLSDRRIFADGLDGPPDGICLDDEGGVWVGM
TLAHQFERVVETGGQARVTDRIDMGGRTAIACTLGGPEGRTLFLVTTTDA
YPERLRGTTLSRLDAVTVDVPAAGFVGEVHVH
315445018YP_004077897.1 hypothetical protein Mspyr1_34510 [Mycobacterium gilvum Spyr1]MNMKKYHSHTLLYLHETMDLGTARGDRFIAEFSAVYHPMMSELGARLFAI
WETTPYNGHWPQVTIIWEIDAFADYARIGRAQARGGSHEAAAAAWSTYLH
DTGVRGEGRIMYAGRSNRTLAQLQEADFKAGLVIQEVMQTKPGRQDDYIR
ELERLYVPWSESTGKRWLGSFITTFRFNEVIHYWALEGDWACFENHYPSW
KDSPPAEIVTWMSVAPALRDGWEDSILAALPPSPLQ
315445017YP_004077896.1 cytochrome P450 [Mycobacterium gilvum Spyr1]MRYDPFDPAVMADPLPYYRVLRDEHPVHYLETWDTYALSRFDDIWNMLEI
NDGTFVASEGTLPAAAVLARHNDGPVADPPLHPMPFHANFDSPIYEDVRR
CTATPFRPKNVAKLRDRIRVLANERLDELLPLGRFDLTQDYGGIVAASVV
CELVGLPAEMAADVLATVNAGSLAQPGSGVEVANARPGYLEYLTPVVERT
RAGEPGDLPIVDNLLAYRLPDGSALSDMEAAVQMLGVFIGGTETVPKIVA
HGLWELSSRPDQLADVVSDLDANVPVAREEMIRYCAPAQWFARTLRRPFT
LHGTTMRPGQRIISLLASANRDEREYPQPDEFLWNRPIARLLAFGRGQHF
CLGAHLARLEITIMVTEWLKRVPEFRVDAAAASRPPSSFQWGWNNLPVDV
HGVGG
315445016YP_004077895.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMWSYRLVAPYTFERTEQPQRSPESLAENQVLLRFLAGGICGSDLPGFRGA
RGRLAFDTGRQAAEKDGFPIHEVVGEVLASRHLAHTPGDRVVGWASGFDG
LAEEVVADGEGLASYDPSLDPAHAVALQPLACVLYAVEQMPDLAGRHVAI
LGQGSIGLLFSYVAKAAGAAHVTGVDPVDRSAVGAAFGVDTVVRATSDRW
VSHLGADDRPDVVIEAVGHQVATLTHAVEAAAFGGFVFYFGVPDDDWYPI
SMRTMLRNNLTLKAGVTLERRRVLRCADEFAAAHPGLLDRYLTHTFGVDD
VQQAFELAARPVPGRVKIAIEAR
315445015YP_004077894.1 2-4-dihydroxyhept-2-ene-1-7-dioic acid aldolase [Mycobacterium gilvMVGPTVIGPEEYAAAGYDYVGIDVQHSYLSDADVALMLRRLEHVPIATLV
RLPDAAPAPIGRVLDAGADGVIIAMVESAADAAAAVAATRYTPGGVRSFG
PLRASLGLDPSALQERASVFAMIETTRGLAAVDEICRVDGLTGIYVGPAD
LAISMGHGPTDAWSRRDVFDVILTAQRAAAAAGVVSGIHASAGSAGNMLA
QNGFQMITLASESQALRRGAAAHLSDARGESGDGR
315445014YP_004077893.1 hypothetical protein Mspyr1_34470 [Mycobacterium gilvum Spyr1]MAADRIALVTGAARGQGAAIVTRLLQDGFRVAACDLLGDDVTRTVAAHDT
DHAVAIELDVTSAEQWTRAVGEVVDRFGGLSTLVNNAGVLHRASLADETP
DGFEGSWRVNSLGPFLGIQAALPHLKAAEGAAIVNTCSTGAIRPFPNHAA
YGSSKWALRGLTQVAAVELAPSGIRVNAVFPGPVETPMLDANTQTRLAAN
ALMGRIGKPMEIADAVAFLVSEHATFITGSELIVDGGQSLQIG
315445013YP_004077892.1 flavoprotein involved in K+ transport [Mycobacterium gilvum Spyr1]MAKSLSVGIIGAGPGGLALGIFLRRAGFDDFTIFDREDGVGGTWRINTYP
GLACDVKSHLYSYSFDLNAHWSRLWSGQKEILEYFERCAQRYRLQEKLRC
NTEIVSARWVPSERRWRLRTSTGAEHSFDVVVSAVGMFTQPVMPDLVEEE
PFTGTVMHTARWDHSVDLRGARVAVLGTGSTAAQLVPEVAKQAAAVYSVQ
RSPTWVLPKPDRPYTDREKWMFAHVPFAKKIYRTRLWLRSESNISVIEHG
SDKTQEFKSIALRTLEATVSDDELRARLTPDHPLGCKRLVFATDYLKTLT
EPHVDVVSSPARALRSRSLVTEDGTELDVDVVLCATGYAAADYLGQIDVR
GADDIPLSQTWRDGAFAYLGMSVPGYPNFFMLYGPNTNVGSNSVIFVLEA
QARYIVRALKYLRRRNRSYIEVRSDVMKRYLDKIDSWMQGTVWLTRCSNY
FRAPNGRVVTQWPRSARDFWALTRWFRAGDYVFEAPSARETISVGAQAEA
ER
315445012YP_004077891.1 esterase/lipase [Mycobacterium gilvum Spyr1]MTRDIAERLDPQLRHLAAARTDLSPPVLGAVRDSLNQRRAETARTADLIG
VEVEQREVPVPAGHTVTVRIYRGGPPQSPAVIYCHSGAFVLGNLDTDHRQ
CIEMARRGRCTVLSVDYRLAPEHPYPAAQDDVSAILDWAVRCSAELGIDA
TAVAVAGSSAGAALAAGLARRSAAGEGPPVVFQMLHQPVLDDRPSPSKDE
FTTTPGFDAEAVAWMWRHYGGDASLPDEAVPARIDEMSSLPAALITCSEL
DPLRDEALDYALRLLWAGVAAELHVFSGTCHGFDSLVPEWEISRQLFDIQ
GTALRRAFLR
315445011YP_004077890.1 hypothetical protein Mspyr1_34440 [Mycobacterium gilvum Spyr1]MGIVTTTSETAFTQSPEQIYDFVTNPVNWTRTYPGSAHVGRIPEKLPLEV
GDTWTETGPDGSRIFTWHLAIAMRPKLWMFNSVGNLGHDSDGNGGMPGRI
TVQYKFTQPGEGITLFSRTMTVEAYRDAPLPDGFFRTVNPANIDAYHEAV
ARELALEDSA
315445010YP_004077889.1 acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]MDFSEVELCDADKAFRDEVREFLAAVVTDDVIRRDLESGDNFDEQVHLAL
GSAGYLERDWRAEADGGFTAVQRRIFELEIGRAHTPWFHWPTTAMVANAV
DHFGSDELKDEVLPQVLAGRYRLCLGYTEPEGGSDIATCKTRAVREADGS
TWIINGSKMFTSNAHHAQYVYLITNTDPQAPKHQSLTMFLVPLDSPGVEI
QPIRTVDGDRTNITFYSDVRVDDRYRIGPVNGGWGVLREALNAEHGTVER
DASGLQKIAVMTEHALLLAEEVDRVASVVGDRLGDGEVAYRLGRSVARLE
AALSTPEMFGRVAIAQTLRDITPDLMDILGPASALPSGRSAEYLFRLALP
MGIYGGTLDVFRNMIAQHALGLGKPNYSPPR
315445009YP_004077888.1 hypothetical protein Mspyr1_34420 [Mycobacterium gilvum Spyr1]MCPDLSVRNGKLAHMFDSLVPEPGALAGLSDAELVDAAGAAARAENAVCA
RKLAVMAELFTRRVDLAPEDRLNWWVDPDAAVAAEIAAAVTITQGLATHQ
TYRAVVLRDRLPKVGALFLAGLLSELLVRAIITRTDLITDPELIAAVDAD
LAADILHWGPQSAKKTEAAIDHIVERHDPDAVRQSRQHDVGRTIEIGNPG
DAPGYTTVWARMFAGDAAAGQRTLTAMAYSVCDNDPRTLDERRNDALTAL
FHGITTLACRCANDDCDAATNPRPPRELTVYALTDQTTADAVSEEPRGDA
TAESDNEDATETDGVAAADADCTSAQQPTPPPTSSPPTAPKPRRSKPTLL
PGRSGYLFGAGFMPAPLFDALLDDALLDGAKIREILHPGQAGPEPRYTPS
TALADFIRCRDLTCRFPGCDTPATEADIDHTVAHPVGPTHASNLKCLCRF
HHLLKTFWTGPGGWHDRQHPDGTITWTSPTGHTYITHPGSRLLFPTLCRP
TATLWTGDPPQVPIRERRGAMMPRRAKTRAQNRAAYITAERTHNVEHRTD
SPRGNDPPF
315445008YP_004077887.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMRRPEIGVYLPQMGFSFDEVLHRARRCEDLGIDSLWLYDHLYGPGMPDYP
SMEAWTLATALLSRTERLRIGHMVLCNQFRHPVTLAKMVTTLDQISGGRL
SLGIGSGSIEDEHRRAGLPWGTFAERSAQLGETLQILRQAFTDERVDFAG
RHFTVTDFPIKPGPVQKSGPPIVVGGVGEKYTLPLVARYADVWNVPTYAL
DQIEPKIAVLRSICEDIGRDPDSIVLSIEAVMAVAPDQESLESVRMLAEK
RFRGPGFGLHDTGLIGTPAEIAAKLGRLVEIGFGQIVLFTHDRCSDQTLE
LLASEIIPRL
315445007YP_004077886.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMQFAITHPMHSHPYNPELVTGAGIARVAVAAEKAGFGGFGFTDHPAPTQR
WLEAGGHDALDPFVAMGFAAAHTTTLRLIPNIVVLPYRNPFVVAKAGATL
DLISEGRFTLAVGVGYLKREFAALGVEFDERAAVFEEALDVITQIWTTDD
LSYEGRNFSAKGITAHPKPLSTPHPPIWVGGNTSAARARVAKYAQGWCPF
RAPAMLAQTARTAALETTEHLAKGIDDLRRRLEDAGRDPADVDITFTNDA
GGAPGTDDFNADEFLAGAEELERAGVTWLQVNVPGDSLAHAVEAIEGFGE
TVIAQR
315445006YP_004077885.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MGRKGWAGAPPRDDEEARTRIIEAALTCIERHGPSQTSLSDVADTLGITR
RTVYRYFATTEDLFTAAAEVALGGFVRRIETITADIDDVAGQLVEVVAFI
VERLPEEPLLTLLLENDRTNQFSRRMLSAPVIDRCRVILRHSRIDWEGLG
YVSDADIDELIEFLLRMIQSMVIAPPEPPRDSAALRSYLHRWIGPALTAG
R
315445005YP_004077884.1 metal-dependent hydrolase [Mycobacterium gilvum Spyr1]MTELHVRRPRFDFTADVPWQWNPASPAFSYFMNATSIIAVCFEQMIVAAV
TEARPLISDPSVAEEATAFLRQEAQHSASHRKHVNALIAHYPGLQHTVDA
TMAEFDALTASTPLAYRLAYIADLEATFTPSFKLMLDNEASLFRPGDERV
ASLFLWHFVEEVEHRSSALVIYDAVIGDPWYRLRKVPAVVRHLLGVIAVI
AEGVNTHIPESDRAVDARTMHPWHGTRTALRQRISRDRHTAPPAFAGVPR
TQKLIAGWRVLLSQLPFHDPADEPLPGFADEWFARWERGEDVTRWYSSRR
AG
315445004YP_004077883.1 NADP-dependent oxidoreductase [Mycobacterium gilvum Spyr1]MSTLTNRQILLRRRPTGLVDPEDTELVSVPAPEPADGEALVRTTYVGIDA
AARTWLDDQPGYLPPVGLGEVIRAAGIGEVIESRCEAYAVGDIVTTLTGF
QEYTLVRDDLFTTPVPGPADQVDQLAVMSIYGPTGATAYFGMVGIGRPQQ
GETVVVSAAAGATGSVAGQIAKIAGARVVGIAGGPHKCRAVVEDFGFDAC
IDYRNDDLRAELKRHCPQGVNVYFDNVGGPILDAVLGRLAHKARVVLCGV
ISSYLTGEHPGPANYVNLLAKTATMQGFNALDEWGRFDEAFTALRRWEEQ
GLLTHREHIFDGIESCVDALNGLFTGANIGKTLVRLGIGDDASTRSS
315445003YP_004077882.1 acyl-CoA thioesterase [Mycobacterium gilvum Spyr1]MTGVKLSWISQFLQFERRGDTFVTTPPEVAPGLRLFGGLIAAQALGAAGA
TVDPGKHPQSLHLYFVRGGRYDADVELQVERTRDGRSFDTRRVTAVQQGA
VILEMIASFHTPEPGADEFPPHPPSVTLDETESMEPDVEFTDLFEIRTGP
GDPSICVIPPFWIRSREQVEDDPLIRACALTFLSDFGPVPAAHPQHTPLR
PGTGQAASLDHSVWFHRPFDPHEWHRYEVHPLNVGDSRGLVHGSLYDGSG
SLVATTTQEALWRL
315445002YP_004077881.1 hypothetical protein Mspyr1_34350 [Mycobacterium gilvum Spyr1]MSLVAGRGPLSRDRAGQLIPPVADDLVYVEPHPRRVQAVLGGRTVIDTEH
ALMVHRRGAPLSYAFSAGDIGDLPSTPVPEAPGYAVVPWSAVDSWFEEGR
ELVHYPPNPYHRVDCRPTARRLRVDAGEVTLVDTTDTTILFETALPPRLY
VRPSAVRTDLLRRSSTTSYCNYKGYATYWSLNLDGTVVDDVAWSYADPPP
ESLPIAGMVSFDETRVAVTAELPATPERG
315445001YP_004077880.1 diacylglycerol O-acyltransferase [Mycobacterium gilvum Spyr1]MAAVKRLNGVDAMMLYSETPEIHMHTLKIGVLDVSGIGGYDFEFFRRAAL
PRLHALAPLRYQLVDIPWKLHHPMWIQNAEIDVDYHLRRATVAAPGGRRE
LDQLIGEIAGTPLDRTRPLWEMYIADGLADNKIAVIHKVHHVLADGVASA
NQLAMAIQPREPAVGGQLEAVPADSMGRANLLAGAGRDHWRQVRRLPKLV
GETASGVSRVRRKARERGANPDLAKNFAPPPTFFNHVVTPGRRFATAPLS
LADVKETARHLGVTLNDIVLATAAGALRQLQLTYDGHANSPLIAGVPVSF
NSSPDRLMGNEFTYMTPSLPVHIEDPLERVKLTATATAIAKENHNLLGPT
LLPSWLTYLPPGTTPQVFRSQARRVESAMVMNLTISNVPGPRERGCMEGA
VIDEIYSVGPIVAGSGMNITVWSYVDQLSISVLTDDRTLKDPHEATDALL
ASFVEIRRAAGLPEELTPVEKAMPPAPAL
315445000YP_004077879.1 hypothetical protein Mspyr1_34330 [Mycobacterium gilvum Spyr1]MTMFEVDGLGSSERAGSGVRVSAEVVHSYDLTVIAADVDGVVASAGGWLC
DRVRAGWQVTVLVAAGADTGALTVLGVRDEALDSAAAALRRPTAAVAVDT
RVLTHDENARTEVLRLLDSGRTEVTVWGTPSPVTSELLSDARFDTVCHRA
SAAARAFKAGALRTCGHDATGPSVETFISAGLWYPPDGGDLVPV
315444999YP_004077878.1 hypothetical protein Mspyr1_34320 [Mycobacterium gilvum Spyr1]MASSRRFIPAGKPADGEGLHRYRVVAVTSDIAALVEYAGGFLCDRARAGW
NVRVLVDGPGETRPLTILGVSADAVSGQTDAGAAMSGFGPGTTVIVGADL
LTRDSRLRASAARLATAGAAVHVWGPPSYPGCRPAPIQHELSTAAQAFKN
SALRAARIDRAAEPVETLYRLADGSPRRLRSV
315444998YP_004077877.1 hypothetical protein Mspyr1_34310 [Mycobacterium gilvum Spyr1]MASTEVERHTGVDVEEVPSAQWGWSSGSVRGYQIGGTIVGIFFLLLTIGN
HQGHVEDLFMIGFALLTFGLVARSVYTTRNRDTR
315444997YP_004077876.1 hypothetical protein Mspyr1_34300 [Mycobacterium gilvum Spyr1]MTADAPHGLFDGKVVLVTGAARGQGRAHAVRFAEEGADVIAVDVCAQLDS
VAYPMSTPEDLDETARLVEKTGRRVVAEQCDVRDRDRLADVVAAGVEEFG
RLDFVLANAGILPIAGDQGRSITAFTDAVAVMLNGVYFTVDAALPALLRN
PDGGAIVITSSAAGFTSVSTGFDTMNHGAAGYTAAKHGVIGVMRHFARSL
AEKNIRVNSVHPGGVATPMVLNEALAQWSGEHPSFSQAQQALLAMPMMEP
EHISDTMVYLCGPAGRYVTGVALPVDAGQTLK
315444996YP_004077875.1 deoxyribodipyrimidine photo-lyase type I [Mycobacterium gilvum SpyrMLWFRRDLRLADLPALVAAAEVDGDVLACYVLDPRLKATGGSRRLQYLYD
ALRDLRESLDGRLLITRGDPVSRIPVLAAAVGASSVHVSEDFTPFGMRRD
EQVRDALGDVELVATGSPYLVSPGRVTKGDGSPYKVFTPFFDAWRQHGWR
PPAESGPRSAHWLDPADVAGKPGITDIPDAGVELDLPAGETAARRQWKQF
VDDGLAGYAEDRNRPDLAATSRMSAHLKFGTIHPRTLAADLGRGKGAQAY
LRELAFRDFYAAVVAEWPRSTWWNWNSTFDAIEVDDGPDAQRAFEAWKAG
RTGFPIVDAGMRQLAETGFVHNRVRMIVASFLVKDLHLPWQWGARWFLDQ
LTDGDMANNQHGWQWAAGCGTDAAPYFRVFNPTTQGKKFDPAGVYVKRWV
EELRDVASSVDVHNLDRDRPADYPEPIVDHAQERAEALRRYNSLRG
315444995YP_004077874.1 secreted/surface protein with fasciclin-like repeats [MycobacteriumMTIMMKSFAGAGLAVTAALGLSFATATTASAAPAGPGCAAYVQQVPEGPG
SVQGMAMDPVATAASNNPLLTTLTKAVSGQLNPNVNLVDTLNGAEFTVFA
PTDEAFAKLDPATVETLKTDSNLLTNILTYHVVPGQAAPDQVVGEHVTVQ
GATVNVTGAPDHLMVNDASVACGGVQTANATVYLIDTVLMPPAM
315444994YP_004077873.1 secreted/surface protein with fasciclin-like repeats [MycobacteriumMAIFGAACSSEEAGNNASSATSSATSAMESATSEMTTSSSAPMADPAANL
IGSGCAAYAEQVPEGPGSVAGMAADPVTVAASNNPMLTTLTQALSGQLNP
NVNLVDTLDGAEFTVFAPTDDAFAKIDPATLETLKTDNELLTSILTYHVV
PGQAAPDAVAGEHTTVQGAPLTVTGAGNDLMVNDAGLVCGGVKTANATVY
MIDTVLMPPAN
315444993YP_004077872.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium gilvMNERLRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNRDLLARQR
AETGVTNIAVADEAAAAALGEVTYSGPDAVTRLVEATEADVVLNGLVGAL
GLKPTLAALATGARLALANKESLVAGGPLVQKAAAPGQIVPVDSEHSALA
QCLRGGSADEVATLVLTASGGPFRGWSADRLEDVTPEQAGAHPTWSMGPM
NTLNSASLVNKGLELIETHLLFGIDYDRIDVVVHPQSIVHSMVTFTDGST
LAQASPPDMKLPIALALGWPARVAGAAAACDFSTASRWDFEPLDDEVFPA
VALAREAGKTGGCMTAIYNAANEEAAEAFLAGRIRFPAIVRTIAEVLRAA
DQWAAEPATVDDVLDAQNWARDRARSAVERESAGSRS
315444992YP_004077871.1 Zn-dependent protease [Mycobacterium gilvum Spyr1]MMYVLGVTLFALAILVSVALHECGHMWVARATGMKVRRYFVGFGPTLWST
RRPNKLGETEYGIKAVPLGGFCDIAGMTAVEELDPADRPYAMYRQKTWKR
VAVLFAGPAMNFIIGLVLIYGIAIVWGLPNITAPTTAVVGETSCIKSEVT
QGELGDCVANSPAAAAGIEAGDVIVRVGDTEVPTFDALVEAVRQESDPTV
LTVQRDENGQVREFTTTVDVTPSQRYVAGEDGGPAVPVDVGSIGVTAAQF
GPTQYNAFTAVPGTFVFTKDLAVELGKAVVKIPTKIGALVDSISGGERDP
ETPISVVGASRIGGETVEAGIWVAFWFFLAQLNFVLGGINLVPLLPLDGG
HITIALYEKVRNKIREARGKVAAAPVNYLKLMPLTYVVIIVMVGFTLLTV
TADVVNPITLFQ
315444991YP_004077870.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [MycobacteriumMTSTAGVGLGMPAPPPPVLAPRRKTRQLMVGDVGVGSDHPIAVQSMCTTK
THDINATLQQIAELTASGCDIVRVACPRQEDADALPAIAKKANIPVIADI
HFQPKYIFAAIDAGCAAVRVNPGNIKEFDGRVKEVAKAAGDAGIPIRIGV
NAGSLDPRILKKYGKATPEALVESAMWEASLFEEHGFGDIKISVKHNDPV
IMVAAYEQLAAQCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSKGIGDTI
RVSLSAPPAEEVKVGNQILESLNLRPRGLEIVSCPSCGRAQVDVYTLANE
VTAGLEGLEVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVKGEVI
KTVPEALIVETLIEEAMRLAADMDTTPGSEEASGSPVVTVS
315444990YP_004077869.1 acyltransferase [Mycobacterium gilvum Spyr1]MSAPPLFRLVDERRVSVVRDIQAVRQVLDDDPVASCMVASRVAEHGIDPA
AIGGELWTRRRANESLCFAGANLIPLRGGAGDLNAFADKAMSSVRRCSSL
VGRAELVLPMWQRLEPVWGPARDVRAHQPLMALNTAPSCPTDPAVRPVRM
EELDAYLVAAIDMFIGEVGIDPRLGDGGRGYRRRVAGLIAAGRAWARFER
GEVVYKAEVGSQSPAVGQIQGVWVHPERRGCGLGTAGTASVAAAVVGAGR
IASLYVNSFNTVARATYARIGFTEIASFATVLLD
315444989YP_004077868.1 hypothetical protein Mspyr1_34220 [Mycobacterium gilvum Spyr1]MTEHDSTATRREIADAMMKALDRRHELLDAVVASEDYDAAIEAIADLLDA
SAEASEAVLRLSFDRLTKVSRRRIAAELENLNSKVLTFASSEQTPGSARR
LMLRPFSAADDRDVFAERTADVRSAGDGTAAPAGDLGDEIRAAVTRMAAE
EAVWLVAEVGSTKVGMVFGELADGEVDVRIWIHPAHRKHGFGTAALRASR
SEMAAYFPAVPLVVRAPAAG
315444988YP_004077867.1 cell division protein FtsI/penicillin-binding protein 2 [MycobacterMASLFTSVTRAAALASAAALVVTLGACTPRPNGPEPTAEEFFEALATGDT
GAAAQLADDPEGARAALNEAWAGLQATGLQAQILSSKYAEDTGSVTYRYT
WHLPKDRTWTYDGQLNLVRDEGRWEVRWSATGLHPRLGENQTFALRAEAP
PRASVHERTGTNVLVPGYRYHVALDAKAAGADLMATARTVAGELHRFDNT
LDPQRLAELASSTRGALSLITLNQADHDAVAPALRSLPGVVITPQPEMVP
TDPTFAPAVVNEVKKNVAEDLDGDPGWRVVTVNQNGVDVDVLNEVAGTPA
PSVSISLDRSVQTAAQNAVNITGKQAMIVVIKPSTGEILAVAQNAAADRE
GPLATMGLYPPGSTFKIVTAGAAIERQMATPNTLLGCPGRMDIGHRTVPN
YGGFDLGTVPMSRAFASSCNTTFAELASRMPPRGLTEAASQYGIGLDYDI
PGLSTVSGSVPPTVNLTERTEDGFGQGKVLASPFGMALAAATVAAGHTPV
PQLIAGRETAVTGAQQQIPQDVVEGLRPMMRLVVTNGSAKDLAGSGDVRG
KTGEAEFAGGSHSWFTGYRGDMAFSALIVGGGSSEYAVRMLKGMLDSLPP
DYQA
315444987YP_004077866.1 hypothetical protein Mspyr1_34200 [Mycobacterium gilvum Spyr1]MTDINHGRSLEPVEMRISDADRNGTLRRLHNAVALGLIDIGEFEERSAMV
SRARQRSELDALVGDLPGPGAIVTSAADRVELRGVLGSLKRQGEWVVPSR
LALHRRMGSVDLDLTRARFAGPIVVIELDMRFGGLDLRLPDGASASIDDV
EVNVGSAHDHRRDAPAEGNPHVILTGKVVCGSVDIRGPRKSWRPGLFRAT
315444986YP_004077865.1 hypothetical protein Mspyr1_34190 [Mycobacterium gilvum Spyr1]MTVSRFAPEQLIARACEATGLDDFGEDDTWRDGLDLVCDGLTTDARLNEI
GVEIAAADLHRALTSRLHIVGWRMQHPEIAAAPVTRPIFIVGQPRTGTTI
LFDLLAQDPALRPPLTWEVDNPFPLPRPDTYTSDPRIAQTQASIEMSEQI
VPGLLGHHPMGALVGQECVRIVAGQFCSMIYPTQYRMPDYYRWLLYKADH
GPAYRYHRMFLQYLQSGVGGPSCQWLLKSPAHLWQLEALLAEYPDALIVQ
THRDPLNVIASISALLHHLRRLASDDSSIPECAAQSREQIVAGLEYAVRL
RDSGVPAANQIVDVHFRDFMRDPFETIRALYARLGRELEPVAEQRMRDFL
AAHPGDHAGNRYRWADTGLDAAEVRAQVRTYQERFGVPDEVLR
315444985YP_004077864.1 hypothetical protein Mspyr1_34180 [Mycobacterium gilvum Spyr1]MDADGNVREWAAASLGAWTFVQQMLADLTKTVIEDATSERELLEGLSVLA
KVTALCTEMTVEADPQRPRFFEMSTDTRLLGGSNPDGRYLLAMIRGDRTY
RVIGSRGDSAYLGFQVLAGSGMNPRRMAAYLSDRELHCSRGTFNFVLSAH
EPAPEVLGAAQWVQIPADATSIVVREYIADFDSELAAMMTIECLDSRPAE
PLSDPALAETFTAMAWTIVKLITLHRTIKPELLTRPNVLVTAEAAELGSA
DTTPDNLYMIGSFALDSDETLVLEFTPPDTRYWNVALESVWHECVAPRRQ
GGSVTNAGVRPDSAGQVRIAIGARDFGHGHWLDTGGRRRGFVVVRWLDNP
QAPTVRSTVVRGAP
315444984YP_004077863.1 TetR family transcriptional regulator [Mycobacterium gilvum Spyr1]MDAVSGPKSGESLTVRRQRATKARIAAAAAQAVAAHGLAGATIEHIAAAA
EVGRATFFRYFSAKEDAVVEGMAAHWLDAIADAIAAQPPELAADAAVVAA
FQDLGHGFEAVSDQVRELAVMTRSSPVFSAWTLQLYLRYEAAIADLVGIR
MADPAPDDPRPRLLGALAMASVRIALDDWLVHGGSLPERVRTALASLHVA
315444983YP_004077862.1 hypothetical protein Mspyr1_34160 [Mycobacterium gilvum Spyr1]MQVTPGHLFAQLDFRDVEDTDERMVIELDNRPDLVNRRGALQGGLVATLI
DIAAGRLADRHVGPGQDVTTADLTIHYLAPVLEGPARAVATVVRAGRRVS
VIAVDVIDVARDRLAARATVSFAVLDPR
315444982YP_004077861.1 methionine aminopeptidase [Mycobacterium gilvum Spyr1]MSVRTALRPGTVSPMLAVPKSIERPEYVGKPTAREGSEPWVQTPEVIEKM
RVAGRIAAGALAEAGKAVAPGVTTDRLDRIAHDYMVDHGAYPSTLGYKGF
PKSCCTSLNEVICHGIPDSTVIEDGDIVNIDVTAYIDGVHGDTNATFLAG
NVSEEHRLLVERTHEATMRAIKAVKPGRALSVVGRVIEAYANRFGYNVVR
DFTGHGIGTTFHNGLVVLHYDQPSVQTVLEPGMTFTIEPMINLGSLDYEI
WDDDWTVATRDKKWTAQFEHTLVVTESGAEILTQL
315444981YP_004077860.1 hypothetical protein Mspyr1_34140 [Mycobacterium gilvum Spyr1]MTRRAAIAAIAACLLSGCGHDTTGTATWPGARLEKAVLTEADFPSGVVFE
RITRDRADGDDAAGPPPMLSEPEGCTDGLTRDIAGDAERGPGSAVEYVVV
YDGARMVITVLSWRLDLDRLAATAQRCAEYRTFFDESDPGVAMTTTPVPV
SRADALAYEQTMYLPGQETSVYFAFENVGAMAVFGIAFPTPDPSIPVKGA
LPQTFLDITAKQAERARTV
315444980YP_004077859.1 hypothetical protein Mspyr1_34130 [Mycobacterium gilvum Spyr1]MPTPMVTVDGFGVPVEVTGPDKGSVVVLLGAAHQAPAAYEGICQRLHTAS
LKTVVIGADPRLTAKSVISILDEVEVRWALLVGDRHGGELAWDLAATRLD
RFIGLVVIDRGHPRVADLTGAVRDEHCPPVELNTTALVSTSAARAVAKAS
QRFVYGEYRIVDLLGRRNAADSTAQLAAEIVMRTSTW
315444979YP_004077858.1 GNAT family acetyltransferase [Mycobacterium gilvum Spyr1]MTADPTADNPEAITLALHEAATADQLDSMADDVVLELGWGRLIFGQTFAD
PERLAEVLRQEGQGRRDICIYAREPHVLVSKAPAELFIDPSHTYRLRFAE
VEDSGSTPTGFRVRTLAERADADEMNRVYLRCGMVPAPTDVLWDNHREQP
SVDYLVAVSDEDGTVLGTVTGVDHVALFSDPENGSSLWTLAVDPTAALPG
VGAALTRALASLYRDRGRAYMDLSVAHDNVAAIALYEKLGFARVPVMAVK
RKNAINEPLFTHPPETVDDLNPYARILADEAMRRGIWVEVLDAEAGEMRL
SHGGRTVVTRESLSEYTSAVAMARCDDKRLTRRIVSEAGITVPKGRLATF
DQADHDFLAEVGDVVVKPTRGEQGKGITVGVDSAEELDAALARAREQHPE
VLIEQRAEGDDLRLVVIDGKVVAAALRMPAEITGTGRHTIRELIETQSRR
RAAATGGESQIPIDAVTENTVREAGYTFDDVLPEGERLRVRRTANLHQGG
TIHDVTATVHPELCRVAVAAAAAIGIPVTGIDLLVPDVTKPEYAFIEANE
RPGLANHEPQPTAQAFVDFLFPNQPGLPQAWTPDEVQS
315444978YP_004077857.1 asparagine synthase [Mycobacterium gilvum Spyr1]MAEVMVPRGPDAAGAWSQGRVALGHRRLKIIDLTEAGAQPMVDSDLGLTI
AWNGCIYNYEELRDELAGHGYRFFSHSDTEVLLKGYHHWGDRFVDHLKGM
FAFAIVERDSGRVLLGRDRLGIKPLYLTQTPDRIRFASSLPALLAGGGVD
TRIDPVALHHYMTFHSVVPAPHTILRGVTKLPPASLMAIEPDGRITTTTY
WEPDFTRHADRADWSEKDWEEATLDSLRTAVKRRLVADVPVGCLLSGGVD
SSLIVGLLAEAGQHGLATFSIGFESVNGVAGDEFKYSDIIAQRFGTDHHQ
IRIDTARMLPALDGAIGAMSEPMVSHDCVAFYLLSQEVAKHVKVVQSGQG
ADEVFAGYHWYPPMGEPAAASLEGSVASYRGAFFDRDRAGYADIVAPGYL
TGDDPSELFVTEHFARAGAETGVDRALRLDTTVMLVDDPVKRVDNMTMAW
GLEGRVPFLDHELVELAATCPPQYKTAHEGKGVLKQAARQVIPSEVIDRP
KGYFPVPALTHLEGPYLELVRDALYAPVAKERGLFRPDAVERLLADPNGR
LTPLRGNELWQIALLELWLQRHGITGAAA
315444977YP_004077856.1 glutamine synthetase [Mycobacterium gilvum Spyr1]MTTRGMLTLEDLEKQVADGDIDTVIVAFCDMQGRLTGKRISSRLFVDDVA
EHGAECCNYLLAVDVDMNTVDGYAISSWEKGYGDMVMTPDMSTLRRVPWL
PATALVMADLSWTDGRPVTQAPRGILRAQLDRLDALGLDAVAATELEFMV
FDTGFRDAWAAGYRNLKPATDYNIDYAMHASTRMEPLLRDIRLGMDGAGM
YCEGVKGECNLGQQEIGFRYEQALVTCDNHTIYKNGAKEIADQHGKSLTF
MAKFDESEGNSCHIHISFRGRDGSPEDIAVFADDSDELGMSSMFRSFIAG
QLATLREFTLFYAPNINSYKRFAEGSFAPTAVAWGLDNRTCSLRVVGHGQ
GMRMENRAPGGDVNQYLAVAALIAGGLYGIENKLELEDAVEGNAYTSGAD
RLPTTLSEAVELFENSKIARDAFGDDVVDHYVNNARVELKAFNAAVTDWE
RVRGFERL
315444976YP_004077855.1 glutamine amidotransferase [Mycobacterium gilvum Spyr1]MSVSSRPVIGLTTYLQQAQTGVWDVRASFLPAIYFEGVGMAGGIASLLPP
QPVDDTIAERVLDGIDGLIITGGRDVDPSTYGAQRHPRTDEPDTDSRARD
AFEFALVRAALRRAMPVLGICRGAQVLNVALGGTLHQHLPDVVGHTRHQQ
GNAVFTTSSIATVPGSRVAALVGPDTEAQCYHHQAIDRLGDGLVVSASDT
DGVIEAVEVDLSAHPEHWVIAVQWHPEERLDDLRLFAGLVGAAGVYATQK
TQKVNR
315444975YP_004077854.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium gilvum Spyr1]MTASDVINPATEEVLRTVEHTDEAGVDDAVARAKAAQRSWARQAPAERAA
ALRAFAAVVDAHVEELAALEVANSGHPIGNARWEAGHVRDVLQYYSASPE
RLSGKQIPVAGGLDVTFNEPLGVVGVITPWNFPMTIASWGFAPALAAGNA
VLVKPAEWTPLTTIRLGELAVEAGLPADLFQVLPGRGSVVGERFVTHPDV
RKIVFTGSTEVGTRVMAQAATQVKRVTLELGGKSANIVFDDCDLERAAAT
APYGVFDNSGQDCCARSRILVQRSVFDRFMELLEPAVKGVVVGDPGAEGT
EMGPLVSKAHWNSVSSYVPDDAPVAFRGSAPQGPGFWFPPTVLTPARDDR
TVVEEIFGPVVTVLPFDDEADAIALANDTVYGLSGSIWTDNISRAMRVSR
AVEAGNLSVNSHSSVRYSTPFGGFKQSGLGRELGPDAPLSFTETKNVFFA
VEEN
315444974YP_004077853.1 hypothetical protein Mspyr1_34070 [Mycobacterium gilvum Spyr1]MDLSQRLKDKVAVITGGASGIGLATAKRMRSEGAIVVIGDLDEKTGKSVA
NDLNVTFVQVDVSDQVAVDNLFDTAFEVHGGVDIAFNNAGISPPEDDLIE
NTGIDAWDRVQDINLKSVFFCCKAALRHMVPAQKGSIVNTASFVAVNGSA
TSQISYTASKGGVLAMSRELGIQYARQGIRVNALCPGPVNTPLLQELFAK
DPERAARRLVHVPMGRFAEPEELAAAVAFLASGDASFITGSSFLVDGGIT
GHYVTPL
315444973YP_004077852.1 GntR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAAPDPADSSDASEALLRPVRPLNAFEDTVERLLQTIRLGVLTPGESLPP
ERELAARLGVSRDTVREAIKSLADAGYLVSRRGRYGGTFLADALPAPRAD
GTEMHRDDIDDAVRLREILEVGAARMAAVRTLAAVEREALRSRLADVRGA
DPADYRRLDSRLHLAIAEAAGVPSLVPLVAQNRMRLNELLDRIPLMTRNI
AHSDEQHEAIVSAILAGDADTAAQTMAAHVWGSAALLHGFLD
315444972YP_004077851.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMATVDNEADRALKAKHRALWASGDYPAVAAELIPSLGPELVRACGVRSGD
RVLDVAAGSGNASIPAAAAGAVVTASDLTPELFDAGRRIAAERGVAVEWV
EADAEALPFPDHSFDVVMSCVGAMFAPHHQATADEIVRVTRPGGTLGLIS
WTPEGFIGHLFATMKPYAPPPPPGASPPPMWGSENHVEALFGDRVRDLTM
RRQTVRFDHCASPLDFREYWKRNYGPTLAAYRFNEDRPERLAELDAAFLD
FLTTWNQADGTDGTAYDAEYLLVTATKR
315444971YP_004077850.1 ArsR family transcriptional regulator [Mycobacterium gilvum Spyr1]MAGYYICPVEDQQLVDRASSALAEVDTPGWAQRFDLVSDPHRLEILLCLH
RAPGICVSDLAAALGRSENTVSQALRVLRQQGWVTSTRAGRSVTYRLEDE
VVHDLLHWIGARHG
315444970YP_004077849.1 ABC-type Co2+ transporter- permease [Mycobacterium gilvum Spyr1]MSAHYVAMHMSDGIINAPISMVFVAIAVAALGICAWRARDELDERTVPLA
GLVAAFVFAVQMVNFPILPGVSGHLLGGALAAILVGPYTGALCVSIVLIV
QALLFADGGVTALGTNITNMSVIGVAAGYGTAVLLYRVLRRRRADLAVPV
VGVIAFVSAVVGTVCAAMGFVAQYALGGAATTSLGTVAAYMFGTHVLIGI
GEGVITALTVMAVVRARPDLVYLLRTHPARQAVPV
315444969YP_004077848.1 hypothetical protein Mspyr1_34020 [Mycobacterium gilvum Spyr1]MTRPSGGRRWFFWAAFAVATMLIAGVVSSFASSSPDGLDSATLRGCEIVE
TGAGEELRGECIAQHAQEHPLTSSPLADYAVEGRDGTGGAAGVVGVLVTV
LVAGGVFWAIARSRARPKSSVGE
315444968YP_004077847.1 cobalt ABC transporter permease CbiQ [Mycobacterium gilvum Spyr1]MGGGHSHPLYRDGDSPVHRLPAEVKIVCLAAFVLAVVATPRELFWPFAVY
ALIILAVWRAARIPLRWILPRMLIEAPFLVLAVLLPFSEGGERISLAGMH
LSIAGLYAAWGIVIKGTLGVAASLTVAATTTSRELPVALSRLRVPAMIVS
VLTLMIRYIDVLAAEARRMRLARVSRGDSPRMFHQIGATARGVGSLFLRS
YERGERVYLAMLSRGFDGHVPALAVGAGSVAAATPRQWVMALLPAAAAVA
VAASAWATL
315444967YP_004077846.1 cobalt transporter ATP-binding subunit [Mycobacterium gilvum Spyr1]MSGPAIRVRGLRYTYPDGHVALDGIDLDIADGERVALLGPNGAGKTTLML
HLNGVLRASAGDVEIGGTVLSRSTLRDIRRRVGLVFQDPDDQLFMPTLAQ
DVAFGPANFGVRGAELDARVAHALAVVSMTELAGRSPAHMSGGQRRRAAL
ATVLACEPEVLVLDEPSANLDPVARRELAETLSGLDATMLIVTHDLPYAA
QLCRRAIVMDGGVIVADGAIDDVLSDTALLAAHRLELPWGFTVGLR
315444966YP_004077845.1 mycothione reductase [Mycobacterium gilvum Spyr1]MADFDLAIIGTGSGNSILDERYVDKRVAICEQGVFGGTCLNVGCIPTKMF
VYAAGVAEQIRESARFGVDGRLDGVRWPDIVSRVFGRIDPLAGGGEQYRR
SSPNVEVFASHTRFSGPDSGDGYRLHTDDGDEFTAEQVVIAAGARATVPQ
AILECGVPYHTSDTIMRISDLPEHLVIVGGGFVAAEFAHVFSALGSRVTI
VLRGTTMLSHCDDTVCERFTDIAGKKWEIRSRRNIVSGESDGSGVSLRLD
DGATLRGDVLLVATGRVPNGDRLDAHLAGVEVTDGLVTVDEFQRTTARNV
FALGDVSSPYQLKHVANHEARVVKHNLLQDWDDTEALMPANHDNVPSAVF
TEPQIACVGLTENEARAAGYRIRSKVQDYGDVAYGWAMEDSTGFAKLIVD
DDTGLLLGAHIMGHQASSIIQPLIQAMAFGLPAQDMARGQYWIHPALPEV
VENALLSLCGEPPWPRPRRH
315444965YP_004077844.1 lysophospholipase [Mycobacterium gilvum Spyr1]MSGWEPDPLPGYRQRTFALGPDPDGEGDLEATLVRRGEPDTRARHAVLMV
HGFTDYFFNTELADHFAARGFAFYALDLHKCGRSHRDGQTPHFTTDLARY
DVELERSLAVIAEESAARVLVYGHSAGGLVVSLWLDRLRARGATASAGVA
GLVLNAPWLDLQGHAILRTPPITAALRAMARARKHSVVRRPNPGGGYGAT
LHRDYAGEFDYNLQWKPIGGFPVTVGWIHAIRRGQAALHRGLDVGVPNLI
LRSDHSVREAPDPELIQRGDAVLDVAQMARWAGCIGNRSTIVPVVDAKHD
VFLSLPGPRAAAYAELDRWLDSYLAGSAAPSTPSEPPPSDGSAPHG
315444964YP_004077843.1 malate:quinone-oxidoreductase [Mycobacterium gilvum Spyr1]MSEAEKTDVLLVGAGIMSATLCALLRLLEPNWSMTLVERLDGAAAESSDP
WNNAGTGHSALCELNYTPARPDGSIDIAKAVNVNEQFQVSRQFWTYAVEN
GVLPDVRSFLNPIPHVSFVTGADNVQYLRKRYEALVGNPLFGTMEFIDDA
GEFARRLPLMAEGRDLREPVGLNWTQDGTDVDFGALSRQLLGFGAQQGMD
TLFGHDVTNLSQNSDSTWTVKVVNRRTGRKRTFNAKFVFVGAGGGALPLL
QKAGIKEAKGFGGFPVGGQWLRTGNPELTAKHQAKVYGLPPLGAPPMSVP
HLDTRVINDKSWLLFGPFAGWSPKFLKQGKVTDLPFSVKPDNLVSMLGVG
LTEMGLLKYLIGQLLLSEAARVENLREFAPSAKDSDWELDIAGQRVQVIR
KAKGKGGVLEFGTTVLSAADGSIAGLLGASPGASTAVPAMFDVMKRCFAD
RYPSWEPKLKEMVPSLGVTLSDEPKLFEEVWARGTKVLKLDKPAGAIPAT
TDGQSTAGTEHTPTAATV
315444963YP_004077842.1 acyltransferase [Mycobacterium gilvum Spyr1]MTVALRRSWAKDLSAATLYELLKLRVEVFVVEQATPYPELDGRDLLAETR
HFWLENPEGEVISTLRLMEEHPAGQKAFRIGRVCTKRTARGHGHTARLLT
AALAEVGDFPCHINAQTYLEEMYGRHGFVRDGAEFLDDGIPHVPMVKP
315444962YP_004077841.1 protoporphyrin IX magnesium-chelatase [Mycobacterium gilvum Spyr1]MTGTASPPIYPLSAVIGHDRLRLALVLCAVRPDIGGVLIRGEKGTAKSTA
VRGLAQVLSAAFAAAGDDGGQLVELPIGATEDRVVGSLDLQKVLRDGEHA
FSPGLLARAHRGVLYVDEVNLLHDHLVDVLLDAAAMGRVHIERDGVSHSH
DARFVLIGTMNPEEGELRPQLLDRFGLTVDVAASRDVDVRAEVIRTRLAY
EADPVAFARRYADADADLAARIADARALVPDVVLPDNELRRIAALCAAFD
VDGMRADLVVARTAMAHAAWRGEVTVDEDDIRVAAELALPHRRRRDPFDD
PGLDPGTLDEAMEQAGESADQTPDPEPEPDPPGGGADGSADGQPPQQNSS
SHPSSSTRQSAPPSPTFKTRTLVVPGVGEGAPGRRSRARNRTGSVVSATS
DPDVGHGMHVFATLLAAAGRQTRSGAVRPGPDDVHRAVREGREGNLVIFV
VDASGSMAARDRMSAVSGATLSLLRDAYQRRDKVAVITFRQQDAQVLLPP
TTSVHIASRRLARFDTGGKTPLAQGLLAARDMVVRERARDRARRSLVVVL
TDGRATGGPDPLGRTRTAASRLVAEGAAAVVVDCETSYIRLDLAQELARQ
LGAPAVRLEELRAENLTALVRTAA
315444961YP_004077840.1 cob(I)yrinic acid a-c-diamide adenosyltransferase [Mycobacterium giMPQGQPLTVPDDGLTTRARRNAPLLAVHTGPGKGKSTAAFGMALRAWNQG
FDIAVFQFVKSAKWKVGEESALTELGRAHDERGVGGPVEWHKMGSGWSWT
RKSGTEVDHAAAAADGWAEISRRLAEQRHDFYVLDEFTYPLKWGWVDVDD
VVETLARRPGNQHVVITGRDAPQALLDAADLVTEMTKVKHPMDAGRKGQK
GIEW
315444960YP_004077839.1 hydrogenobyrinic acid a-c-diamide synthase/cobyrinate a-c-diamide sMVIAAPSSGSGKTTVATGLMGALRRAGHRVAPFKVGPDFIDPGYHALATG
RPGRNLDPVLVGEPLIGPLYRHGSDDADIAIVEGVMGLFDGRISDGGAGP
ARGSTAHVAGLLGAPVVLVVDARGQSHSVAALLHGFATFDQTVRLAGVIL
NRVGSSRHDEVLRQACDQAGVAVLGSIPRADELAVPSRHLGLVTAEEHGR
HATAAVAAMTELVTRHVDLAAVTAVAGGDVADAPWTPTQFAAGPTATVAL
AAGKAFTFGYAEHREILCAAGADVVTFDPLCDPLPVHTSALVLPGGFPEE
FVTELSANEPVRSQIRALAAAGAPIHAECAGLTYLVDELDGHPMCGVLAG
SASFTPSLTLGYRDAVAVAESSLHAVGERVTGHEFHRTAVQFAGDRQAAW
QYRGRGGAAVEDGAVLGGVHAGYLHTHAAAHPQAIARFVAAAATTKLAG
315444959YP_004077838.1 uroporphyrinogen-III C-methyltransferase [Mycobacterium gilvum SpyrMSTYDNAYLVGLRLSGKKVVVVGGGTVAQRRLPLLVSNGADVHVVTKAAT
PAVEAIDGITLTLREFRDEDLDGAWYVIAATDDPAVNAAIVAGAERRRIF
CVRADIAVEGTAVTPATFEYEGLEVGVLAGGEHRRSAAIRTAIREALQQG
VVTDESGDAPGVVKGGVALVGGGPGDPELITVRGRRLLAHADVVVADRLA
PQELLAELSPEVEVIDASKIPYGRAMAQDAINAVLVDRAKAGKFVVRLKG
GDPFVFARGYEEVIACAEAGIPVTVVPGVTSAIAVPALAGVPVTHRGLTH
EFVVVSGHLAPDHPESLVNWDALAAMSGTIVLLMAVERIELFVKVLLKGG
RPADTPVLVVQHGTTSSQRTLRAGLSEVPERIRSDGIRPPAIVVIGAVAG
FGT
315444958YP_004077837.1 EmrB/QacA subfamily drug resistance transporter [Mycobacterium gilvMTALNDAERAAIQRDAEGRGKRGSDRASGRALPARVTGSGESAGGRGGDA
GRRGRTPAWMPSRRFFAAVIAIGGMQLLATMDSTIAIVALPKIQDELGLS
DAGRSWVITAYVLTFGGLMLLGGRLGDTIGRKRTFIVGVALFTIASILCG
IAWDEATLVIARLLQGVGAAIASPTALALIATTFPKGPARNAATAVFAAM
TGVGSVMGLVVGGALTEVSWRLAFLVNVPIGLIMIYLARKTLRETNRERL
KLDAAGALLATMGCTAAVFGFSMGPEAGWMSPVTIGSGIAAVGCLIAFLW
VERTAENPVVPFELFLDRNRVATFAAVFLAGGVMFTLTVTIGLYVQDIMG
YSALRAGVGFIPFVIALGIGLGVSSALVSKYPPRVLVIGGGVLVLAAMIY
GSTLDANIPYFPNLVLPITIGGLGIGMIVVPLMISAIAGVGFDQIGPVSA
IALMLQNLGGPVVLAIIQAVITSRTLYLGGTTGPVKDMNAAQMHALDQGY
SYGLLWVAAVAVIVGAVALFIGYTAQQVAHAQEVKDAIDAGEL
315444957YP_004077836.1 prolyl-tRNA synthetase- family II [Mycobacterium gilvum Spyr1]MSELFLRTLRDDPADAEVPSHKLLIRAGYVRPVGPGLYSWLPLGLKVLRK
IEHIVRSEMDAIGGQEILFPALLPRAPYETTNRWTEYGDTLFRLQDRRDN
DYLLGPTHEEMFTLTVKGEYSSYKDFPLRLYQIQNKYRDEARPRAGILRG
REFLMKDSYSFDVDDDGLKNAYHAHREAYQRIFDRLKVRYVIVSAVSGAM
GGSASEEFLAESEVGEDTFVRCAQSGYAANVEAVVTTAPDPIPLDGLPEA
VVYDTPDTPTIATLVDWANTADLPSFAGRAVTAADTLKNVLLKVREPGGD
WELLAIGVPGDREVDDKRLGAALDPAEYAMADDADFAAHPFLKKGYIGPK
ALLANGVRYLVDPRVVDGTAWITGADETGRHVVDLVAGRDFTPDGTIEAA
EVREGDPSPDGAGPLVAARGIEIGHVFQLGRKYADAFNADVLGENGKPVR
LTMGSYGIGVSRLVAVIAEQHHDELGLRWPGSVAPFAVHVVIANKDAEAR
AGATELATALDRAGADVLLDDRTASPGVKFKDAELLGVPWIVVVGRGWAD
GVVELRDRFSGEKREIPVGPDTTAAEQILAAITG
315444956YP_004077835.1 hypothetical protein Mspyr1_33890 [Mycobacterium gilvum Spyr1]MTSPTSAPTDALLPTRPEDAAAGALFDALAAEHATIYGYGVVSAHSTPEL
NYLVSAAIAEHRARREAAIALCEQQGVDPAVPEAGYQMPFEVDTPADATN
LAVQMEEDAAEAWRAVVEQATDPGVRAFGVTALTECAVTAAQWRAVRGDT
TVTVAFPGGSE
315444955YP_004077834.1 hypothetical protein Mspyr1_33880 [Mycobacterium gilvum Spyr1]MPSRPPTLSRRRVLVGAAALAALSVTAAGCSTPPPPPDLDDLTTALDRAR
SDGDLAAEVATGARGTLADALTTIAAQRAAHAEALSEEIVRLTGHAAPTP
STAAASTTTTSAASVPDPTVDDVIGALRASADSATAAAGSLTGYRAGLLA
SIAASCTASFTVALAGAGSTP
315444954YP_004077833.1 hypothetical protein Mspyr1_33870 [Mycobacterium gilvum Spyr1]MAERSTDFRPGLPSQRQVVELLDGEFARAGYDIEDVVIDAATRPPRIVVI
ADGDRGLDLDAVAELSRLASEQLDTLDTPPYVLEVTSPGVDRPLTEEKHY
RRAQGRLAEVTLADGSTLTGRIGAVQNATVALVVREARSNLTVRDIALDA
VVKAVVQVEFSPPSPRELELAGVSGKET
315444953YP_004077832.1 transcription termination factor NusA [Mycobacterium gilvum Spyr1]MNIDMAALHAIEADKGITVDVVVETIKSALLTAYRHTEGHEADAHIDIDR
KTGVVKVMARQTDEDGNVLHEWDDTPEGFGRIAATTARQVILQRLRDAEN
EKNYGEFSAREGDIVAGVIQRDARANARGLVVVRMGSETKGSEGVIPAAE
QVPGERYEHGDRLRCYVVGVARGAREPVITLSRTHPNLVRKLFSLEVPEI
ADGSVEIVAVAREAGHRSKIAVTSRAPGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDYDEDPARFVANALSPAKVVSVTVIDEAARAARVIVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRSDDADKNGGDGPGGHDRSASRPDAGR
GVG
315444952YP_004077831.1 nucleic-acid-binding protein implicated in transcription terminatioMIQRETSARMRESTINPFAGPVRTCIGCRRRELAVELLRLVAVDSANGSG
NRSSAVTVDAARKLPGRGAWLHPDPGCLQAAIRRRAFGRALRITGSPDIT
AVSEHLLPQEQPEAPGQENR
315444951YP_004077830.1 translation initiation factor 2 (bIF-2) [Mycobacterium gilvum Spyr1MAGKARVHELAKELGVTSKEVLARLGEQGEFVKSASSTVEAPVARRLRES
FGGNKPDAVKPAAGASNGAPAKPSAPGARPGPRPGPPAPAQPKEPPAPAA
PAAAAPAPAAPAPPAAPPAPAASAAPPSAPEAPSARPTPGPRPGPGGPKP
GAPKPAPRTPRVGNNPFSSQQPVERPAPRPQGPAGPGGPRPGPGAGGPRP
GGGPRPGATPGNMPPRPVGGPRPGGGPRPGGGPRPGAGPRPTPGGAGRPG
GGGGGNYRGGGAGGGGGAGGAAAGGFRGRPGGGGGRPGQRGGAAGAFGRP
GGAPKRGRKSKRAKRAEYENMQAPVVGGVRLPHGNGETIRLARGASLSDF
ADKINANPASLVQALFNLGEMVTATQSVNDETLELLGGEMNYVVQVVSPE
DEDRELLQSFDLSYGEDEGGEDDLEFRPPVVTVMGHVDHGKTRLLDTIRD
ATVREGEAGGITQHIGAYQVTVDLDGNERPITFIDTPGHEAFTAMRARGA
KATDIAILVVAADDGVMPQTVEAVNHAQAADVPIVVAVNKIDKEGADPAK
IRGQLTEYGLVPEEYGGDTMFVDISAKAGTNIEALLEAVVLTADASLDLR
ANPDMEAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSVVAGDAYGRVRR
MVDEHGEDVEEALPSRPVQVIGFTSVPGAGDNFLVVDEDRIARQIADRRS
ARKRNALAARTRKRISLEDLDSALKETSQLNLILKGDNSGTVEALEEALL
GIQVDDEVQLRVIDRGVGGVTETNVNLASASDAIIIGFNVRAEGKATELA
NREGVEIRYYSIIYQAIDEIESALKGMLKPIYEEKELGRAEIRAIFRSSK
VGNIAGCLVQSGIMRRNAKARLLRDNVVVAQNLTVSSLKREKDDATEVRE
GYECGLTLTYNDIKEGDVIETYELVEKART
315444950YP_004077829.1 ribosome-binding factor A [Mycobacterium gilvum Spyr1]MPDPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDAKVTNDLHDATL
YYTVLGRSLDEEPDYEGAAAGLEKAKGVLRTKVGASLGVRFTPTLAFARD
TVPDAAHRMEALLAQARAADEDLARVREGAKHAGDSDPYRVLGEGDLEGP
ATGGPDVEDEGGANSHDR
315444949YP_004077828.1 exopolyphosphatase-like protein [Mycobacterium gilvum Spyr1]MAPTRTIAESTTDGRAAGGHVDARAAAELLAAACSVSIVCHVFPDADTIG
AGLALALVLDEAGKSVEVSFAEPDTLPDSLRSLPGGHLLVPPATMRRDAD
LVVTVDIPSVNRLGALRDLAVGDRDVLVIDHHASNQLFGTANLVDAGADS
TTMLVAELLDAWDKPLGLDVAHCLYAGLTTDTGSFRWASARAHRLAARLV
EAGVDNAAVSRTLMDTHPFAWLPMLSRVLGSAELVADAVGGRGFVYAIVG
HDEWANARSEEVESIIDIVRTTAQAEVAAVLKEIEPQRWSASLRSKSVDV
SAVAATFGGGGHRLAAGFTATGSADDVVAALRTALG
315444948YP_004077827.1 efflux protein- MATE family [Mycobacterium gilvum Spyr1]MADPVAPATGRRIAGLAFPALGVLAAEPVYLLFDLAIVGRLGALSLAGLA
IGALIMGVLSSQLTFLSYGTTARAARFYGAGDRNAAVEEGVQATWLAVGI
GTVIVAAVQVTAVPLVSALAAGGEIAETALPWVRIASLAVPAILIAAAGN
GWMRGVQDTMRPLRYVVVGFGLSAVLCPLLVFGWLGCPELGLPGSAVANV
AGQYLAAALFCRALFVEKVPLRVRPAVLRAQVVMGRDLILRTMAFQACFI
SAGAVAARFGAASVAAHQVVLQLWSFLALVLDSLAIAAQSLVGAALGAGQ
LTHAKAVAWRVTIFSAVAGVVLAVVFALGSQLIPSVFTDDQSVLDRIGVP
WWFLVAQLPVAGIVFAIDGVLLGAGDATFMRNATLASALAGFLPLVWLSL
AFGWGLLGIWAGLSTFMVLRLVFVGWRALSGRWLVPGTR
315444947YP_004077826.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMDGSERPVNHHGDHPGFSGLTGQLCAVAFLLTGRETGRLAADLTAVSATD
HVLDIGCGPGNACRIAAARGARVTGVDPSAAMLRVARIVTRGASVTWVKG
GAEALPVPDAGATVAWALATVHHWPDVDAGLAEIHRALGPGARFLAVERQ
TEPDATGISSHGWTGAQAETFAAMCESAGLTTVRVGSGRAGKRRVWTVHA
TRP
315444946YP_004077825.1 short chain enoyl-CoA hydratase [Mycobacterium gilvum Spyr1]MSTSTDVLLVDTRDRIQTLTLNRPGSRNALSAALRSRLFEALRQAQADDE
VDVVILTGADPVFCAGLDLKELGDTTELPDISPKWPPMTKPVIGAINGAA
VTGGLEIALYCDILIASDQARFADTHARVGLLPTWGLSVRLPQKVGVGMA
RRMSMTGDYLSADEALRCGLVTQVVPHAELQDTARQVATSIVGNNQKAVR
ALLASYHDIDDAQNGAALWQEAAAAREWMKSTSGDDIAESRSNVIERGRT
QVRP
315444945YP_004077824.1 hypothetical protein Mspyr1_33780 [Mycobacterium gilvum Spyr1]MCRNITELRGLEPAATADEIEAAARQYVRKVSGITRPSGANTDAFEAAVA
EVTESTRRLLSGLAPRKQPPKTVPPLRRPEVRARLNLA
315444944YP_004077823.1 hypothetical protein Mspyr1_33770 [Mycobacterium gilvum Spyr1]MTATPVESRGTATPTRPALKEWSAAIHALLDGRQTVLLRKGGIGEKRFDI
PAEASGSRFLLFPTVAHSHAERVRPEHRDLLEPAAADSTEDEVVVRAGAS
VVASIPVERPENLESIAMHHIWTGESVQSDRLDFRPRHRLTALVVATVPL
VEPVRLARTPDYRGCSSWVRLPVDPRWGEPVHSEAELDRVARLVRDSVG
315444943YP_004077822.1 CocE/NonD family hydrolase [Mycobacterium gilvum Spyr1]MSSELARRARRALSRVFDLPPPVCDFVVHRELRVPMRDRVELVADHYAPH
TASPAGTLLVRGPYGRGLPFATMFASFYAARGYHVVFQSVRGTFGSGGEF
DPFVNEVDDGADTAAWLRDQPWFTGTFATIGLSYLGFTQWALLTDPPPEL
AAAVITVGPDDVSGPRWGAGSFGLNDFLGWSDLVGRQEDPNRVRTLLRQA
RAQRRVTSASLRLPLAAASRELLGDGAPWFESWLDHPDTDDPFWTRLRLR
DGLERAEVPVLLLTGWQDLFVDQTVEHYRMLAGRGVPTGLTIGPWTHGDM
MTKAAPTMLRESLDWLATHLKGEPPQRRSPVRIHLSRRGWLNLPDWPPAM
PSLVLHPQPGGGLAPGAPGAADATFVYNPGDPTPTVGGRLLSPVGGYRDD
TALARRADVLTFTGTALASDLPVVGVPVLDVAHTCATPHNDLFVRISQVD
AHGRSRNVSDGYVASAPDSGTVTVELDPVAWTFPAGSRIRVLIAGGSHPR
FLRNLGTGEHAGTATDFATARHTVHLGEGTRLTLPAGPPPPSAD
315444942YP_004077821.1 hypothetical protein Mspyr1_33750 [Mycobacterium gilvum Spyr1]MVAKLRLFSALCALVAAVVVVCQVNPAGLTTPAGVDLRSTFAPLPDATPP
PYASTTIKSPVIDLTDPDPFNPCRDIPLDAVQRIGLAYTPPTQEDSLRCK
YDAGNYQMAVETFVWRTYEESLPPDAVELDINGHRAAQFWIMKPTDWNNR
WWITCMVAFQTSYGVIQQSLFYSPIYSEPDPDCMQTNLQRAHELSPYYIY
315444941YP_004077820.1 phosphohydrolase [Mycobacterium gilvum Spyr1]MSTDERRPTLWAVSDLHTGHTGNKPVTESLHPASPDDWLIVAGDVAERTD
EIRWALDLLRKRFAKVIWIPGNHELWTTQRDPMQIYGKSRYDYLVTMCDE
MGIVTPEHPYPVWTEEGGPATIVPMFLLYDYSFLPQGAGTKAEGLAIARE
KNIVGTDEYLLSSEPYATRDAWCRDRVNYTRGRLEDLDWMMPTIQVNHFP
MVREPCDAMFYPEFSLWCGTTATADWHTRYNAICSVYGHLHIPRTTWYDG
VRFEEVSVGYPREWRRRRPYRWLRQILPDPKYPAGYLNEFGGHFQITQEM
RDNAAKMQQRIKDRG
315444940YP_004077819.1 phosphopantetheinyl transferase component of siderophore synthetaseMIAAPLLSGVLPGEVDALAAAEMYTDPRELAPLPEEEPLIAKSVAKRRNE
FITVRYCARQALVDLGMEPVPILKGDKGEPCWPDGVVGSLTHCEGFRGAA
IGRRSDVRSLGIDAEPHDVLPAGVLDAISLPVERHELGGMPGGVHWDRVL
FCAKEATYKAWYPLTHRWLGFEDAHITFAIDKSDSTGQAGTFRSRILIDP
AAESGPPLTALAGRWSVRNGIALTAIVL
315444939YP_004077818.1 tRNA pseudouridine synthase B [Mycobacterium gilvum Spyr1]MSAEPGLVVVDKPGGMTSHDVVGRCRRLFGTRKVGHAGTLDPMATGVLVV
GIERATKILGLLTATDKSYTATLRLGQTTSTEDAEGELLHQVSAAQVTDE
QIERAIAPLRGAIEQVPSAVSAIKIAGKRAYQMVRDGEQVEIPARPVRID
RFEVLAVRRNGDVVDVDVVVDCSSGTYIRALARDVGAALGVGGHLTALRR
TRVGGFGLDQARTLEQLADAAELSYSLDEACLHAFPRRELTAAEVVDAGH
GRSLAPAGIDGVYAATAPDGRVMALLEDAGTRTRSVVVIRPATL
315444938YP_004077817.1 polyketide cyclase / dehydrase and lipid transport [Mycobacterium gMAKLELSRSLPMPAETAWAHASDLSSLGDWMPMHQGWRSDVPEEITVGTT
IVGVAGAKGMRNRVTWTVKQFDPPSALAVHGEGVGGTRYKMTMTVASTGD
GCTFTVRMDLGGAPLFGPVGAAAARAVKGDIDRAIKEFERRYA
315444937YP_004077816.1 Mn-dependent transcriptional regulator [Mycobacterium gilvum Spyr1]MSPDGNPANPTDLSTVAQDYLKVIWTAQEWSHEKVSTKLLADRIGVSAST
ASESIRKLADQGLVDHEKYGAVTLTDAGRRAALAMVRRHRLMETFLVNEL
GYGWDEVHDEAEILEHAVSDRMLDRIDAKLGYPTRDPHGDPIPAADGKVP
TPPARQLSACQDGEAGTVARISDADPEMLRYFDTVGISLDSRLRVVARRD
FAGMISVAVENPGSSGGSTAASDGETTVDLGSPAAEAIWVVA
315444936YP_004077815.1 bifunctional riboflavin kinase/FMN adenylyltransferase [MycobacteriMQRWRGQDEIPTDWGRCVVTIGVFDGVHRGHQELIGRAVKAGRSRGVPTV
LMTFDPHPMEVVFPGSHPAQLTTLTRRAELVEEMGIDVFLVMPFTSDFMK
LTPERYVHELLVERLHVVEVVVGDNFTFGKKAAGNVELLRKAGDRFGFAV
DSLSLVAEHHRDETVTFSSTYIRSCVDAGDMVAAEEALGRPHRVEGVVVR
GDGRGRDLGFPTANVAPPMYAAIPADGVYAAWFTVLGHGPVVGTVTPGER
YQAAVSVGTNPTFSGRTRTVEAFVLDTEADLYGQHVAVDFVARLRGQEKF
GSVADLITAMEGDTERARTILSAQ
315444935YP_004077814.1 30S ribosomal protein S15 [Mycobacterium gilvum Spyr1]MALTTEQKKEILGQYGLHDTDTGSPEAQVALLTKRISDLTEHLKQHKHDH
HSRRGLLLLVGRRRRLLKYVAQVDVARYRSLIERLGLRR
315444934YP_004077813.1 guanosine pentaphosphate synthetase I/polynucleotide phosphorylase MSVVEIEEGVFESTATIDNGSFGTRTIRFETGRLARQAAGAVVAYLDDET
MLLSATTASKQPKEHFDFFPLTIDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLIDRPLRPTFISGLRNEIQVVVTVLSLDPKDLYDVLAINAASAST
QISGIPFNGPVGGVRVALIDGQWVAFPTVEQLEKAVFDMVVAGRKVGDAG
NEDVAIMMVEAEATDKVIELVAGGAGAPTEAVVAEGLEAAKPFIAALCDA
QAALAGAAGKETAEYPVFPDYAEDVYYSVASVATDALSEALTIAGKEARD
DRTNEIKAEVVERLAEQYAGREKEIGAAYRSLTKKLVRQRILTDHFRIDG
RGVTDIRALSAEVAVIPRAHGSALFERGETQIMGVTTLDMVKMAQQIDSL
GPETSKRYMHHYNFPPYSTGETGRVGSPKRREIGHGALAERALMPVLPSV
EEFPYAIRQVSEALSSNGSTSMGSVCASTLSLLNAGVPLKAPVAGIAMGL
VSDDVEVEGGGVERRFVTLTDILGAEDAFGDMDFKCAGTKDFVTALQLDT
KLDGIPSQVLAGALAQAKDARITILEVMAEAIDEPDEMSPYAPRITTIKV
PVDKIGEVIGPKGKMINSITEETGASISIEDDGTVFVGASNGEAAQAAID
KINAIANPQLPKVGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGRGK
RINKVEDVAKVGDKLRVEIADIDNRGKISLVLVAEEEAGAATPEAPAPAD
AATSSS
315444933YP_004077812.1 Zn-dependent peptidase [Mycobacterium gilvum Spyr1]MPRPQAASSGALRQGRTSSAASVPAVRRTRLPGGLRVVTEHIPSVHSASV
GVWVNVGSRDEGRSVAGAAHFLEHLLFKATPTRTAVQIAQAVDAVGGELN
AFTSREHTCYYAHVLDSDLELAVDLVADVVLNGRCEPDDVEVERDVVLEE
IAMRDDDPEDTLGDVFLSAMFGDHPVGRPVVGSVASIAGMTRSQLHSFHV
RRYTPDRMVVAVAGNIEHDEVVRLVRRHFGRHLVRGRSPVAPRKGAGRVA
GRPTLELVKRDAEQTHLSLGVRTPGRHWEHRWALSVLNTALGGGLSSRLF
QQIRETRGLAYSVYSTVDTFADTGALSIYAGCQPERFDEVVRVTTDILAD
VARDGITADECRIAKGSLRGGLVLGLEDSGSRMNRIGRSELNFGEHRTIA
DTLSKIDEVTIDEVNAVARQLLTRPFGAAVLGSVRSKRSLPKPLQQIAG
315444932YP_004077811.1 beta-lactamase class A [Mycobacterium gilvum Spyr1]MTELSRRHVLLGGLSLFALTACSTQTVLADPARPLPPPEERIAALAARHD
ARIGLYAADLDSGATLAFGDTDTFAVCSTFKTYAAGAVLQRVQQGRLGLG
DTVLIEAADIRPHSPVTEPRVGTAMTLAELCQAALQQSDNAAANGLLRVL
GGPSAITEFARSIGDDRTRLDRWEVELNSAVPGDPRDTSTPRALATGYQA
LLTGDVLDPIGRRQLVDWMLANQTSSMRAGLPAGYTSADKTGSGDYGSTN
DVGIAFGPAGQRLLLAVMTRSASDDPDAPSLRPLIGELATLVLSEL
315444931YP_004077810.1 hypothetical protein Mspyr1_33640 [Mycobacterium gilvum Spyr1]MAALSEVLPDDVPTTTADALALFDSLAAVDPQFMIGTWHGAELPTGHPLD
GLLAASGWWGKRFRDNETVDPLLFPTADGAGLFALNPAPAFAGLGLFTRF
PMLKKQNFTAAVATLRPALQARGPKARLRTTRYRGVDTATMIYDQLPIND
VFRLVDDTPGSEVVLGAMDLRGYDAPYFFVLLRDGSRS
315444930YP_004077809.1 hypothetical protein Mspyr1_33630 [Mycobacterium gilvum Spyr1]MRSDDMCPCGSGDLYGRCCLPLHTGQRGAETAEQLMRSRYSAFVAGDAEY
VWRTWHPRTRPADVTDLTVTWTRLEIVDRVDGGPGDDTGEVEFRAHHRAG
VLHERSRFAVRAGRWFYVDGEIFD
315444929YP_004077808.1 lactoylglutathione lyase family protein [Mycobacterium gilvum Spyr1MSDYAAPVGAPIWLDLMSTDPARAAEFYHAVFGWDVEAPPQAEFGGYQNF
TVNGRRVAGLLPHMGGVPNVWSVYLHTADAAETVRAVEAAGGSVMVPPMP
VGDMGSMMVATDPAGAVIGFWQPGTHVGFTQWGVHGTPYWFECQSKDYEK
SLAFYPQVIGARMEEIGTGGDPNAVGPDRYAQLFIGESAYSGIMDSATLF
PAEVPSFWQIYITVDDVAGTVARAESLGAQILMPGEETPYGTLAALRDPL
GALICLGHPPAGM
315444928YP_004077807.1 L-alanine dehydrogenase [Mycobacterium gilvum Spyr1]MRVGIPTEIKNNEFRVAITPSGVAELVQRGHEVLIQSGAGDGSSISDADF
KRAGAQMITGADEVWSEADLLLKVKEPIEAEYSKMRRGQTMFTYLHLAAS
KPCTDALMASGTTSIAYETVQLADGSLPLLAPMSEVAGRLSAQVGSYHLM
RSHGGRGVLMGGVPGVAPAEVVVIGGGVAGYNAARIAKGMGAHVNVFDVN
INTLRKIDNENNGAIETRYSSSLDLEDAVKHADLVIGAVLVPGAKAPKLV
SNSTVAAMKPGAVLVDIAIDQGGCFEDSRPTTHDDPTFPVHDTVFYCVAN
MPGAVPRTSTYALTNATLPYVLKLAGRGWRDACRADPALAKGLSTHEGAL
LSEQVAADLDVPYTDPAELLA
315444927YP_004077806.1 AsnC family transcriptional regulator [Mycobacterium gilvum Spyr1]MSKESTTSRSSAGLPPKNVREVTLDDVDRRILTALHSDARMANSALSELV
GIAPSTCHGRVRRLQELGVIRGFYADIDPAAIGLTLQAMISVSLQANSRS
QIRHFIQTIRRKPQVMDVYFLAGADDFILHVAARDTEDLRAFVVENLNAD
ADVAGTQTSLIFEHLRGASPL
315444926YP_004077805.1 hypothetical protein Mspyr1_33590 [Mycobacterium gilvum Spyr1]MAVTLSVTPAQAAPYGSNGVFGVTTQPRDGWATTYIPPGRYRVDQSPSMQ
PYQSPPGRWFRCSEFPCTPTAPGNIIGSGAALRDAPTFVDILPTDVAVAL
HNVTLTPA
315444925YP_004077804.1 hypothetical protein Mspyr1_33580 [Mycobacterium gilvum Spyr1]MDGVAEAVGVIGEQLAVLAKAAEDLSHRELIGLLAELTTVLRSAPAVEHA
VLARLLDETEPHHLGEASWKKVLTTALRISSAEAGRRLQRAKNLGPRRAM
TGEPLAPVWESTAAAQAQGHLGEEHVEIIAKFHKKLPSWVDVDTRAAADA
QLAHTGSGLGPEELAQVADRLLMMIDQDGPEPSEKEKATRFWVKLGTQQR
DGGRTISGYVDAETSAYWEAVLAKEAAPGANMAEQEKAGDTRTQGQRNHD
GLKAVLRRTLESGQLGSHNGLPVTVIVSTTLQELEKGAGVAVTGGGSLLP
IPDLIRLAADAHHYLYVFDGHTGQSLYLGRAKRLANAAQRIVLHARDRGC
TRPGCTVPGYWCQAHHASADWKDDGHTDIDDLTFACGPENRMIENTGWTT
RKNSRNQTEWIPPPDLETGQHRVNGYHHPDRHLLPHEEGEDSSTSRDCDD
P
315444924YP_004077803.1 dihydrodipicolinate reductase [Mycobacterium gilvum Spyr1]MRVGVLGAKGKVGATMVAGVQAAEDLTFTTGIDAGDPLSALVDTDTEVVI
DFTHPDVVMDNLKFLIENGLHAVVGTTGFTDERLDQVRKWLEAKPDVSVL
IAPNFAIGAVLSMHFAQQAAKHFESVEVIELHHPHKADAPSGTAARTARL
IAEARKGMPPNPDATSTGLEGARGADVDGVPVHSIRLAGLVAHQEVLFGT
LGETLTIRHDSIDRTSFVPGVLLAVRKIRENPGLTIGIESLLDLA
315444923YP_004077802.1 hypothetical protein Mspyr1_33560 [Mycobacterium gilvum Spyr1]MSDGSRALRIQLLIGFMCVALVVYFVLLGRTALILIGSGEAAPVGLGLAI
LIMPAIGAWVLVATLKAGLAHQRLARKARESGMDLDVDDLPRRASGRIER
DAADALFATVRTEVENDPDNWVRWYRLARAYDYAGDRTRARETMKKAVQM
EESAQ
315444922YP_004077801.1 multimeric flavodoxin WrbA [Mycobacterium gilvum Spyr1]MSKTLLIVHHTPSPHCQEMFEAVLAGATDPEIEGVEVLRRPALTVSPAEM
LAADGYLLGTPANLGYISGAMKHAFDCSYYQLLDATRGRPFGVFLHGNEG
TEGAQRALTGITGGLGWEQAADTVVVSGKPAKNDLEACWNLGATVAATLM
D
315444921YP_004077800.1 hypothetical protein Mspyr1_33540 [Mycobacterium gilvum Spyr1]MPGMAEFALAGAPIAGGALLGLAAGNLRPPDVRDAIAKDLDLLERLPAEQ
VERRAELQRIIDMRIDGLVAAADKSRELRELAMSYEGNWRDIVLFVCAIM
FTLVWWHVDHSRSNWLVMFVVMIVLTVIVGIYAARGVLRGLASFLANRRR
GRQ
315444920YP_004077799.1 citrate lyase subunit beta [Mycobacterium gilvum Spyr1]MYDQSFGEAAFGEQGQRIDPVLARSWLLVNGAHYERFQAAAHSRADIVVL
DIEDAVAPKDKAAARANVVRWLGEGHADWVRVNGFGTEWWAGDLEMLAGT
SVGGVMLAMVESVDHVTETAKRLPGVPIVALVETARGLERITEIAAAKGT
FRLAFGIGDFRRDTGFGGDALTLAYTRSRFTIAAKAAHLPSAIDGPTVGS
SALKLSEATAVSAEFGMTGKICLTPEQCLTVNEGLSPSAEEIAWAKEFFV
EFERDGGEIRNGSDLPRIARANKILELARAYGIEPSEFDDVDEPTHIPAP
SDTYHY
315444919YP_004077798.1 dienelactone hydrolase-like enzyme [Mycobacterium gilvum Spyr1]MPTITDTVTTTDGSCPVTLHTPDGDGPWRGIVMYPDAGGVRSTFRTMADQ
LAGHGYAVLLPDVYYREGDWAPFTMSTVFGDAAERRRLFGMISKVTPERM
ESDAVAFFDYLADRPEVSGETFGTTGYCMGGRTSLVVAGRVPQRVAAAMS
FHGGGLVTDDAESPHLLADRIRAAVYVGAAHNDNSFTRADGETLDKALSA
AGVEHTVDWYSAQHGFAVPDNGPYDESAARRHWDAMQSFFAAHLV
315444918YP_004077797.1 thymidylate synthase [Mycobacterium gilvum Spyr1]MPTATPYEDLLRLVLDTGTPKSDRTGTGTRSLFGHQMRYDLNAGFPLITT
KKVHTKSIVYELLWFLRGDSNVRWLQERGVTIWDEWASPTGDLGPVYGVQ
WRSWPTPSGEHIDQISAALDLLKHDPDSRRNIVSAWNVGEIPQMALPPCH
AFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLGVG
EFIWTGGDCHIYDNHVEQVTEQLSRDPRPYPELVLAPRDSIFDYTYEDVV
IKNYEPHPAIKAPVAI
315444917YP_004077796.1 dihydrofolate reductase [Mycobacterium gilvum Spyr1]MTELNLIWAQSSSGVIGRDGGIPWHVPEDMARFKELTMGHTVIMGRQTWE
SLPEKFRPLPGRRNVVLTRQADYVAEGAEVVTALEDAPLDDAWVIGGSQV
YGLALPLATRCEITEVDLDLHRQDEDALAPLLDEAWVGTEGEWRDSASGL
RYRFYSYVRK
315444916YP_004077795.1 hypothetical protein Mspyr1_33490 [Mycobacterium gilvum Spyr1]MRLTAAQARRVAVAAQGFHEPRPSGPVTRAHLKRLIARLQVLQLDSVSVA
VRAHYAPVFSRLGPYDRDVLDRAAWSHSARSPRLLVEYWAHEAALMAVDD
WPLLRWRMREYKNGRWGREIVKKNGKLAADIVEAVTALGPCTAGQIEAYL
ESEPRRTGGSVKKAMWDRSDTKWVAEALWSSGVLTTATRVGFARHYDVSE
RVLPADVVARRIDEADALRELTLRAATALGVATEADLRDYFRLGARQVRP
AIADLLDAGEIERVEVDGWDAPAYLRAGQTVPRRDRGTALLCPFDPLIFF
RPRVERLFGGFHYRIEIYVPQPKRRYGYYVWPFLLDGDLVGRVDLKADRT
AGTLQVLGAYCEDGHDGPRVATELATALRQMADWLGLDDVVVAERGDLSA
HLRAALVS
315444915YP_004077794.1 hydrolase or acyltransferase of alpha/beta superfamily [MycobacteriMDVLRTPDERFTDLPGFPFDPHYVEVGGLRMHYLDEGPADGDVVLLLHGE
PSWSYLYRTMIPVLVDAGLRAVAIDLVGFGRSDKPADRADYTYQAHVDWT
WGAVAALGLADITLVCQDWGGLIGLRLVGEHPDRFARVVAANTTLPTGDQ
HPGDAFLAWQRFSQETPDFPVGHIVNGGCVSTLAPDVIAAYDAPFPDDSF
KAGARQFPTLVPTSPDDPAAPANRAAWEVLRRFDKPFLCAFSDSDPITRG
ADAALRTLIPGAHGQPEVTIAGGGHFLQEDRGPELAGVVVDFVRNTSV
315444914YP_004077793.1 diguanylate cyclase domain-containing protein [Mycobacterium gilvumMPASDRQWWRQTDQFEWFSNYLRERGMQQRWRWATFTFTVVLGALPLVML
ASPLGPDTDLTRGVAIVSGAAGAGASLLWLSGWPSRTQSLVYNALCSGGI
AMGCLALSNPYSGLMGCTLFAVIGGFLAYFHSVGQVAANFAVAAICATIT
AARLVTETGDVALTAAAAINVIALNTGVPFGIHSLVHSLHTDLRAADRDP
LTGLLNRRAFYSAVNQLLADTHAVDAAFNVTVIDLDKFKSLNDTRGHAVG
DAALVYVAEILHRHAGASAVSGRLGGEEFVVADVDLPVLQRRTADLIREG
IAAGPFGITASLGICSARIAWEDSAAGGMSPDFLDKLIESADAAMYVSKR
AGGDRVEHRRLDGADLADA
315444913YP_004077792.1 thymidylate synthase (FAD) [Mycobacterium gilvum Spyr1]MAEIAPLRVQLIAKTEFSAPPDVEWSTDADGGAALVEFAGRACYQSWSKP
NPRTATNATYVRHIIDVGHFSVLEHASVSFYITGLSRSCTHELIRHRHFS
YSQLSQRYVPENDAEVVAPPGIEDDPELLALFTAATDASRAAYTELLNRL
EAKLADQGTSTLRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRA
SEHADVEIRRLAIECLRRLVEVAPQVFSDFEITALADGTEVATSPLATEV
315444912YP_004077791.1 dihydrodipicolinate synthase [Mycobacterium gilvum Spyr1]MPVSTSGFDAPARLGTLLTAMATPFKPDGSLDIETAARLATRLVDAGCDG
LVVSGTTGESPTTTDDEKILLLRTVLEAVGDRARIVAGAGTYDTAHSIHL
AKASAAEGAHGLLVVTPYYSRPPQAGLVAHFTAVADATDLPNILYDIPPR
SVVPIEWDTIRRLAQHPNIVAIKDAKADLHGGGQIIAETGLAYYSGDDAL
NLPWLAMGAVGFISVWGHLAASQLRDMLSAFASGDVATARKINVALGPLS
AAQSRLGGVTLSKAGLRLQGFEVGDPRLPQIPANDVQLQALAADMRAASV
LR
315444911YP_004077790.1 hydrolase [Mycobacterium gilvum Spyr1]MDLTHTPPGPLAPGGLRVTALGGIGEIGRNMTVFEHLGRLLIVDCGVLFP
THDEPGVDLILPDLRHVQDRLDDVEAIVVTHAHEDHIGAIPFVLKQRADI
PIVGSKFTLALIAEKCREHRLSPKLVEVTEGTKSTHGVFECQYFAVNHSV
PGCLAIGIHTGAGTVLHTGDIKLDQLPPDGRPTDLPGMSRLGDAGVDLFL
CDSTNSEIPGVGPSESEVGPALHRLMRGADGRVIVACFASNVDRVQSIID
AAVALGRRVSFVGRSMVRNMGIARELGYLKVADEDVLDIAAAEMMPADRV
VLITTGTQGEPMAALSRMSRGEHRSITLTAGDLIILSSSLIPGNEEAVYG
VIDSLAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRNVMPVHGTW
RMLRANAALAARTGVPDENIKIAENGVSVDLVAGRVSVAGSVPVGKMFVD
GLVTGDVGDATLGERLILSSGFVAVTVVVRRGTGKAVAPAHLHARGFSED
PKALEPAARKVEAELEHLASQNVTEPTRIAQGVRRAVGKWVGETYRRQPM
IVPTVIEI
315444910YP_004077789.1 response regulator with CheY-like receiver domain and winged-helix MAAVLIAEDEPRISALVRKGLSANGFSVTVVPDGPSAYAYAHSGAFDLMV
LDTGLPGMDGLSVLRRLRAEGSALPVIVLTTRTTGADTAALLGGADDVIA
KPFRLEDLVSRVRTRLSPGRAARTHTLSYGNLRLDLRTRRAHVGDYSVDL
SAREFALAEMFLRHPGQVLTRDQLLRQVWGNDYEPGSNVVDVYVRYLRRK
LGARRFVTLRGMGYRLEAVH
315444909YP_004077788.1 methyltransferase [Mycobacterium gilvum Spyr1]MTSRDAAAETAFGPMVLAAIEHNEPPDRRLVDDDLAESFLPNRFRLLVRC
TRVAAVRRAVIAAADRSGPGLWASIACRKRYIDERLSDPLNDTDAVVVLG
AGLDTRSCRIARHSTMPVFEVDQQINVDRKQAVLRRTLGEVPSSVRLVGV
DLERGQVMPALRAQGYDTRARTFFSRAPLTPFPDAVRATLTQLDGAAEGS
KLIFSYIRQDFIDGTDLYGARSVYRRFRQRRAVWKSGLVPEHVGELLADH
GWRLVEQAGPSYYRDTYIRPTGRPLAASPLEWTVFAER
315444908YP_004077787.1 hypothetical protein Mspyr1_33410 [Mycobacterium gilvum Spyr1]MAELTGKVAFITGAARGQGRAHAVKLASEGADIIALDLCAQIDSVPYPLA
TPDDMAAMVKLVEEAGGRIATYEADVRDRDAVKAAVRDGTEKFGDRLDIV
IANAGIAPMAAADAWQDVIDVNLTGVYNTIDVAMKPMVKFGNGGAIVLTS
SVAGLVGIGAPLGGSVGYAAAKHGIVGIMRVYANFLAQYSIRVNSVHPAG
VNTPMIDNDFTRSWLDGMAQQSQGGPDMGNALPVQTLEPEDIANAVYWLV
SDAARYVTGITLPVDAGFINKR
315444907YP_004077786.1 hypothetical protein Mspyr1_33400 [Mycobacterium gilvum Spyr1]MPIVVVATLTAKPESVETVRNACKQAIEAVHEEPGCQLYSLHEADNTFVF
VEQWEDADALQKHSAAPAVATMFGAVGEHLDGAPDIKVLQPVVAGDPAKG
QLRA
315444906YP_004077785.1 DNA segregation ATPase FtsK [Mycobacterium gilvum Spyr1]MTSVADGVSEADATSLTGMASKTAARSSARQTRSKPAPRGGGRSARPAAP
RRKPAPRKPARRNSSAISTAGTAVGKGVRAGWLMVAKGAGSTARSVGRAR
ELEPGHRRDGIALALLGLAVIVAASSWFDAARPVGAWIDTTVRVLIGAAV
VLVPVLLAVVGVTLMRSEPDPEARPRLILGSAMVALPALGLWHLWAGAPA
DPVERRHAGGFLGFALGGPLSDGLTAWIAAPLLFIGVLFGVLLLTGTTIR
EVPATVRDMFTTRWREDDDEYYDDSYDGDESYDGDDYYDEDHDGDDDRDR
DDRADDFSDGYYDEQIGDPDDEAQWPAAAQPTVPLTRPDGPTGTPMENYP
LVDEDDDVAAPVAAPAVTSRKKTPKEPKLSLDRVVEGPYVLPPLDLLVAG
EPPKRLTAANQQMTDAISSVLQQFKVDAAVTGCTRGPTVTRYEVELGPGV
KVEKITALQRNIAYAVATESVRMLAPIPGKSAVGIEVPNIDREMVRLADV
LTAPSTRRDHHPLVIGLGKDIEGDFISANLAKMPHLLVAGSTGSGKSSFV
NSMLVSLLARATPDEVRMILIDPKMVELTPYEGIPHLITPIITEPKKAAA
ALAWLVEEMEQRYQDMQASRVRHIDVFNDKVRSGEITAPLGSNRIYKPYP
YILAIVDELADLMMTAPRDVEEAIVRITQKARAAGIHLVLATQRPSVDVV
TGLIKTNVPSRLAFATSSLTDSRVILDQPGAEKLIGMGDGLFLPMGANKP
IRLQGAFITDEEIHAVVTATKDQAEPEFVEGVTAVKAGERKDVDPDIGDD
MDVLLQAVELVVSSQFGSTSMLQRKLRVGFAKAGRLMDLMETRGIVGPSE
GSKAREVLVKPDELAGTLALIRGGSDANGADGEDDETDF
315444905YP_004077784.1 meth