Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is Mycobacterium_sp_JDM601
Gene IDProtein IDProtein DetailsSequence
333992985YP_004525599.1 ribonuclease P protein component RnpA [Mycobacterium sp. JDM601]MLPSHYRMRRSADFGATVKHGRRAVQPDVVVYSRVVDDRQIDTLDVAEAS
PQVGLIIAKSVGSAVDRHRVARRLRHVARDVLGDLHPGERLVIRALPSSS
GAKSAALRAQLCAGLQAVHRAGGVAR
333992983YP_004525597.1 hypothetical protein JDM601_4343 [Mycobacterium sp. JDM601]MTDMTDTNDAETTEHGAVETAGEPETEDGGAAPATPAVDLEDRLVAEGEI
AGDYLEELLDLLDFDGDIDLDVEGRRAVVSIDGGTDLTKLVGRKGEVLDA
LQELTRLAVHQKTGERSRLMLDIAGWRRRRRDDLTALGDEVARRVLESGD
DEELAPMSPFERKIVHDAVAAVAGVHSESQGVEPSRRVVVRRD
333992981YP_004525595.1 chromosome partitioning protein ParB [Mycobacterium sp. JDM601]MTGPSRKKGGLGRGLASLIPTGPADGASTTADRGAGMGPGMGDAAADVVL
GGATPAKAAEVGAVYREISPADIEPNPRQPRQVFDDEALAELVHSIREFG
LMQPIVVRALPGAAPGAARYQLVMGERRWRASQQAGLEAIPAIVRETDDD
NLLRDALLENIHRVQLNPLEEAAAYQQLLDEFGVTHDELAARLGRSRPLV
TNMIRLLRLPIAVQRRVAAGVLSAGHARALLSLEGGSEAQEQLAARIVAE
GLSVRATEEAVTLANRGDTSTPVAPRRKPIHMPGLQDVAERLSSAFDTRV
TVSLGKRKGKIVVEFGSVDDLQRIVALMSSSAG
333992979YP_004525593.1 hydrolase [Mycobacterium sp. JDM601]MSGRHRSADDALRRGDRSGAVVEIRAALAALGLVDSPDADLTTGKHVALD
VFDDDLDQAVRAFQQQRGLLVDGIIGEATYRALKEASYRLGARILNHQFG
APMYGDDVATLQARLQDLGFYTGMVDGYFGIQTHNALMSYQREYGLYADG
ICGPETLRSLNFLASRVTGGSPHAIREEELVRRSGPRLSGKRIVIDPGRG
GGDHGLITQTPTGPISEADILWDLASRLEGRMTAIGMETFLSRPNGRSPS
DAERAATANAVGADLMISLRCAAHVSPAANGVASFHFGNSHGSVSTIGRN
LADFIQREIVARTGLQDCRAHGRTWDLLRLTRMPTVEVDVGYITSPRDRG
MLVSPVTRDAIAEGMLAAVKRLYLLGKNDRPTGTFTFAELLAHELSVERT
GRLGGG
333992977YP_004525591.1 thioredoxin reductase [Mycobacterium sp. JDM601]MSETPTIHDVIIIGSGPAGYTAAIYAARAQLAPLVFEGTSFGGALMTTTE
VENFPGFRNGIMGPELMDEMREQALRFGADLRMEDVESVALDGPVKSVVT
ADGETHRARAVILAMGAAARYLNIPGEQELLGRGVSSCATCDGFFFRDQD
IAVIGGGDSAMEEATFLTRFARSVTLVHRREEFRASKIMLNRARDNDKIR
FLTNAVPVAVEGTDTVTGLQVRDTVTGAETTLPVTGVFVAIGHDPRSEMV
REAVQVDADGYVLVEQPSSRTSLPGVFAAGDLVDRSYRQAITAAGTGCTA
AIDAERWLAEAADAAEAAMDPATETLMGAPQ
333992975YP_004525589.1 RNA polymerase sigma factor SigM [Mycobacterium sp. JDM601]MGHPERSDAELLAAHVAGDRHAFQELYGRHQRRLRRLARLTTGCPEDAED
ALQEAMLSAHRSAGSFRYNAAVGSWLHRIVVNACRDRLRRNRLHPSVPLA
ESPAVADRTAEVETALEVRAALRRLPTEQRAAVVTVDMHGYSIADAARAL
GVAQGTVKSRCARGRARLAVLLGRDHTGPAARVRPAARRIALAAEGVLHG
RVDDCA
333992973YP_004525587.1 hypothetical protein JDM601_4333 [Mycobacterium sp. JDM601]MAAFLMALGMALGSAAAPHAIAGEPGGMSFVQIRVDQVTPELITTSSVPV
VTVSGTVSNVGDRPVRDVMVRLEQAGAVASSAGLRTNLSGSNDQYRPVGP
FSTVAAELQRGQEARFTLSAPLHSASQPALSIDRPGIYPLLVNVNGTPDY
GEPARLDDARFLLPVTGLPKTEADGDPLAGAVAPDTSRPVRLTMLWPLAD
RPRLTPGAPGGTLPVRLTDDELAKSLAPGGRLDALLSAAEFATSPTVDGG
GVVNQALCLAIDPDLLVTVNAMTRGYLVADSPDGAASHPGTGQAAATTWL
ERLRRLAHRSCVTATPYAQADLDALARVGDPGLDAIAVSRPADIIDRILQ
VTSTRGAVVLGDGKLTTGAADLISAESSTGAAVVITASDCSAQDSTTGAS
ATADVTPRRLSPQLVVAPYDPAVGAALAGMGTDPVAPTYLDGSLTVRLHH
DSALARRQDALGAMLWRGLEAPDGPDEPRDQILMPPAYWKPRVDDAQAVL
TTVGTALRSGLAVPRPLTAVIAESQGVTAAPAHPLPAEQAVGGFGPDVIG
AVTDDIGRLWALTSALTTDVRTGLTGDQYTAPLAEDMLRALSQSEPLDVR
SGLAAQRLSVVGDTVADLIGAVTIVNPAGSYTLATEHSPLPLALRNDLAV
PIRVRLHVDAPPGMTVADMGDLELPPGYLPLRVPVEVRVNQHFVVDVALQ
TPAGLPLGESARLSVHSNAYGMVLFLITMTAAAALTMLTGRRLWHRFRGQ
PDRADLDRPSPVDPNRPRSPAATAGRSSRDVDR
333992971YP_004525585.1 poly(A) polymerase [Mycobacterium sp. JDM601]MPEAHQDADLLTAAAVALNRHAELLRDLGAMFDAAGHQLYLVGGSVRDAL
LGRSSPDLDFTTDARPEQVQQLLRGRAEALWDTGIEFGTIGAGLHGYRVE
ITTFRADKYDRVSRNPEVRFGDSLHEDLVRRDFTANAMAVRITGAGPGEF
LDPLGGLAALRAGVLDTPTAPQDSFGDDPLRMLRAARFVSQLGFTVAPRV
RAAIEEMAEQLSRITPERVAAELDKLLLGADPAAGIELMVASGMGDVVLP
EVGAMRMAIDEHHQHKDVYQHSLTVLRQAIELEDARGGPDLVLRWAALLH
DIGKPDTRRHEPDGGVSFHHHEVVGAKMVRKRMRALRYSKQMVDDVSQLV
YLHLRFHGYGDGKWTDSAVRRYVTDAGPLLDRLHKLVRADCTTRNKRRAA
RLQANYDQLEARITALAEQEDLQRVRPDLDGNEIMALLDIPAGPLVGRAW
NFLKELRLERGPLSRDEATAELLAWWQTQRNR
333992969YP_004525583.1 PE protein [Mycobacterium sp. JDM601]MNKTTVGALLSAPIIIAGVTAAPAPAAATDHHILDYALAAEALVMIPAMN
QNWLDLSKELYLVPNGFPEDGDATFLQVPETYDLNASIKGATDILVDAIK
TRWDAGDFDSGDPLYIFGYSQANVAAGLAMERLAEETDIPKDALHFVMVG
DSAAEGGFLSGFLPTLLQWVPEEWHDDVITMVYQVAEMMNIDSVIGLVTP
NDLYTADVYSLSSDGFANWDDGHQMAGMFSDHLAYLGLSPEEIASATQTV
SGDTVYHMIDTANVNMFQALVNSAEMIMGGFLAWF
333992967YP_004525581.1 hypothetical protein JDM601_4327 [Mycobacterium sp. JDM601]MDTRAPASLWRSARSLPEFWRLLELRAASQFGDGLFQAGLAGALLFNPDR
AAAPWAIAGAFAVLFLPYSVLGPFAGALLDRWDRRMVLVVANIARLVLVL
GIAALLAIGAGDLPVLCAALIANGFTRFIASGLSAALPHVVPRDQVVTMN
ALAIATGAVAAFLGANFMLVPRWLVGANDRGAASIIAAVAIPVAIALLLS
LRFGRHVLGPDDTKRAIHGSVLYAVTMGWLHGIRTVRDRPTVAATLSGLA
AHRMAFGINTLLVLVMVRHVGEHTVSGLGTTALFVAAAGAGSFLATLLTP
PAVHRWGRYATANGALAAAAVIQFAGIGLYLPVLVLCGFLLGVAGQVVKL
CADTAMQIDVDDALRGHVFAVQDSLFWASFVLAVSATAAVVPPDGQAPWL
IVAGTLLYLAGLAGHSLIGRPRDPVGGIQYGHG
333992965YP_004525579.1 transmembrane protein [Mycobacterium sp. JDM601]MLIMGVLCLVAAVVSLVFGVRTLARPLTGDPEQLVLRAVAPAQVAVGVIL
AVGGALVLAGPPAVALLALIISITGALVILAAGAWQGARYAARQSAAAGA
AGGCGSGCGCGDAAPVEDVGCGAGCGCAGGAPPEPEPASGCGSGCGCS
333992963YP_004525577.1 hypothetical protein JDM601_4323 [Mycobacterium sp. JDM601]MTGRLVAGHLGGRGFVHLNRVKGAAFRPDRHSLISVALQADEGFVPGRLR
PWRRLAAAGYRRAKAGAPLPGPSRKDPWR
333992961YP_004525575.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MPTALITGAGGGIGSAIASALAPTHTLLLAGRPSARLDAVAERLGATTWP
LDLADGDAIESATEIVDELDVLVHNAGVMLPGAAGESYIEEWRATFEVNV
FGAVALTLALLPALRQARGHVVFINSGAGQRVSAGMASYSASKFALRAFA
DSLRSDEPALRVTTVYPGRVDTEMQHDLVAYEGGQYDPDRFLRPDTVAEV
VAAAVRTPPDAHLHEVVVRPR
333992959YP_004525573.1 phosphate ABC transporter ATP-binding protein [Mycobacterium sp. JDMTVSAREPVSLTAKGIQLSFGKNAVLRGVDLDVPAGSTAAVIGPSGSGKS
TMLRTLNRLHEPDGGDILLGGRSVLDDNPDELRQRIGMVFQHFNLFPHRS
VLDNIALAPRKLLGMSQDAARELALGLLDRVGLKNKATARPSALSGGQQQ
RVAIARALAMQPQVMLFDEATSALDPELVKGILALIAELGADGMTMVVVT
HEMAFARSASDTVVFMDRGKVVESGPPEQIFDNAETDRLQKFLSQVL
333992957YP_004525571.1 oxidoreductase [Mycobacterium sp. JDM601]MQLHPQHAAQYGAIRDAVGRCEDLGVDVAFNWDHFFPLYGDPDGPHFECW
TMLGAWAEQTSRIQIGALVTCNSYRNPELLADMARTVDHIGDGRLILGIG
SGWKDRDYHEYGYEFGTAGSRLDDLAAALPRIKTRLSQLNPPPTRHIPLL
IGGGGERKTLRLVAEHADMWHSFTDADTYPHKAAILAEHCAALGRDPATI
EHSTALGNDHTEAELLAAAESMAELGVSLLTVGSSGPDYDLTAAEALCRW
RDQR
333992955YP_004525569.1 myo-inositol-1-phosphate synthase [Mycobacterium sp. JDM601]MTEQTTDVRVAIVGVGNCASSLVQGVQYYQNADDTSTVPGLMHVRFGPYH
VRDVKFVAAFDVDAKKVGFDLSEAIFASENNTIKIADVPPTNVVVQRGPT
LDGIGKYYADTIEVSDADAVDVVSVLKEAKVDVLVSYLPVGSDEADKFYA
QCAIDAGVAFVNALPVFIASDPVWAKKFADAGVPVVGDDIKSQVGATITH
RVMAKLFEDRGVTLDRTYQLNVGGNMDFKNMLERERLESKKVSKTQAVTS
NLTGSLAGKVEDKNVHIGPSDHVAWLDDRKWAYVRLEGRAFGDAPLNLEY
KLEVWDSPNSAGIIIDAVRAAKIAKDRGIGGPIIPASAYLMKSPPKQLPD
DVARAQLEEFIVG
333992953YP_004525567.1 hypothetical protein JDM601_4313 [Mycobacterium sp. JDM601]MATRQSSGTRAKDSDRDDVCRILDAALAEGQLSSEEHRERVSAATRAVTL
GDLHSLIADLQTASAPVQLPALNKPVGFGGRAVAAAALGAAVLLGLGIGW
GVYGNTSSPLSFTSDPGAKPDGVAPLVLTPPRRLHSLGGLSGLLEQARAK
FGDTLGYRLVVYPDYASLTRADPTEDRRELDYSYRGGWGDPSSSAKNSGA
VLVDLSGFDIKAAVGILRGAPETLGIKDGDVKSTYLIVEPARDPTTPGAL
SLSVYVSSDYGGGYINFAGDGSVKRINYPS
333992951YP_004525565.1 bifunctional penicillin-binding protein 1A/1B PonA1 [Mycobacterium MGARRGPGSPDDRQTAIIPAVDDAVTDDLRDPIDAVRAALDGAPRQREQA
LSGRGPRRQPPPEKPVEPPPRRTDRVQHTDRPTAADPLDWLRRHPPNWTW
VRRGLYVAAAVILLLPIITFAMAYSITDVPSPGDIRTNQVSTILANDGSE
LAKIIPPEGNRVDIDINQVPVYVRDAVLAAEDRDFYSNPGFSVSGFARAV
KNNLFGGDTQGGSTITQQYVKNALVGSERAGLRGLVRKAKELVIATKMSS
AWPKDDVLQAYLNIIYFGRGSYGIAAASRAYFDKPVEQLDVAEGALLAAL
IQRPSTLDPAVDPEGALDRWNWVLDGMVETGALTAGERAAQQFPETVPPE
LARSQNITTGPNGLIQRQVTKELLELFDIDEQTLNTQGLQITTTIDPQAQ
DAAVDAVDTYLKDQIPNMRSAVVSIDPRDGSVRAYYGGSDANGFDFAQAG
LQTGSSFKVFALVAALEQGIGLGYQIDSSPLAIEGGRIKITNAEGESCGV
CNIAEALKRSLNTAYYRLMLKLKNGAQDVADAAHAAGVAKSFPGVPHTLS
QDGGPPEGGVVLGQYQTRVIDMASAYATLAASGVYHPPHFVAKVVNADGQ
VLFDAQTSEDTGEQRIPKAVADNVTSAMQPIAGWSRGHNLAGGRPSAAKT
GTTQLGDTGANRDGWMVGYTPSLSTAVWVGTTGGDEPLVNQWGGPVYGAG
IPADIWKATMDGALRGTSNESFPTPTEIGGYAGVPAAPPPPPPEELAPPE
PSETVIQPTIEIAPGITIPIGPPTTIPVAPPQPQAPLPGQAPQPQVPPPG
EPESTGPPPGEPAPPMP
333992949YP_004525563.1 transmembrane protein [Mycobacterium sp. JDM601]MVSPLPLAEDLRSADDRDLPTRTDDVVHALSNTIGGPVGRHALVGRARFM
TPLRVMFLIAVLFLALGWTTKSACLQSVGSGGPDERVANWDNERAYFQLC
YSDVVPLYTAELLNQGKFPYKSSWVEKDGTGKPQIRYDGLPAQRYMEYPV
LTGLYQYSAMALAKTYTAITKVVKIPALSGVAEVVVFFDIVAVGLALAWL
VTVWSTAGLAGRRVWDAALVAASPLVIFQVFTNFDALATAFAGAGLLAWA
RRRPVAAGVLLGLGTAAKLYPVLLLYPLLLLGLRTGRLRDVRRTVVATAL
SWLAVNLPVLVFAPRGWTEFFRLNSRRGDDMDSIYNVVKSLTGWRGFDGE
LGLWQPPTVLNIVVAVSFALCCAGIGYIALTAPRRPRVTQLAFLLVAAFL
LTNKVWSPQFSLWLVPLAVLALPHRRLLLAWMAVDALVWVPRMYYLYSVS
DRSLPEQVFTSTVLLRDLAVLGLCALVIRQIYRPDQAPVDLVRERGVDDP
AGGVFDRAADAPPAWLPARRFRSAARPPVA
333992947YP_004525561.1 single-strand binding protein Ssb [Mycobacterium sp. JDM601]MAIGDTTITVVGNLTADPDLRFTPSGAAVANFTVASTPRIYDRQSGEWKD
GDALFLRCNIWREAAENVAESLTRGSRVIVTGRLRQRSFETREGEKRTVY
EIEVDEVGPSLRYATAKINKVSRGGGGGGFGAGGGAAAGAAPMAQSGGAP
AEDPWGSAPASGSFGGADDEPPF
333992945YP_004525559.1 50S ribosomal protein L9 [Mycobacterium sp. JDM601]MKLILTAEVDHLGAAGDTVEVKDGYGRNYLLPRGLAILATRGAQKQADDI
RRARETKQVRDLDHAKELKAALDALGPVTLPMKTAADSGKLFGSVTAGDV
VTAIKKAGGPNLDRRIVRLPKAHIKAIGSHPVSVHLHPEVHVDVTLDVAA
AN
333992943YP_004525557.1 hypothetical protein JDM601_4303 [Mycobacterium sp. JDM601]MVPASFSWHDVDTWSTVAELRGGRLADDVATLNYSTLFIHRPRQVPTDAT
LWSDLTTSSLSKVITSRSLPTAVTHHWSSISSTTCPTGDGRTRYECCAAR
PPQYPAMTGLPLRPIAELTAAVSGHGRSVVVLTGAGISMPEPSRLPGAWA
WKTELLKALAARSDLGFDGLGRSDLRQHLDDLAHLGETTDIKLEATLQAI
DDAQPALAQQLVECVIHGVPPNAIHEYLARAVISGAVRTVVTPNFDELIE
DAAAVYGSPLTQWVTGEPPRLAHVLHVHGTATAVRSLRHTLNRFELRLPT
DEHRLVADVLRDEVVALGWSATDPDILSALAEGSGPVRVLLAGHDPAPET
AQTLEALARRRPVILYPGGFDAAFGRQRWPSHSREQDVTPSGVTPTQSVI
DRLSVPHARTAIAHLSFRHQLRAPQDQVVLDAWASRIRRDDPHDVLAFRR
AMVEQRQASRKVLNAALIQAAICIMTADPHDLSTLGDVIERIGGGLNPFK
RVIGLPFHVTAVMLMARRGRVDPFARARLARALDGLGLVRPAKVQLQRAF
ASLDADASDIWVRGHLHRLLAAVKVRLDSTCDWQSDIATALELFRFDNRS
LEMGNVYRTEAMCHVVSGRLGWRADAAHSLAMAEHHYRIAADASAFGLLR
LQRRIIRLPLALARLVSRLA
333992941YP_004525555.1 cobalamin synthesis protein P47K [Mycobacterium sp. JDM601]MADRNLPAIPVIALTGYLGAGKTTLLNHVLRAPGARIGVVINDFGELNVD
AGLVTGQVDEPVSIAGGCICHLPDEGGLDDALEKLADPKLALDAIIIEAS
GVAEPADVSRVIRFSGVERIRHGGVVDVIDAAEHFDTVDTRSAPPQRYGV
ASLVVVNKLDRIAEESRVEALGRVEARVRELNPHAHVVGAVAGRVDPRLL
YDVSDGDASGQMSFRELLLDEALGAHDEHHDHMHATSVTVVGDGAVDPGP
LIDLLEQPPRGVYRMKGTVAIGKRHYLFNVVGTSVHVMTAPVAAGASHLV
AIGTHLDTEDVRARMAEALRPCSGKVAASGMRRLQRLRRYSI
333992939YP_004525553.1 hypothetical protein JDM601_4299 [Mycobacterium sp. JDM601]MATKVRRAFWLLERLAPGIGSRWAVELWCTPPIIESSLRMPPGVKPGEPL
EAYWNGHRIVGEAWGEGPPVYLVHGWGGRRPHLGMFIKPLVESGHRVIAF
DLPSHNESDPGVLAPGRTTAIECAEAVAAMIRTHGPARAVVAHSLGSNAT
AFAASWGTTVGRLVFLAPMGEFPIYLDLFAARHGFGRRIRAGLHRRLERR
IGMSLEDTNMVRIAEKTDYPPLLLIHDPDDPETPYVTSEKIVASWPGARL
MTTQGLGRLAHFRILRHRPAIRAGVEFIGSASV
333992937YP_004525551.1 PE protein [Mycobacterium sp. JDM601]MLTKAFAPIAIAGTVAGGVLAGPPAYAAHADINLLAGTAFFVGPTTLSTP
SPTFAQTAADLFLQPLGFDAGDDPTSCVVGIGDCDAPLRVLSTPALIQQG
HSSFVGAAEIVRAVHAELDANPDAYDADNPLWVFGWSQGATAGSIAMAQL
AHDGIDPELVHFVFIGNPVGADTASTDMGGASSSDLFDTGLLSGVQTPND
WFTVTDYTIPGDPVTDPASTSALGLFYEHMMYLGLTPDQVANHIATTDGM
ITDIDISGDFDQFDAWLNAWSHGLIDSGWWEGIFYSVVAFFYSAFGNIED
FFGDWLGIDWGGVEDTLDFWFPVEP
333992935YP_004525549.1 diacylglycerol kinase [Mycobacterium sp. JDM601]MMPLRRRRSGLHRITEGLGELDAEVFEAIAHSPSRLLDATMPALTRAADH
SKLWLALAAVMAATGRPTVRRAATRGVASLAITSLVTNQLVKRIRPRARP
NVMLVPLLRRAHRLPRSNSLPSGHAASAAAFATGVGLESPLLGLPIAGLA
GLVGLSRIATGAHYPGDVLAGLGIGAAISVLGAQLVPPITSPPPPHTDAL
RVRCPARPDGAGVTLVVNPRSGGGRAGEVAEQVREALPAVTVIELGPDDD
VTEALRRAADSAEVLAIAGGDGSVAAAAGVAVERDLPLAVFPGGTLNHFA
KDIGCDTTAKTVAAVADGDLSRVDVVRFNDAATVVNTASIGAYPAFVRRR
ERLQHKVGKPLASAYAMLLTLRREQPVRIAYDDKTLQTSLFFLGNSVYLP
AGFAPAVRHRMDDGLLDVRILEVGRPWSTLRIVAALLTGRLQRSRLYHEL
RVPRFRFTAPDGPVPIARDGEVDSPCSEAEFSVCYRALQVFRPLPPNPR
333992933YP_004525547.1 beta-lactamase domain-containing protein [Mycobacterium sp. JDM601]MSLDNALRTEPELVPSRYAVQVGDIEVLVISDGVLPITASTMATNVDPAD
LAHWLSDMFLPPAVIDWPLNVVVVRSGEQTILVDAGLGMEFPDFPRAGQT
VARLEAAGIDPAAVTDVVLTHLHMDHVGGLLADGLKARLRPDLRIHVAAA
EAEFWEAPDFSGTRMPAPVPAALQSIASRFLDDYRSRLVPFETEYEVAPG
VLVCRTGGHTPGHSVVRLASGGDRLTFAGDAVFQVGFENPEWHNGFEHDP
EEAARVRIRLLRELASTGESLVATHLPFPSVCRVGVAGNAFRCVPAVWDY
333992931YP_004525545.1 hypothetical protein JDM601_4290 [Mycobacterium sp. JDM601]MSTRAHWQVLSGWFLIAVWLAATVAGALSTGSSVQAVAQAIYGGALTLFV
VLHTLTLYRPAGAAAYFVVALAVSFGLEACSVATGFPFGFYVHHMEGPRA
LGVPFTVVAAWVILAWLAWILARVIVGDDRNRRLSVVATPVVATLILGGY
DLVIDPIGAYVRGLFSYGSPNGALGVPLSNFFGWVLTGWVLFQAFALVER
RWRRDSAPARSTLVMPVVVWLGLALQVNLEMLRVGDGVATIQGGRSVPFA
DIYATCVATTWFTMGLVVAIAVVRLYADQSRTKLNG
333992929YP_004525543.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MLVTGGGSGIGQACVLRILSEGGRVVAADISADGLGDTVAKAGEAGSRLS
TVVMDIGDEQSVRGGVTRAVESLGGLDTLVNAAGILRSSHLAQTTLADFE
QVLRINLVGTFLVTREAIGALHEGKSPSVVNFSSTSAHFAHPYMAAYAAS
KGGVLSMTHAWAMEFAKAGIRFNSVQPGSISSGMTDGTGASRQSVGPGLP
ADADFTLFGKVAPMLPLDGGAIFANPDAVAGVVAMLGSDDASFITGTEVR
IDGGSHM
333992927YP_004525541.1 hypothetical protein JDM601_4288 [Mycobacterium sp. JDM601]MVTDTAEGVDRSVQFPRHLRVEHTEASHRGIPANPMSAGCRWR
333992925YP_004525539.1 MCE-family protein [Mycobacterium sp. JDM601]MAVAAATVALAVGLFRGSFASTVPVTVLSSRAGLVMNADAKVKLHGAQVG
SVRSIESLPDGRAALHLAMDPAYMDVIPANVRVDIASSTVFGSKYVELIP
PADPATGSLQRGQVLHGDHVTVEINTVFERLSQVLSRIEPTKLNETLGAL
STALDGRGDRIGQMMADLDAFLARVDPSLTAMEHELSVAPRVVEAYADAA
PYLVTTADAATRMSDVAVSEQHHLDALLISVIGLADTGNDVVGTNRRAIT
DTMALLGPTTDLTNQYHEALTCGLGGAVQLANAPGTPLPGGLLLQTVVLG
QERYRYPQNLPKVAATGGPQCTDLPKVGFQKRPPFVITDVNANPAQYGNE
GILLNSDGLKQLLYGPIDGPPRNSAQIGHPG
333992923YP_004525537.1 MCE-family protein [Mycobacterium sp. JDM601]MLKYRDSALVRTGLVGLVLMVLIILVGLHTKQLLAMATSIRYQAVFAEAG
GLSAGNNVKVAGVNVGAVSGVELDHGRALVTFAVDSKVRLGKDTTAHVGI
GTLLGERVLVVEPRGSGSIGARGVIPLSRTASPYSLTDALGEFTSNTAAT
DTAALNQSLDTLSATVERLAPQLAPTFDGISRLSRSLHNRNESLAGLLTT
ASDVTGILSERSDQVNRLILNADELLGVLQDRRRAIVDLLANTTAVAQQL
SALVDDNEQQLAPTLEQLNKVSAMLERNRDNLTNTLKGLAKYQLTQGEAV
NNGFYYYGFASNLLPGPAIQPFLDYALGFRRGVNAGQPPDNAGPRAEFPF
PYNGIPGGSR
333992921YP_004525535.1 virulence factor Mce family protein [Mycobacterium sp. JDM601]MVVDNWRANIEISVRPDVTIPANAVARVGQTSLLGSMHLALDPAVGEPAI
GRLRPGATIPISKSSTYPSTEQTLSSLSVVVNGGGLTQIGDIVRNFSAAL
DGRQVQIRDLLGRMNTVVTMLDTQHDNIIAAISSLNRLAETFAGQRDVLT
AALDRIPAALDVLNKQRPQLITALRKMGDFSSTATQLLNDSHADIVRNLK
NLEPTVRALADVGPDLATALAFLPTYPYTQEFIDRGIRGDYMNQFIVFDF
TIPRLKSGILLGTRWGEPGASLVPAPGDPWYSTYTRDPLKAPVAELPSEV
ATAPPLVGPPMDTSAAPFDPSQGGS
333992919YP_004525533.1 hypothetical protein JDM601_4279 [Mycobacterium sp. JDM601]MLRAPALATIAAVAMLNAVSTGAIAAADHPDWGLNGTYAATSNGEWARKN
EVFYEQESRRSTWAITTQCSYPGECTGTVQSDGGWTAPIYQQSNVWYVKH
AIDNWIPCPDGGSAPGLQTFRFKAMTPEGAYADPASTTLTGEDITTGPSG
ACGVNKPVYINMPFKLVKIG
333992917YP_004525531.1 hypothetical protein JDM601_4277 [Mycobacterium sp. JDM601]MSKTGTLVALAEAEAAEAEAVAAKARARVIRLQEEEQNAGDDGDVQPRPD
HRAVEPGLSLLARVRELALARRRPAAVAVVVCSCALLVLSALMVQQHRRA
QADQRHRAEFVAVARQVVVTLMSIDYNDAEGSVQRIVNNSTGPFRTEFQG
AADDFVKVSKDAKVTTKATVNAAAVESMTPDSAVVLVAASSTVSNAAGAE
DAPRRWRLTVDLQREGDQIKMSKVEFVP
333992915YP_004525529.1 hypothetical protein JDM601_4275 [Mycobacterium sp. JDM601]MSRHVTPEEVQLGEAVFGPLTQSVRELIDVAIRSDADADDARRAHALIEE
ATALLGTRLDPKPFGVPSTGDGRYLPWGNVAIGLRNAIAPPLIIQRDDTD
RVATDLALGAAYEGPPGQVHGGMCALILDHLLGATAHRAGAPAFTGTLTL
RYVAPTPLGRLRAEAWVEREERGKTFAAGHILDAQGGVTVQAEGVFIRPK
ANA
333992913YP_004525527.1 oxidoreductase [Mycobacterium sp. JDM601]MTSVSLDPPYISFCPANTSSSWPLIREVGALCVNILSEHQQAVCAQFATR
GIDKFAGVSWVPGGNGAPALQGTLASVEADVEYEHAAGDHTIVVARVTGL
RAHADRGPLLFYLGGYGRFDGGRHA
333992911YP_004525525.1 dehydrogenase [Mycobacterium sp. JDM601]MTNAHHITVDLLVVGSGTGMAAALAAHEVGLSTLIVEKTGYVGGSTARSG
GAFWMPANPILIGAGSNDTRSAARSYVGAVIGDAAPHDRAHAFLDHGAAT
VEMLRRTTPMKFQWAKGYSDYHPERPGGSALGRTCECRPFNTAVLGSELE
RLRPGVMKSSFPMPVTGADYRWLNLMARIPLKALPRIMLRAFQGIGGLAL
RRRYAAGGQALAAGMYAGVLRAGIPVWTDAPVCDLIVDDDRVAGAVVDRN
GVQVSVTARRGVVLAAGGFDHMMSWRHKFQSELLGEHASLGAEGNTGDAI
RLAQDVCGADTMLMDQAWWFPAFAPLPGAEPTVMLAERSLPGCLLVDQTG
QRFVNEAIDYMSFGQKLLERERVGNPVEVMWMIFDQKYRNSYLLAAELFP
RMPIPQTWYDAGIAHRAEDLSALASAIGVDPPVFIATMDRFNAMARTGVD
IDFNRGVSAYDRYYGDPTTAPNPNLRPLDRGPFYAVKVVLSDLGTCGGLR
ADVYGRALREDGSVIDGLYAIGNTAANAFGASYPGAGATIGQGLVFGYIA
ALHAAATLK
333992909YP_004525523.1 hypothetical protein JDM601_4269 [Mycobacterium sp. JDM601]MLARKSSWEQTSVQWNGAAVDLCKERQTAGAGLRPGMFLVCTKLRASIEA
AAGAGSLPVLDEL
333992907YP_004525521.1 lipase [Mycobacterium sp. JDM601]MIAPHRRVLDPDAAARVATFGPAMPLRERGLAAVRASLESAPPPADMPEM
GDVTDTAVAGPGGPVPIRIYRPEPAGGPAPVIVHLHGGGLVMGSNHSFEP
MARAMAAASGAVVIAVDYRLAPENPPPAQFEDAMAVTEWAAANAGTLGLD
ATRLVIAGDSAGGGVAAAVALWVRDQGGPEIFAQVLMYPGVDRDMAAASI
LSQPDAPMLSRADIDYLHELADVGAGTPHDVRRVPAYAADLSGLPQAIVV
TAELDPISDWGERYARRLRDAGVQTTITRYPGIYHGFLMRSEATARGRLA
MAEIGALLRAKFANPLPF
333992905YP_004525519.1 hypothetical protein JDM601_4265 [Mycobacterium sp. JDM601]MSTDNTISLTELQNFIGEFWYHYDQADYPKMGAAFAADATYLSRSDSGAC
PFEESLAADLTSAAEVVPWLIEHRDASPYPLRHHTTNLHITGREGDVTYA
RFYLFVNQVTNFVPFAVSSGVAEVGVRRGGSSPSGLEFTTMSVILDVTNS
EPLVGSGLPGAENAATTT
333992903YP_004525517.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MALPRLVPAAAAESASTATLRAEVRAFLAEQLTTGGFTPSVDAWLCGWDE
AFTAALAARGWLGMTVPTAYGGRGRSFLDRFVVTEELLAAGAPVAAHWIA
DRQIVPSLLKYGTEEQKREFLPKIAAGECFFGIGMSEPDSGSDLASVRTR
AVQTEGGWRLTGTKVWTSGAHRAHAFIVLARTAPLDPADRHAGLSQFIVR
FDGPGIEVRPIVSMGGSHHFNEVILDDAFVPDTMVFGEIGEGWRQVTSEL
SFERSGPERLLSTFPLLAASAQAMAAQQIPHDADLGRLVARIAGLHQMST
AVAGALERRQSADLAAAVVKVLGTSTEGDIADFADLRAGDDSVIESSYRE
LIAAAVDQRPGFTLRGGTNEVLRGVIARGLGMR
333992901YP_004525515.1 aldehyde dehydrogenase [Mycobacterium sp. JDM601]MSNHDYARSKLFIDGRWVDPAGTATIEVIDPATEQVCGSVPSGTEADVDA
AVAAARRAFDPLITVDERRGRLDAVITAMERRLPDIAETITQEMGAPIRI
AQSVQTRVPLAVARGFADALARYEFEERIANSLVLREPYGVVAAITPWNY
PLYQVVAKVLPAIAAGCTVVLKPSNDAPLSVFEFVDALQDAGLPPGVVNL
VSGPGRVIGERMAAHPEVDFVSFTGSTSVGSRVGELAGQSIKKVALELGG
KSANVILAGADLDTAIKVGVGNAFLNGGQTCMAWTRMLVPLSRYSEALEL
VQAAVSKYSVGDPWDPGTRIGPSASEAQYQTVLGFIERAPQEGARLVAGG
GQKVHDVGYYIAPTVFADVDPASELGQEEVFGPVLAVIPFRDTDEALDIA
NGTPYGLSGAVWAADDDTAIAFARQVQTGQLDINGGKYNPAAPFGGYKKS
GIGRELGRIGFEEYLQIKSLQLP
333992899YP_004525513.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MKQLDAVLAAARSHALGDIPRRPARKHPDKIALIDGDVTLTFADFEHLVN
RATAALQDQGFRPGDRVAILAHNCWQYAVLAFATARAAVVLVPINFMLTA
EEIAFILEHSGVSGFIVEADLAATAQTAMQGSRSVRTTAALVPPGQTLPS
GWSDFAQWLQTTSKAPQPYVADDQLIRLMYTSGTESRPKGAMHSTRSLMG
NYISSIIAGSMESTDIEIHSLPLYHCAQLDNFLITDIYLGATSIILPRPE
PEAVLRAIEKYGVTSYFAPPTVWISLLRSPLFDQVDLSTLCKGYYGASAM
PVEILAEIRDRLPGLRLWNFYGQTEMAPLASALGPDEQDAHPGAAGRPVI
NVETAILDENDAHVGSGIVGEIAHRSPHLMLGYLDDAAKTAEAFRGGWFH
SGDLGYYDTHGLLHVVDRKKDMIKTGGENVASREVEEVLYRHAGIEEAAV
FGLPHPVWVEAVVAAVVVRDGIEIAEGDVLTHCRTHLAGFKTPKRVFFVE
SLPKNPSGKLLKRELRDRFSLEQPAVT
333992897YP_004525511.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MAVTARSHQPSPSTRAGQTKSLPGTIAETIDLIEAAGGTAFGIAADLEDT
GQRAGLIDQVVERTGRLDILVNNAGYADYSIIEKMSMETFDRTVEHYVRT
PFVLIQQAIPRMRRQGAGWIVNIGSVTGLAPARPYRPYNKTSGDVVYASM
KAALHRLTQGLAAELLDANIAVNVVGPSSAVRTPGADSLIPETFPTEPVE
YLAETVLAMCHLPAAERTGLVAFSLHYPWSQQLAVHSLDGSTRLPPLEPP
KVANPNILPAGL
333992895YP_004525509.1 hypothetical protein JDM601_4255 [Mycobacterium sp. JDM601]MAEVFVIDRILTKPGQTRRFVDRYLAEYAPGARERGMTLQNVLVSPPIWF
DDQSNTVTITWSLPSPLAWWQMTWQGRPDATVGQWWSAIDELVVERTRSV
AAAAHDVDALCGEATDV
333992893YP_004525507.1 lipase [Mycobacterium sp. JDM601]MILDPQIASIIEVLNAGFPPVHTMTGDEARTAIRARFTPPANPEPVAEVH
DRAVAGPGGPVQIRIYRPTAADETPVPTLVYAHGGGWVFCDLDSHDGLCR
DFANRLPAVVVSVHYRRASEEGRWPAAAEDTYTVTNWAADHIGELGGDPN
LLLVGGDSAGGNLAAVTALMARDRMGPRLAAQLLLYPVIAADFDTQSYRQ
FGRGYYNPLPALQWYWDQYVPDVADRTHPYASPLHAADHSGLPPTVAVIA
GHDPLRDEGLAYIEALRRAGVPTVQRYFEGAVHGFMTMPTLGICARARKQ
ACAYLTGLLPRPVKN
333992891YP_004525505.1 flavoprotein [Mycobacterium sp. JDM601]MEATRAGADVLVLERTGSWGGAAAMAGGFIYLGGGTSLQAACGFEDSVDN
MSAFLNAAMGPGADENRIADYCAGSVAHFEWLVGCGVPFKAEFFGEPGWE
PLGDHGLMYSGGENSHPFNTIASPAPRGHIPQMVDKKQGEASAGYMLMKP
LVNTALAAGARALYDIRAQRLAVESDGRVVGVIARQYGKDIALRARRGVV
LATGSFAYNDAMVAQFAPRIAGRPAASVEQHDGQSIRMAQALGADLAHMD
ATEVAIFIDPQQLVRGILVNGRGQRYVAEDSYPGRIGQLTLYHQDNTAYL
ILDDAAQEAAMASASPKLMMRPPTWVAGTVAELESEMGLAPGSLQATVAT
YNAGAARGTDPLLHKKAQWLRPIGSPVGAIDLRDCTGGFTLGGLATTLDA
EVVHVSGVPIPGLYAAGRSAAGLAAWGYASGISLGDGSFYGRRAGRSAAR
P
333992889YP_004525503.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MIDSVAELADQLRGQAAEAEKIGKLTDNTVKTMKQIGNIRLLQPKGLGGL
EVHPREFAETVMLTAALDPSAGWINGVVGVHPYQLAYADPRVGAEIWSDD
VDTWVASPYAPQGVAKPVDGGYLFNGRWQFSSGTDHCDWIILGAMIGDAD
GKPLMPPQMLHMILPRKDYEIVEDSWDVVGLRGTGSKDVIVSDAFVPAYR
TMDAMKVMDGTAQREAGMTEPLYLMPWSTMFPLGISAATIGIAEGALAAA
LDYQRERVNSSGVAIKDDPYVMYAIGEAAADINAARQELLTNADRIYDMV
AAGKDVSFEDRAAGRRTQVRAVWRAVSAVDEIFARCGGNAARMDKPLQRY
WRDVHVGQAHAIHVPGTVYHASALSSLGVDPQGPLRAMI
333992887YP_004525501.1 monooxygenase [Mycobacterium sp. JDM601]MGAGFGGLYALHKFRQQGLAVRAFEAAPEVGGTWYFNRYPGARCDVESLD
YCYSFSDELQQEWTWTEKYATQAEILEYIKWVADKLDLRPGVTFNTRVVS
AVYDEEAVRWTVATDTGETVTARFVVMATGPLSSPLTPDIPGLDTFAGKT
YHTAHWPHDDVDFTGKRVGVIGTGSSGVQSIPIIAEQAAHLYVFQRTPNY
SVPAGNRPLTAEEIKHAKATYEERRRLSWRSGGGSPHVAHPKLTMEVTPE
ERRAAFEERWQLGGVLFSKTFADQMISLEANKEARKFYEEKIRAEIDDPA
VAELLIPNDHPIGTKRICTDTNYFQTFNRPTVTLVSVRKTPIESIDRTGI
QTSAAHFDLDAIVLATGFDAMTGTLAKIDIVGRNGQKLSDHWADGPRTYL
GLGVDGFPNLFLVSGPGAPAVLANMVLHAEAHINWISNAIAYLDEHGYAA
IEATKDAVADWIAECNQRADATLFPKANSWYMGANVPGKPRVFMLFIGGF
ATYLDICAEVAGAGYKGFNLLKAP
333992885YP_004525499.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MGRAATEKLRATGHTVIGIDLKSADVIADLSTAEGRRTAAATALAACDGV
LDGAVLAAGLGPIAGRQRLIAQVNYFGVVELLMALRPALARADRAKVVVI
GSNSTTTTPLVPQRAIRALLAGDADRALRAVRIFGKSAAAIMYAASKIAV
SRWVRRHAVTHAWAGSGIRLNALAPGAIMTPLLAEQLANPQEAKAIKAFP
VPIGGYGDPSQLADWMVFMLSDAADFMCGSVVFVDGGSDAYFRADSWPTA
VPAVSLPRYLTRSFRHGQSNG
333992883YP_004525497.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MRSPRSTRADSTREALLSAAERLIAERGVEAVTHRQIVEAAGQGNNAAVA
YHFGTKKELVRAIEASHAGHIEELRTARVADTDDSAGLRDWVGCLVQPLT
DHLASLPAPTWYARFAAQVMTDPTYRRVVTKSALESESLRHVIDRIGHGI
PELPRHVRSERNIMMRTVLMYTCAEIERGFADDGNGPRPDWPRAGRSLVD
AIAGLWQAPVSDR
333992881YP_004525495.1 glyoxalase [Mycobacterium sp. JDM601]MTADLHPLFEYPWPDGEFRLFQLGFVVPDLLSAAARWVKVFGVGPFHIMP
RAQSRCRYRGTDASVDVQIGVAQAGPVQVELIRDHTANNSVFAEMASLHG
DNQFGFHQVSTLSRDYDAKLAHYLDQGYELACEFTNPGQRVAFIDTFAEF
GFFTEIVEDKPSFRINLATIARTCETWDGTDPIRLLTRDGYRTPDEPWKD
ENQ
333992879YP_004525493.1 oxidoreductase [Mycobacterium sp. JDM601]MVLRKDASALDGRVAVITGGGSGIGRGIAETFAEFGARVVIWEKDPETAE
LAAAAAGGLACAIDVRDADQVDAALATTIAEAGVPTVLVNNAGGVFASPL
LETAAKGWETLIRSNLTHVLLCTQRVAQALVRRGEPGSIINIASIEGTRA
APGYAAYAAAKAGVVNFTKTAALELAPHGIRVNCLAPDLTLTEGIERVGS
SEMLAHAGYMIPMGRPGHVDEMAGAAVFLAGDLSTYVTGQTLHVDGGTHA
AGGWYHHPDTGEYLLGPPRPKPE
333992877YP_004525491.1 hypothetical protein JDM601_4237 [Mycobacterium sp. JDM601]MTRSVSRREALRYGALLAPALAVPGFFAATAGAPKAAAEGLQLIDFAHRL
VEPERIKAAGFAGALVYVSELRPGATFDFKPVTRDYADRLRTAGLQIVSC
YQFGKPGWPDSPSDFTGGYDGGAADARTALRLHTAAGGPPSAPIFFSVDE
DIDAKTWKKLAVQWFRGINSVLGAARTGIYGGARQCSWAIADDVIGHSTS
AGHRWAWQTRAWSGGEREPAAVLFQREMVTATDPGFLIDDIHVDVDDVLA
ADFGQWELVR
333992875YP_004525489.1 PPE family protein [Mycobacterium sp. JDM601]MDYGAVPPEVNSARMYAGPGVDPMLSAAAAWNLLAAELRSAAISFEWSVA
GLVSQGWWGPSASAMTAAAEPYISWMSVTAEQAEQTAAQAYAAADAYASA
YAMTVPPPAIAANRVMLAALVKTNALGLNTPEIAATEARYAQMWAQDAVA
MYSYAAAAASATELVPFAVAPETTSSDDESSSGALPADTGDAHSQVPSAL
RSMASPAEGTRPTDPDWHWTKFFDGLFDGTWGHDDGSGLNINAQLWNTIA
ATGIFDPGGNLEGFAGLATLGFLARGMEGGTAALTGGGLSSAPGVTLASA
EAAGRAAGAAVGGAGSPVSAGVGRATLVGSLSAPPSWGTAVPAAAPSAGT
ASGWTVAPDSRSVTAMPPPMLPNGGGRSGSFGLGTPRYGTKLTVMPRPVV
VG
333992873YP_004525487.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MADQSGVSITTVYRYYPTKHHLFSALLLHYTRSVTPPEPATGCPAADISE
LMAGICRSMLARPRLARAMITSVNARRAESGAAGDFNLREIILSVAGITR
PASQDAQLALLVEQCAYGVLSWAVMGETTPAQAETDMRRACELLLAPWRK
T
333992871YP_004525485.1 oxidoreductase [Mycobacterium sp. JDM601]MRLGLFTPVVIQIPGTASEWEADGGIDDVAEIGATADDLGFAHLTCSEHV
AVPVEVAAVRGATYWDPLATLSFLAARTRRIRLVTSVLVLGYHHPLEIAK
RYGTLDRVSAGRLTLGVGVGSLREEFDLLGCAWEDRGARADDAMKALRAS
LSTSRPAYHGDYYRYDSLIVEPCAVQPRVPIWVGGRTRRSLRRAVELGDG
WTPFGLTVDEIAKMLGSVDVPDDFAVVLATPPLDPIGAPQHATDQIERLA
EAGATDVSCVISAQSAGHFCNQLAALAQLTNLAGKGS
333992869YP_004525483.1 peroxidase [Mycobacterium sp. JDM601]MTFDDYTDLTVCGGPVRVYRAGDTGPPLLLLHGAMLDTAHGVWRRVAPAL
AADFRVYLIDLPRHGASRPWRGVLDDAFFRRFLHELLDALGLPQVALIGL
SLGAGIATGFALEHSERVSSLVAIGPGGLDAKRPAQLLTWLVMRTPGLLR
AGTWCLARFPGAIRRSMVANLTAGEQTPDFEEIMAAAVGEARAKHRYGEK
ALDDWQIESYGPRSMRLNLLPELPRLAVPTLWVRGADDPLVGAGALAKAH
AATPDSRLATIAGAGHIVTYDRPDELVNLVREFLESVP
333992867YP_004525481.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MPMPGKFTADDFVDAAIRLILAGGPGAATAVAVAEAVGAPSGSVYHRFPA
RRDLLAAAWLTPVRRFHQDVLPLLAADGDPVAIGVAAARQVLLWSAANPD
EAALLARYSRSDFVGPDCSPAVLAEADTLDRRTADALGAFLARFPAADRA
RVLLAVIDAPLALVRRSLAAGGPDADTAELAADVARRLLD
333992865YP_004525479.1 hypothetical protein JDM601_4225 [Mycobacterium sp. JDM601]MSTVALRTELPISAEHAAALARKPELMQFVLAPVLKMPSLSAPDRLEVGI
RASARLWWFGVIPSWTHHLEIKELDDLMIYTNEHGGPVRTWNHRLTFTPI
DEQRCSYTDEIETDPGIKGLGTRLFIRLMFAHRHRRWRSLAAILA
333992863YP_004525477.1 IclR family transcriptional regulator [Mycobacterium sp. JDM601]MVNLFDHLAGAGSDGMTLAEVSRHLDVHKASCHSMLSELLRAGWLLRDPV
RKSYHLGPALVRLGRAAAGRYPALVLARSAMAELSATTGAHCVAFAVSDD
YSTVVDQVRSRHGGGHPMPIGTQFPHRPPYGASVVAWGAPDARQRWLAAL
PEGVRSRYRRALVAAEQRGYAVGLHILPDLRLQELALIVRSAEVRSTRLS
QLAQALTDELLHTEQWFPINLDPERSYEVSHIDSPILEGSRIALMLSLVP
SAEPTSGAAIARLGTQLSSTTRRLSAALAETPDLYS
333992861YP_004525475.1 acetoacetate decarboxylase [Mycobacterium sp. JDM601]MSANAVRYGPRPPQERVDHEIDATKAPIATEAVTVTYLTDPDIVAAVLPR
PLEPGAEPLVRIQLQRVRLDGRPPFGSAVFSVTARHGDIAGDYPLFMPQS
TEQSVTGGRETFGEPKKLAHIEVQRDGDRVDAGVERLGHRLIGVHGRVTG
PGELPPDQTNTEFYFKFLRAPDGNGITDPHLVYGEYHRHYELLEIIDGTV
ELGDSPLDPVADIAIREIRSITWCRRRTVQVGRIAQPVPAEWLLPYVHQR
YDDVALLAAPRPAQV
333992859YP_004525473.1 amidohydrolase [Mycobacterium sp. JDM601]MDPYLIISADTHAELPTERYREYVDPEYAEDFEAYLAEKTAAAKAGGFID
EEFAQEWFSEHGDGIAGGWDVALRDRELDGDGVVGEVIFPDADAVTGVAG
APFGAGLGQSGDLDPGRAMAGARAHNRWLAELCSHSPERRAGVAVVPILA
DVDAAVAEITRAAESGLRGGILIPARWVGYPPYHDRRYDKVWAACQDLQM
PVHTHSGPAPQEEYGGHLGIYVTEVRWWGARPLWFALWSGVFERFPGLRW
GVTECGAFWANDLLWLMDTRFLREHSAKKMSHQMEGDLTMPPSAYFDRNC
FIGATTTERRELARRYEIGVSNLLWGNDFPHPEGTWPHTRKWLRSSFWDI
PIEETRQMLGLAAADLYNFDLAALAPLAERIGPTPADLGQDDAVSIPKWE
AARQTGRHWLTDAEPIPDLVEN
333992857YP_004525471.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MGERVIDRLMGIADQLREQAGDAEKIGRLTDQTVKAMKSAGSIRLLQSAK
HGGYEAHPREWAETVMATAALDPSAGWVAGVVGVHPYQLAYADPRVGDEV
WAEDIDTWMASPYAPQGVAKPVDGGYLFNGHWQFSSGTDHCDWIILGAIV
ADADGVPVMPPAILHMILPRADYEIVDDSWDVVGLRGTGSKDVIVQDAFV
PGYRTMDGLKVMDGSAQREAGMTNPLYLMPWSTMFPLGISSAVIGIAEGA
LAAHLDYQRERVSATGTAIKDDPYVMYAIGEAAADINAARQELLANADRI
YDMVADGKEISFADRAAGRRTQVRAVWRAVMAVDQIFARSGGNALRMDKP
LQRYWRDAHAGLNHAIHVPGTTFHASALSSLGVEPEGLLRAMI
333992855YP_004525469.1 hypothetical protein JDM601_4215 [Mycobacterium sp. JDM601]MFGTNWRLFGDLAAVAFVAMLCFATGAFCYVRRLQDRTPPPISEGIGARK
AVLVKVRKREPLSSQELEFAGRVIADQRTPLAFCIPAAIFSLGCFYVLGS
LEQLHGATPSERTFLGVIPMLGSFNVTAQLVRVVKLKKRLPAAAQQRVGE
333992853YP_004525467.1 transporter [Mycobacterium sp. JDM601]MSQPRSLPARVVRALSVPIIIFWALLAVVTNTFVPQVERVAEELAGPMVP
TYAPSQAAMLAIGEKFQESDSTSMTMLVLEADRPLGDADHHYYDALVRTL
QSDTDHVQYVMDTWGKPITAAGAQSLDGKAAYVLLRLAGDIGQLEANESV
AAVRQTVAASDPPPGLTVYVSGAAPLAADTVATANRSLNNITIATIFLII
FMLLVVYRSYITMLVPLFGVLILMLAAKGVIATLGHFGYIELSSFAVNLV
VALTLGAGTDYGIFLMGRYHEARLNGESREDAFYTAYRGVSHVILGSGLT
IAGAAFCLSFARLNYFNTMGPAVAISMVLTVTGALTLGPAVLSVGSLLGL
FDPRQQVKARLYRRIATSVVRWPKPILTASAALVTVGAVFVPTYQVSFDD
RTYQPHDSAANLGFAAADRHFPQSKLFSEMLMIESDHDMRNSADFISLDR
VAKALIRLPGVAMVQSITRPMGRALEHASLPYLFTMQGSANGQQLPFTRE
QNANTDKQAQIMGHTVEVLQTTIALTQKLAEEMHSTVLTMAEMQALTEQM
DEEIANLDDFMRPIRSYFYWEPHCYDIPVCWAFRSLWDMMDSVDKLAENI
KNAVSSLEVVDSLLPQLVTQLNIMADDQIALRSLIVNTYGSSDIQARNTD
ETFDDMINVGNDFDASGSDDFFYIPRPAFDNEDIKTGMQLMMSPDGKAAR
FIVTHEGNAMGPEGIAHVEKFPDAIKIALKETSLAGAKIYIGGSGSNNKD
IQQYSRSDLLIAAIAAFVLIFLIMLVITRSLVAAMVIPGTVAFSYAGAFG
LSVLIWQHLIGLHLHWLILPLTFIILVAVGSDYNLLLIARLKEELGAGLN
TGLIRALGSTGGVVTSAGLVFAFTMLAMLASDLRTIGQLGSTVCIGLLLD
TLIVRSFIVPCLVRIYGPWFWWPTIVRQRPLRQRAQPSAPA
333992851YP_004525465.1 hypothetical protein JDM601_4211 [Mycobacterium sp. JDM601]MSESDQVLPPAAAARAAIRADLTLIDDAQARLRGADTDIVGNAFRVEIAE
RLETQHRVNRGLSYRIFGEIADPADGPEDPRMPADTKVSDLLWSRLRITR
GEIRRRFRIAARIRPRRSLTGPPAPAELPEVGAAVEAGAIGDDHIAAITN
ALDVLPAKVAATDREDAQRTLVHHATQQDAKFVTAVGHRIADTINPDGNY
SDEDRARRRNLVLGRQGPDGMSRVTGCIDPEARAYLEAIVAAVRPGHRRP
DAPEQRDSRTSGQRAHDALKLGLRHGIESGAMGTHRGVPVTVIVTTKLAE
LNQAAHALSDPAVPMPTPARTGGGSRLPMRDLIRMAANSIHYLAVFDNHS
ERPLYLGRSRRIATLDQRIICHARDRGCTRPNCPEPGYHCEVHHCTEWSK
GGRTDADALYFACGCDHGAHTRGDLQTHVTKRGRLAWTDGTGPPRINHLH
HPDELLDTDKGTQCDEDP
333992849YP_004525463.1 transcriptional regulator [Mycobacterium sp. JDM601]MPVAAGSRTLPSPLLTAATDTLRQLGPRRFSLTAVAEAAGVSRGTVHNIL
GTRDDAIAAALEQLSSAFIETMAAEVSRQQTLAEQVAAAAVLISAHRRRS
TAEPRAINQSVLVLLLEHGGDELMRRSVQLWTPLVRAAQRSGEVSEALDA
GRAGEWIVRLLFSFELLPPMRVNLDSPRAVRRFVCDHIVAGLSGARR
333992847YP_004525461.1 hypothetical protein JDM601_4207 [Mycobacterium sp. JDM601]MARMYPCEQVDLGFIDQAPQRFSNSVELAVTPEQVWEVLADADAWPRWAS
VITNVTWTSPEPHGVGTTRLVDMRGGIIGDEEFLAWEPCRHMAFRFNASS
TSALAVFVEDYRIEPTPQGCRLTWTLANRLTGPAKLFSPVSGPLMNLAFR
RFLSNLRRYTDQRFATVQRG
333992845YP_004525459.1 cytochrome P450 [Mycobacterium sp. JDM601]MHDDVDLTDLDRFTSGFPYHVFDVLRRESPVWFHPGTAHSPGGEGFWVLS
RYADIVAAATDSETFSSETGGGRDGGGTTLEDMPLGFAVGALLNMMDDPR
HAKFRKLLMPSMTPRALRGIEQDLRRRAVAIVDAALAKRECDFLVDVAAE
LPLQAVAELVGVPQQDRHELMDWANVTLDYEDREVGEVSDRLVQAHARMH
AYGAELLEYKRAHPADDLLSVVTHAEIDGEPLTANEQQMFLSLIMAAGSE
TTRNSIAIGMSALSEHPEAWERLRRDRQLLPVAVEELLRWASSTPYNRRT
ATRDVELHGRQIRAGDKVSLWWASANRDESVFAEPYTFDILRNPNPHLTF
GRGVHFCLGSTLARLEMRVIFDVLLDRVGTVTLTGPIEYVRSNKHAGVRH
MPVTIEPR
333992843YP_004525457.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MRTRGWGGDVPASDDEAVARILAATRRTIDERGEQTSIADVARTLGVTRQ
TVYRYFPSTEELLSATAIDGVGDFLDQLAAALAGITDPGEAVAEGVALTL
ERLPGDPYVGLLLRAQQPSAFAVTVTTDTGRAFGHSILERLDVDWSGFDA
QAIDDIIEMVLRTLQSFILAPLPAPGAELRRLLRRWIAPAVTAARSATKV
RGSVGSSRR
333992841YP_004525455.1 aldehyde dehydrogenase [Mycobacterium sp. JDM601]MALQSVIDDLAKRPGTGELIPVIDPATEEQITEFRDAGPEAVDEAVARAK
AAYQSGVWTDIAARERAKVLWRLGDLIDEHAKEFTELESLDAGMPPAQAE
MIVSTCAEFFRYYAGWCTKLNGASYQVQMEGGVNSTHANFHAYTHKEPYG
VVGLIYPWNGPLFNACAKVAPALAAGCSSVVKPAEETPLSAVLLEKLIAQ
AGVPDGVTNFVIGYGATAGAAITAHPDVEKVAFTGSTEVGKQIMRDSADN
LKKVTLELGGKSPVLIYSDADLDMAIMMASMGIFVHSGQGCVCGSRIFVQ
RSVYERVVAGIAMIGDNLVLGGPKDEGAMISPLVSQKQLDRVLGYIDQGK
KDGVEIVSGGYRLDRKGYFVKPTVVTGVDPATSRLYREEIFGPVVTILPF
DDDDEAVAMANDTSYGLAATAWTTNLARAHDLGKRLNAGMVGLNCQLTFD
HNVPFGGYQQSGVGKEFGYEGIDAYLKTKSIWAAL
333992839YP_004525453.1 hypothetical protein JDM601_4198 [Mycobacterium sp. JDM601]MTDSPNKAISRRTFVRGAAWSLPALAIVLTAPRAWAQPPGSQECGDPNEL
IENCVVQLPEDFTSTSFSTTAVAGGTNYSVLFSTNIRPGPLVPAAATGYR
INSTGLTGTKRDGVAFSITPHIGERGPRVLGAPSGSSLGFVVDVPWTAGQ
LVRNFAYAFDVVYLNGLTEIQTCSYVTAMTLADNGLIVGGVGSVTFSPPR
LTSCA
333992837YP_004525451.1 hypothetical protein JDM601_4197 [Mycobacterium sp. JDM601]MLGAGMAGLLAARVVSEFYDSVTVVDRDRLPDHPVHRQGVPQGRHLHSFL
TGGTNILGELFPGILDELAAAGAVVIDNPDLSGRYAQVRGRVDRIGNVAF
LDGHDAIEPVHHRGAVTGVRVRNQRNRLTQVLHADLVVDATGRASHTAEF
LAEHGFGSVPEQRRNANWGYSSQLLRIPPDRVTDRLVFVNRGRPAPVLLL
VPYERDTWMLVIARSDEHGAPPSDFTALLAAAKQVLPADIMAGLRDATPM
GQLTVSRDTGALWHRYDRMPRLPAGLVVIGDGLCRLNPLHGQGMTMAALE
AVALRDCLRERGPELPQRFFRAAADRIAPIWAANAAADQPSSPDHPQPLR
RRLDRWFAEAANLRGSRHLTRPLIPESPTGTLLSRRPSAGGSHA
333992835YP_004525449.1 PPE family protein PPE51 [Mycobacterium sp. JDM601]MIDFAAIPPEVTSSLLYAGPGAESLLTAATAWQGLATELQAVTASYRAVL
ATLTVDWIGPSSAAMVAAATPFVDWVSGAAAQATQASAQAGAAASAFEVA
LAAVVPPPVIAANRSLREALLATNTLGQNTAAIAAADAQYAQMWAQDAAA
MVQYEAAAASATRLTPFASPPQSANPAGQAGPGIAAAGDASEISGIYEGL
FSTLGGVMKFGGLGNVVLSGPNFGMVQFKSFYKPQALLPEIPRSALGAGL
GAGLSGGPASAARAGMARAVTAGVGAAPTVGALSVPPGWATATPAIRLAA
TALPASLPTPAGAVAAPAAGLLNPAALGALTGGALGAPGSQLINGANIRG
GSGSGGKGGKGTAPVQLDRVLAQLQKQKDAVQHWQIDEAGLDDLLEELAK
KPGFHAVHLGKTVRDAGAAGSAPATAMP
333992833YP_004525447.1 hypothetical protein JDM601_4193 [Mycobacterium sp. JDM601]MKLAAAAVMLAACGAATGVAGAEPTPAPAPAPAPKQVIDTDGTFTVGKDI
APGTYRSDGPREGNACYWRRNSGDKIVDSAMTKKPQVVLIEPSDTTFRTD
RCAPWQLTECPPTCAPVPQQSAGLPDVLKGFVPQQRPAAPSPAPSGG
333992831YP_004525445.1 serine protease [Mycobacterium sp. JDM601]MTVCYRHPDRATALRCTRCGRYICGDCMRGAAVGQHCVDCAQQGAAPRRS
RPMVRAASTTPVISYGLIALNVLAFIGQMSSHQLDSELVLWSPAVADGQL
YRLLTSAFLHYGAMHLLLNMWALYVVGPPLEGLLGRSRFSALYLLSALGG
SVTVYLLAPLNTATAGASGAIFGLFGATLIVGRRLQMDIGWVAAIIVINL
VFTFTIPQISWQGHVGGLVTGLLVAAAYVYPAAPRRNQIQLAVSVALLVL
FVALIWWRTAELVS
333992829YP_004525443.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MMLTDLSVDEDRQARLAAELAAVDPQFAAARPDPAVADAIAQPGLALPQL
VRDALAGYADRPALGQRAVDFVTDPATGRTIAQLQARYDTISYGELAERI
RALSAALVAAAVRPGDRVAVLGFTSVDYTVIDMALGQIHAVAVPLQTSAA
VSTLTPIVAETEPRVIAASIDSLADAVELVRSGPAPTRLMVFDYHEQVDD
HRDALADARAKLAGAEVVVEPLADLLTRGRTLSPAGLPAHDAGQDTDPLA
LLVYTSGSTGAPKGAMYPQRNVARMWVRSAKNWFGPTAASITLNFMPMSH
IMGRGILYGTLGNGGTAYFSARSDLSTFLEDLALVRPTELNFVPRIWEML
YQHFQSEVNGITGADRAAAEAQVLAEMRRDLLGGRCIFAMTGSAPISDEL
RSWVSELTGLHLLNGYGSTEAGMVLFDGVVQRPPVLDYKLVDVPELGYFG
TDKPHPRGELLLKTENLFPGYYQRPEITAEVFDADGYYRTGDVVAEIGPD
QLVYVDRRNNVLKLAQGEFVTLAKLEAEFGNSPLVRQIYVYGNSAQPYLL
AVVVPTPEALAALGDTTELKKAIAESLQQVARDADLQSYEVPRDFIVETE
PFSLENGLLTGIRKLAWPKLKAHYGDRLEQRYAELAEGQANELSELLRHG
AQRPALETVSRAAAALLGAAAADLHPDAHFTDLGGDSLSALTFGNLLRDI
FDVDVPVGVIVSPATDLAAIADYVETERRAAQTGSRRPSFASVHGRDAVE
VAAADLTLDKFLDEATLAAAPTLPAPSGQVRTVLLTGATGFLGRYLALEW
LERLAPVGGKLICLVRARSDADARARLDATFDSGDAKLLARYTELAAEHL
EVIAGDKGEANLGLDQQVWQRLADTVDVIADPAALVNHVLPYSELFGPNV
VGTAELIRVALTGKIKPFTYFSTIGVGDQIPLGRFTEDADVREMSPLRAI
NDGYANGYGNSKWAGEVLLREAHDRCGLPVAVFRCDMILADTSYAGQLNL
PDMFTRMMFSLVAAGVAPASFYELDAAGNRQRAHYDGLPVEFIAEASTTL
GAGSAGMADAGFATYHLMNPYDDGLGMDEFVDWLIEAGHPIERIDDYGDW
LQRFETTLRALPERQRQASLLPLLHNYQKPQPAICGSIAPTDKFRAAVQE
AKIGATQDIPHVTPAVIVKYITDLELLGLL
333992827YP_004525441.1 hypothetical protein JDM601_4187 [Mycobacterium sp. JDM601]MAGSVALVMGASTGIGQAAQAVQPTPGFAVAAIEPAAGSVVGVAYPVIVT
FTGPVSDRVGAERGIHIAVTGKTASGMPSGHFEWVSDDVVHWVPDGYWSP
HSTIEVDAHGMSTGFETGDAVLGLADISDHTFTVSVNGDTLRVMAASMGK
PKRPTPIGSFTALSKERTVKFDSRTIGIPLNDPEGYLINGEYGVRVTWSG
VYVHSAPWSVGSQGYSNVSHGCINLSPDDAAWYFNTVRLGDPIVVQA
333992825YP_004525439.1 elongation factor G [Mycobacterium sp. JDM601]MQEDAMSAKTGTSRGAAAAPTAASPAAIRNVVLVGPPGSGKTTLVEAMLV
AAGVLPRAGSVGDGSTVCDYDDAEIRQQRSVGVACASLSHDGVKVNLIDT
PGYADFLGELRAGLRAADAALFVVAANEDIDDAANVLWQECHQLAMPRAV
VVTKLDHARADCPGTVAAARTAFGEQVLPLYLPAPTAPGAGLTGLLAAER
CEAPDTERQRGELIEAIIEESEDESLLDRYLDGEPTDGAVLTKDLERALE
QVLARGSLFPVIPVCSNTGVGVAELLEVITAEFPGPPEHLLPEVFTPDGA
ARPGLSCDPAGPLLAEVVRTTSDPYVGRVSLVRVFSGTIKPDSGIHVSGH
CTGFFGDGSGHADHDEDDRIGALAFPLGRQQRPATTVMAGDICTVGRLSH
AETGDTLSDKAEPLVCKPWSMPDPLLPVAVVPHAKTDEDKLAVGLARLAA
EDPGLRIERNPETHQTVLWCLGEGHSGIVLDALTHWVSVDTVALRIALRE
TFVSRANGHGRHVKQSGGHGQYAVCDIEVEPLAQGSGFEFVDRVVGGAVP
RQFIPSVEKGVRAQLERGLTGGAGAGYPVVDIRVTLLDGKAHSVDSSDFA
FQMAGAAALRDAAAAGRVRLLEPIDDVTVLVPDELVGAVMGDLSARRARV
VGTDKVGADRTLVKAEVPQTELIRYVVDLRSLTHGTGSFTRRFARYEPLP
ESSASVAAHAGSSA
333992823YP_004525437.1 transmembrane protein [Mycobacterium sp. JDM601]MIRRHYDSETKLSWVLAALAGVLAATAYTHSEGYFVTFMTGNAGRAVLGV
FDGNEWLSISAAALLFSFLGGVLTASVFRRRVWPHQPHGALLLTAVALLA
ATLLDWTVAGGPSLPLPLLPILLVAYGVGALNTTFVRDGEVSIPLSYVTG
TVVKLGQGIERHFNGGSIADWLGHFMLLAGYTSGAAVGGCISLAAGGTWM
LGIATAVCVLAMWYTHRYVDRRDVWR
333992821YP_004525435.1 acyl-CoA transferase [Mycobacterium sp. JDM601]MVPTAAEAPRPLAGVRVIEIASFVAVPLAGMTLAQLGADVVRIDPVGGAA
DYRRWPVTEDGTSIYWTGLNKGKRSMAADLRAPEGQRLVQRLIAESGVVL
TNMAGRQWLSFDTLVAERADLIHLEVLGRADGSTAVDYTVNAATGFPLVT
GPADYGAPINHVLPAWDIACGLHGALAVVAALHRRDRTGEPCRIRLALED
VALGTASALGFLTEAMVNGARRERIGNALYGSYGQTFTGSDGVSFMIVTL
TNRHFRDLTELTGTTKVIAALADARDIDFGDEGQRYRHRDVLTGLFNGWF
AERTGAQIEAALAGTSLLWDRYRSFADVAADERLGDNAMFRSLHQPRIGD
YLAAGLPASLDGVHPPAVAAPALGADTEQLLTELGMTIDDIELLRRNGTV
ATD
333992819YP_004525433.1 hypothetical protein JDM601_4180 [Mycobacterium sp. JDM601]MLSATFGLVNLGPSPAEREETAYEAAIRSMPNGSYKVGVLGKGGVGKTTV
AASVGSVFAALRRADHVVAVDADTAFGRLGSRIDPRATSSYWDLAADAGM
QSFADISSRVGANAAGLYVLIGEPAAGRRRILDAALYREAALRLDRHFTI
SIIDCGSTMDSPVTQEALRDLDALIVVSSPWADGAGAAAKTMEWLADRGQ
GGLLQRTVVVLNDSDGHADQRTRSALTAQFLRHGQAVVEVPFDPHLRPGG
VIDIMQEMAPATRRRFLQIAAIIAHYFSSRPGGRDAKTRPNQSR
333992817YP_004525431.1 hypothetical protein JDM601_4177 [Mycobacterium sp. JDM601]MFERGVVEPGPGGCHHHLILRTFRRRLVWHRRAIERIGPCDIERRSA
333992815YP_004525429.1 NADH-dependent glutamate synthase small subunit GltD [MycobacteriumMADPKGFLTHTQRILPLRRPVSERVGDWNEVYQEFAEDTLREQAGRCMDC
GVPFCHTGCPLGNLIPEWNDLVRTGRWREAFDRLHATNNFPDFTGRLCPA
PCEPACVLGINQPPVTIKQVEYEIVERGFMQGWAEPIRPSKMTGKSVAVV
GSGPAGLAAAQQLTRAGHAVTVYERDDRIGGLLRYGIPEFKMEKRIVDRR
LAQMVAEGTVFRAGVNVGVDVTADQLRSDFDAVVLAGGATAWRDLPIPGR
ELDGIHQAMEYLPWANRVQAGDLSEPPITAHGKKVVIIGGGDTGADCLGT
VHRQGGTCVHQFEIMPRPPETRDPSTPWPMYPLIMRTSAAHEEGGDRVFS
VNTEEFIGRDGHVTGLRAHEVRRRNGGFEKVDGTDFELEADLVLLAMGFV
GPERSALLTDLGVEFTGRGTVARDADFATGVPGVYVAGDMGRGQSLIVWA
IAEGRAAAAGADRYLMGKTALPAPVTPTMAPIR
333992813YP_004525427.1 hypothetical protein JDM601_4173 [Mycobacterium sp. JDM601]MDVVTLGIDTKVTLLAAGLIFLLALLLGVWKYQQIVTSENHQAHIYVDIA
HRAALLYSFATLLVAVFVELSGWPTWVNMTASMVMVYFFVTAIASYMLHG
ALRDTTNQFEKAGPLLKVGMVLLIIGEIGGFAVLLAGFGVGEF
333992811YP_004525425.1 monooxygenase EthA [Mycobacterium sp. JDM601]MSEYLDVAVVGAGISGISAAWHLQRHCPSKSYAVLERRHDLGGTWDLFRY
PGIRSDSDMFTFAFRFKPWTANTTIADGATIKNYLRETVAESGIAERIRY
GHRLVAADWSDADAAWRLTVESDGETIEIRCGFLIACSGYYDYDDAYAPE
FPGAESFTGPIVHPQHWPTDLDYAGKKIAVIGSGATAVTLVPALVASGAG
HVTMVQRSPGYIGLLRSVDPVARWANRLLPRRVAAMANRWGYIVGQVGVY
QVSRRFPNFMRKTLMAMARRRLPAGFDVAKHFGPSYQPWDQRLCLAPDGD
FFAAISGGRADVVTDEIETFTPSGIRFSSGEELPAELIVTATGLNLRLFG
GAQISRAGKLISPRDTVAYQGMMLSGVPNLAFTVGYSNASWTLKADLVSA
SVCRVLEHMDTHGFDTVVPREPGPHVQERPLVTQISGYVQRALGQLPRAG
SHRPWRLHDNYLLDSVLIRRGKVDARHLLFSRRSNLSREDIP
333992809YP_004525423.1 hypothetical protein JDM601_4169 [Mycobacterium sp. JDM601]MGEPHTPRACGAFPFPDRPLSTVRRNTQRTVDSLNTTLIVCRHD
333992807YP_004525421.1 hypothetical protein JDM601_4167 [Mycobacterium sp. JDM601]MDDSLRSRWERLRERVDEACRDAGRDPSDVDVLPVSKTFGPELIREAVGL
GLRRFGENKVQEIRDKYESLADCGIDWVMIGHLQTNKAGMVARLATEVQS
LDRSRLAAALDRQLRAANRAIDALVQVKTSDEPSKYGLDPAQLLPFLDEL
ADYPTLRVRGLMTLAINTPDLDEVRRCFRRLRELRDAAAARGHDLPRLSM
GMSGDFPLAIAEGATEVRIGTALFGARPYPDSYYWPEAGRAP
333992805YP_004525419.1 hypothetical protein JDM601_4165 [Mycobacterium sp. JDM601]MTDPQGQPDHESAAVPEPATPAEAAQPAEPAQPAAAEPAAPATPPEPAQP
AGADRPAEPPAKKAPAKAAKKTPGKAAKKAPAKAAKKAPAKKAPAKKAPA
KKAPGAVPAPAARPADTNGSGRLADGAKETAAQAKSTVDAARNPLGPSVP
SSSRSPGAVLAAGVLGLLGLLLIRRLLHARRG
333992803YP_004525417.1 nuclear export factor GLE1 family protein [Mycobacterium sp. JDM601MNPAIRAWALSAAIAVVSFAGAAPAWAHVHASSPGAVRGGVAMVTFEVPN
ESPTGSATTELTVTLPDVASARTETQPGWTARLDRDAETGAVRSVTWTAT
AGGIGADQFGLFRIAMKLPDADSVDFPSAQRYADGTVVRWDQPPPPGGGE
AERPVPTLQLAAGPASAPEHHAQHPPPAVSAGPAQTLQSEDDAAGRADNP
ARLLGGAALLVAAVAATLALGRRRA
333992801YP_004525415.1 hypothetical protein JDM601_4161 [Mycobacterium sp. JDM601]MSATFAVRLNRLFDVVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSVATMAALANFFRIKPAFFTDDDYYAKLDAELTWLDSLRDDGVR
RIATHAVGLSPEAQEDVLARIDELRRKEHLSA
333992799YP_004525413.1 hypothetical protein JDM601_4159 [Mycobacterium sp. JDM601]METTGSGRAIEVAPFHSHGELHGFVVFGRWPDSTKEWAQLLSIAVRVASM
PGLLPTTTVFGTREELPDNPGPGTVGLLLAEGTVAGESAIAPGYFAGRQP
SALLMLHPPSETIPSLPECRGAASGCVLLPGLPYLGLEHRAAWVEAESDG
TVTSMVSRVGVDPVSHPDTAILAMLLAA
333992797YP_004525411.1 hypothetical protein JDM601_4157 [Mycobacterium sp. JDM601]MTARPVGPGPVATATGWHAGSSTYKRSYLLASLRAGVIALVLLTVLLAIV
LI
333992795YP_004525409.1 glycerophosphoryl diester phosphodiesterase GlpQ1 [Mycobacterium spMAAADDVVAEHPFVVAHRGASFDRPEHTLAAYDLALQEGADGVECDVRLT
SDGHLVCVHDRRVDRTSTGAGLVSEMTLAQLQNFDYGSWHNGRPDGSPEA
ATPRGAGLLTLDALVAMVLDWHRPVKIFIETKHPVRYGALVERKLLVLLD
RFGIASPASATRSRAVVMSFSAAAVWRVRRAAPMLPTVLLGSAARYLRGS
AATTVGATAIGPSIATLREYPELVDHAAARGRSLYCWTVDRDEDVDFCRD
VGVAWIATNQPARTKARLRAG
333992793YP_004525407.1 transcriptional regulator [Mycobacterium sp. JDM601]MLAMLIVLLGMAGLVGGAAWLDTALHRAAVFTGYPDRPSQGRGTTWLLVG
SDSRAELSAAQQQHLTTGGDVGNGRTDTMLLIHLPATGSGTPTTVVSIPR
DSYVPIPGYGYDKINAAFALGGAPLLTRTVEQATGLRLDHYVEIGFGGFA
TLVDALGGVVLCPDEPIEDPLAGLNLPAGCQKLAGQAALGYVRSRATPRA
DLDRMDHQRLFLSALLARVADPTVWLNPLRWYRVPNAAAHAMTVDAGAGV
LDLAALGWALRGHTTMLTVPVGEFSYTEAGEAVVWDHQQAARLFDELSRD
APPTMATDN
333992791YP_004525405.1 endoglycoceramidase [Mycobacterium sp. JDM601]MGAFLAFGVTPLAAAPAAAADSFDDVFELAWAPFLDEATGGTDWAAVFDP
ASWEAFFGQLNFDGVLPGAAAAEPSLFAPDLTALMHDWVYTPLYTGIDDL
VGSSWMAPVVDGLNQLSGALGLGLMIGDGTAGTAESAAGGAGGWLFGDGG
AGWDNSEVNGVGGAGGAAGFFGNGGAGGSGGEGGAGGVGGAGGWYMGVGG
AGGSGGDGLIGGSGGDGGLGRGWALGVGGVGGDGGDGTHIGGNGGDGGNG
SIWFGGGGDGGDAGNGVYHGPGDLPGLGGAGGLAGAFGTHGAVGNFGTLD
DAPERGPAELATAGNWIVDHDGRVVILQGVNQVYKSPPFSPGGNGFDDDD
AAFLAANGFTAVRLGIYWAQIEPQPGVYDMEYLESVKETIETLKAHGIVS
ILDMHQDLYSSEIGGNGAPDWATMFNPDDNDTSAPFPFGYALNPAQNQAW
DAFWANEKVDGVGLLNHYSRMWQTVADYLGGTPGVAGYEIMNEPWPGTPW
LGSFLGNAHFDRETLTPFYDQVTSAIRSVDPNTTVYYEPNVLFGNATAVT
HIGPVDDDNTVFAFHDYCIFDALGGGSSFGCSLWDGMMMSGAQHYIDRYD
VPGMVTEFGATRNLDTIASQLNSIDPHKFGWLYWGYTNEAGSLVHNTNVA
PTGDNVDEAVVATLAQPYPQVIAGVPNSWSFADGVFSFSYSTAMADGSGS
FGAGSETQISIPQIQFPNGYQVSVTGGTVASEDNAPVLVIESVAGAGTVT
VTVSPTAAG
333992789YP_004525403.1 hypothetical protein JDM601_4149 [Mycobacterium sp. JDM601]MATTTAVTVPTSAERIRSACVRGQALLAIADSTDAAPVNAPVCQLLPDGS
MVVAVPVGDPVAEAAGTGVAAMLELTDHAPLRLRERVRALAWIRGRLLTV
PESEIPALLDRIAAVNPNPALLQVISPRSTARPSAVAAPTDVSYALLRLT
PDSAVLADATGAESVAVDELLAARPDPFCAIEAHWLQHLDSAHPELLARL
ATTKLPPQLRRGRPRPLAVDRYGMWLRVEAADGDHDVRLSFPRPVEDVLS
LNRAVRALMGCPFLNGLQPRRP
333992787YP_004525401.1 phosphoglycerate mutase [Mycobacterium sp. JDM601]MSGRLVLLRHGQSYGNVDRRLDTRPPGSELTPLGRDQARAFAGNGLHRPA
LVAHSVAVRAAQTAAEVSGPFGVTARAIEGIHEVQAGHLENRNDDDAIAE
FNAIYQRWHCGETSVALPGGETAEQVLDRYLPVVTELRMRYLDDDDWIGD
IVVVSHGAAIRLAAATLAGVDRSFALDHHLGNAEAVVLSPITDGRWSCVQ
WGSLTPPFYPEPDADPVGDALRSDTDPMG
333992785YP_004525399.1 hypothetical protein JDM601_4145 [Mycobacterium sp. JDM601]MDPRRFDELVSDALDLIPAQLAAAFDNVVILVEGRNDEEPDLLGLYEGVA
LTERDSSYAGSLPDTITIYRDALLEMCGSDDEVVEEVRITVIHEIAHHFG
IDDDRLHELGWG
333992783YP_004525397.1 seryl-tRNA synthetase [Mycobacterium sp. JDM601]MIDLTLLREDPDRVRRSQLGRGEDPALVDALLAADTARRTAISAADNLRA
EQKAASRSVGAASPEERPVLLARAKELAEQVKAAEAAQAEAEATLRGAHL
AIPNVVIDGVPAGGVDDYTVLDVVGEPPAIENPRDHLDLGESLGVIDMGR
GAKVSGSRFYFLTGAGALLQLGLLQLALRLAVENGFTPMITPALVRPEIM
SGTGFLGAHAEEVYRLEADDLYLVGTSEVPLAGYHADEILELSGGPLRYA
GWSSCFRREAGSYGKDTRGIIRVHQFDKVEAFVYCRPAEAEAEHDRLLGW
QREMLARIEVPYRVIDVAAGDLGSSAARKFDCEAWVPSQGTYRELTSTSN
CTTFQARRLATRYRDDNGKPQTAATLNGTLATTRWLVAILENHQQPDGSV
RVPAALVPYVGVEVLEPSGS
333992781YP_004525395.1 transmembrane proteinm MmpS5 [Mycobacterium sp. JDM601]MQALKRGWLPLLIVVVLVLGTLTVLRLRTFFGGEDSSLISTKVDDTKPYN
PKVVTYEVFGEPGATADISYLDLDSRPQRVDDAVLPWAVTLSTTLSAVSP
NLYAQGKGSTLGCRISIDDELKDERTATGASAMTFCLVKAA
333992779YP_004525393.1 transcriptional regulator [Mycobacterium sp. JDM601]MAKPVAPRGSARERVLQAALDLFMEHSVGGTSLQMIADRLGVSKPAVYYQ
FRSRDDIVMAVVEPMFDDIVRVIKIAEAMPTTQGKRDVTVSGVVELAVRY
RRLTFLFYDRAVEYAVRSREDFMATHDAAAALLQGPSPTAEDRIITTTLL
AGTFTTAADPELEDIDDEQLHSILLDTARRIMAPLT
333992777YP_004525391.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MPRAPQTARSERTREALRQAALVRFLAQGVEDTSAEQIAADAGVSLRTFY
RHFTSKHDLLFADYDAGLQWFRSALADRPPHEPMVESVQAAIFAFPYDVE
AVTRIAALRAEELDPERIVRHIRQVEADFADAVAERLRATQGPADPLRIA
VTARCIAAAVFAAMEVWMLDEDRSLAELARMCRTALESLANR
333992775YP_004525389.1 hypothetical protein JDM601_4135 [Mycobacterium sp. JDM601]MTGSYDDGLVALDRRAITLRRYHFPSGTSKVIPLSAIRGYRAEPLGMLTH
RFRLWGSSDLRRWLPLDVKRPLRSTLITLDLADAGWPQPAFTPVDPTAFQ
ELLDELLAG
333992773YP_004525387.1 acyltransferase [Mycobacterium sp. JDM601]MKITVTGAEHVPPSGGAVVAINHTGYLDFTFAGLAAYLGKPRRRLRFMVK
KEMFDNRFVGPVMRGCRHIAVDRGQGADAYAAAVEYLKAGELVGVYPEAT
ISRSFELKEFKSGAARMAVEAQVPIIPHIVWGAQRIWTKDHPKRLGRTKV
PISVAIGEPIAPTLPVEDLRALLQTRMQHMLEQVQDAYPEHPAGAYWVPH
RLGGGAPTPAEALRLDAEEAARKAAKRDARNQQPPTATGGSE
333992771YP_004525385.1 acyltransferase [Mycobacterium sp. JDM601]MAEPLFRTLETVIPPLVRANGPHPTFEGLENVPECGGAVLTLNHTSYLDW
YPASIAALRRNRRLRFMIKSEMTEVPVIGYVIKHIKLIPVDRSAGAGAYD
VAVQRLREGELVGLHPEATISRSFELREFKTGAARMAQAAGVPLIPVIVW
GIHRVWTKDHPKQLWRNHVPVLVKIGEPMAASGDVEATTAELRGTMAAML
EQAQLQYPHPAGAYWVPRRLGGGAPTMAEALAMREAELAERDRKRMAQPH
GGRLRRALAGRGRH
333992769YP_004525383.1 hypothetical protein JDM601_4129 [Mycobacterium sp. JDM601]MLILPWALDAGPGSKSAGTTPAPPSAAATKLNQQPLPDLGPGVTVREITQ
DEPFTMVALTGGDLSGTSAKVRARRADGSWGPWYATAHEVKDALSQPRPA
DAPAPGPDGTEPVFVGRTTAVQIALTRPESADTKPESKAKPDPKTGAKAG
PGSKPHSTPKPDLGYVPATAAQPFAQNISAVLITPPKAPVDAQWTPPSAA
LAPGQPPNIIPRSQWGAGARGRCGKPAESGPVQAAVVHHTAGSNDYSPED
SAAIIRAIYAYHTRALGWCDIGYNALVDKYGQVFEGRAGGITKGIVGSHA
GGFNKNTWGVSMIGTFDDAPPPPIQLETVGRLLGWRLGLDRTDPRSTVQL
TSGGGSFTHFPRGSALSLPAIIGHRDLDETECPGEHGYVALNEIRDIAAR
FGDPPGPEDLVRTMQGGAIHARWLELGGAAGLLGAPTSPEAIGEGSTKYA
TFERGAVYWSPETGAQPITGAIYDAWAALGYERGMLGLPTSAEIPEPEWI
GQNFQHGTLNYNRADGSVIRVIDGNAEELPPPPPEGPPVQLERFSRVIGV
N
333992767YP_004525381.1 UDP-galactopyranose mutase Glf [Mycobacterium sp. JDM601]MGSGFFGLTIAERVATQLDKRVLVLEKRPHIGGNAYSEAEPQTGIEVHKY
GAHLFHTSNKRVWDYVRQFTDFTSYQHRVFAMHDGQAYQFPMGLGLVSQF
FGRYFSPDEARALIAEQAAEVDTKEAKNFEEKAISLIGRPLYEAFVKHYT
AKQWETDPTELPASNITRLPVRYTFDNRYFNDTYEGLPVDGYTAWLQNMA
ADERIEVRLDTDWFDVREELRAASPEAPVVYTGPLDRYFDYAQGRLGWRT
LDFELEVLEDCGDFQGTAVMNYNDADVPYTRIHEFRHFHPERSYPTDKTV
IMREYGRFARDDDEPYYPINTPDDRAMVEAYRRLAKAEMESAKVLFGGRL
GTYQYLDMHMAIASALSMYDNVLAPHLAEGVPLHENNRENNR
333992765YP_004525379.1 transmembrane protein [Mycobacterium sp. JDM601]MLVAVQSALAGRTGVLPTARSLSHFGEHSLGWLMVSALGALAWPRRRRAW
LTAGAGAFVAHAAAVVIKRVVRRERPHHPAIAVNVGTPSRLSFPSAHATS
TTAAAILLGRAAGLPAKTLPAILVPPMALSRLVLGVHYPSDVATGVVVGA
AVAAAAIRLDNSGGAG
333992763YP_004525377.1 transmembrane protein [Mycobacterium sp. JDM601]MLPSFSASRGLRTPDPRVRPLGWPAVAYTPSVRLSSWAAVAVVLLLFGVG
AWRRRWISDDGLIVLRTVRNLLAGNGPVFNAGERVEANTSTAWTYLMYLG
SWLGGPMRMEYIALVFALALSLAGVALLMLGTTRLYAPNLQGRRALLLPA
GALVYIAVPPARDFATSGLESGLVLAYLGLLWWMLVCWSQALRMPRSRAR
GPLFTGCLAFVAGASVLVRPELALIGGGALIMLLIAAPRQWRPRALILVA
GGALPVAYQIFRMGYYGLLVPGTALAKDAAGDKWSQGMIYLANFNAPYAL
WVPAVLLTALGAALWVGAAVRHRPRRPVPRGVGRWARLVQSPAAVVCFFV
ISGLLQGAYWIRQGGDFMHGRVLLAPLFCMLAPVAVIPVLLPDGARFHRE
AGYPLSGAVGLLWLAVAGWALWAANSPGMGYDATRVTYSGIVDERRFYSQ
ATGHAHPLTAADYLGYPRMRAVLATIEATPDGALLLPSGNYDQWDVVPVI
LPPPPGIGVPTDPQPGDTGPHTVFFTNLGMLSMNTGLDVRLLDQIGLANP
IAAHTERLDHGRIGHDKDLFRDFVVADGPWVKWYPLIPGYLDQDWVAQAE
AALRCPDTAAVLGSVRAPMGPRRFLSNVLHAASYTRYRIERVPRDELIRC
GLAVPEPTRPPYTGMPPDVP
333992761YP_004525375.1 hypothetical protein JDM601_4121 [Mycobacterium sp. JDM601]MGMSGLSKLWRALCVTVLMLGMWGGGAIVGSSAQAAPYESLMVPSPSMGR
DIPVAFLNQGPHAVYLLDAFDAHPEVSNWVTAGNAMNTLAGKGVSVVAPA
GGAYSMYTNWEQDGSKQWDTFLSSELPDWLAANRGLAPGGHGVVGASQGG
YGALALATFHPDRFGFAGSMSGFLNPSHTTESGVISAGLENFGGVDPYGM
WGAPQLGRWKWHDPTVHATLLAQNNTRVWVYSPMGGASNPAAMIGDPAEA
AGSGRFFNMQYRQSRGRNGHFDFSGGDNGWGSWSSQLGAMVGDIVGAIR
333992759YP_004525373.1 hypothetical protein JDM601_4119 [Mycobacterium sp. JDM601]MAKKARKSTAKSPRKSPAKALRNRRRVLAWVAAGAMALAVALVAVVVVIW
IRHPGSPPIADQPSEGVPPTSSAPPRAKKPRPAYQDASCPDVQLVSVPGT
WETSPTDDPLNPTQFPIALLLTVTRPIAEQFDASRVQTYTVPYTAQFHNP
LSADKQMSYNDSRAEGTRNTIKAMTEMNEKCPLTSYVLVGFSQGAVIAGD
IASDIGNGRGPVDEDLVLGVTLIADGRRQEGPGGGIDVPPTPPGQGAEVT
LHELPILSGMGLTMTGARDGGFGDLAERTYEICARGDLICAAPQEAFSIG
KLPATLETLAGGAGQPVHALYGTTAVWSQDGLSATQWTLNWARELVDNAP
HPPHG
333992757YP_004525371.1 polyketide synthase [Mycobacterium sp. JDM601]MSEAPQMTGDDAALRGTSRTDLTVADMRAWLRNWVANATAQPPEKINETA
PLIELGLSSRDAVAMASDIEDYTGVTLSATVAFRHPTIEALATVIIEGEP
VVVDHSGDEDWSREADVDDIAVVGLATRFPGDMNSAEETWTKLLAGIDAI
TDLPEGRWSEFLSEPRIAERVGKARTRGGYLSDIKGFDAEFFALSKMEAD
NIDPQQRMALELTWEALEHARIPASSLRGEPVAVYMGSSNADYQNLALSD
PSVTHPYAITGNASSIIANRVSYFYDFRGPSVAVDTACSSSLVAAHAGVQ
ALRNGEADVAIVGGVNALITPLVTVGFDEVGGVLSPDGRIKSFSSDADGY
ARSEGGGVLVLKRVEDARRDGDQILAVIAGSAVNHDGRSNGLLAPNPDAQ
EAVLRKAYKNAGIDPRTVDYIEAHGTGTILGDPIEAEALGRVVGRGRAAD
KPALLGAVKSNVGHLESAAGAASLAKIVLALQHDKIPPSINYAGPNPYID
FAATHLKVADTVTDWPRYGGYAVAGVSGFGFGGANAHLVVREVLPRDVVE
KEVEEPEAPAPVEDPVLEHEAPRFDEYGEFIGPDGSDDEPEYELPGLTEE
ALRLKEAALAELADRAPARLIPLAVSAFLTSRKKAAAAELADWIDSDEGR
ATPLESIGRALSRRNHGRSRAVVLAHDHDEAIAGLRAVAEGKTKPNVYSA
DGPVTNGPVWVLAGFGAQHRKMGKDLYLRDEIFAEWIDKIDALIQDERGV
SILEMILDDAVDYTADTVEYPIEAVQLVIFAIQIALGELLRAHGANPAAM
IGQSLGEPGAAYFAGGLSLRDTVRIIVPRARLMGEGEAMLFGEYIRLMAL
VEYSAEEIKTVFADFPDLEVCVYAAPSQTVIGGPPEQVDAIIARAEAEGR
FARKFQTKGASHTAQMDPLLGEFTADLQGIEPMPLNCGYFSTVHEGSYIR
PGAEPIHDVDYWKKGLRHSVYFTHGVRNAVDNGYTTFLELAPNPVALMQV
GLTTADAGLPDAQLIATLARKADEVDAMTMAMAQLYVHGHDLDMRTLFPR
HTQGPVGPEEFANIPPTRFKRKPHWLDARFSGDATGVMPGSHVALPDGRH
VFEYAGRGETDLAALVKSAAAAVIPDASLVASEQRAVPAEGSRLVTTLTR
HPGGAAVQVHSRIGESFTLVYDALVSRGGAGGVALPVAVGAGTSVTSESV
AAPADNGLADDTDDAAILHDNLTAGAGLAAGFAKWSPDSGETIADRLGAI
VGGAMGYEPEDLPWEVPLIELGLDSLMAVRIKNRVEYDFDIPPIQLTAVR
DANLYNVEEMLRYAVEHRDEVEALHEHQKTQTPEEIAAEQAALISGATAT
TVAAPAPDPQAEPDTDAAPPASDIPVPPPPTDPTGPAIPPPPTDPSGPTA
GQTGVSTKTAAAAAAKVLTSEAVTEALGADVPPRDAAERVTFATWAIVTG
KSPGGIFNELPALDDDTAVKLAERLSERAEGIITVDDVTSAATIEALATI
VRDHLEEGVVDGFVRTLRAPTQKSAGGASKALPLFVFHPAGGSTVVYEPL
MKRLPADTPVYGIERVEGSIEERAAEYVPKLLEMHDGPFALAGWSLGGAL
AYACAIGLTRAGADVRYVGLIDLVLPGEPIDQSKEGMRARWDRYARFAER
TFNVEVPEIPYEELEKLDDEGQVRFVLDVVAQSGVQIPGGIIEHQRTSYL
DNRALDTIEIQPYDGHVTLYMADRYHDDAIVFEPAYATRKPDGGWGEYIS
DLEIVPIGGEHIQAIDEPYIAKVGAHMSEALNRIEGEQ
333992755YP_004525369.1 Na+/H+ antiporter NhaA [Mycobacterium sp. JDM601]MATAAALLWANYAGQTYSGFWDTEFGWSRLGLRMDGRHWVNDALMTVFFF
VIGLELKHELTQGALAHPRRALVPVIAAVGGAVVPAAIFFAITWGTDAVS
GWGVPMATDPAFAVGILALVAPRAPAGLRAMLLAIATVDDVLAVLVIAFG
YARGLTWGWLAAAAAAAVRCPPRSARHMCSDWAAWPGSASPSPCS
333992753YP_004525367.1 PE family protein [Mycobacterium sp. JDM601]MVSGLTGAPQLTSPAPAQAGVLLSAGTDSLAESNIALIMGPSMIPTPSQQ
YADIVNDLFLQPRGFAGELEVLTTPQAPYLLDDSMAEGAQALVERVQSLI
ADGQAGADNPVTVFGYSQSAALTTLAMQQLYDAGVSTDAVRFVLIGDSAN
PNGGLLVGFEEMQDFYDAMRDAGVTLGNPTPNDLYATDIYTLEYDGYAAF
PHYPLNLLATLNAIMGMATQHMAYLGLTSEQLEQAILLESSPDSLINSYI
VPSEHLPLLLPLLFMPVFGKPLYDLLEPTMRILVNLGYGNIEHGWYDGPA
DQPTMFSLDSQDVDWTEFNAALAVAAQTGWDNFVAGVMDPATYQWLDPAD
DPAFANLIAAGEAMGLGGGSVPELLENLTNLMWESLVGQYLDPAYWADVS
333992751YP_004525365.1 integral membrane transport protein [Mycobacterium sp. JDM601]MSLLLPASRPPAPAKEKRRSTAEQRNRVLRKAIVASAVGNATEWYDYGVY
AVVATYLTGAFFPDTLGNLGTMLGFAVSFVLRPLGGMVWGPIGDRFGRKS
VLVATVLLIAVATTLIGVLPTYATAGWWAPGLLIALRVVQGFSTGGEYGG
AATFMAESAPDAKRGTYGSFLEFGAVAGFVFGSAVVLALEAMFTHEQMVA
WGWRIPFLLALPLGVVGLVLRSRMEETPVFTECVACEEITGSAWDRLVDL
LTNYTRPILVTFALFVVLNIIDYTLVTYQPTYLHATAGLDERSRTTVVLI
GELAMMACIPFAGAWSDRVGRKPLWRASLLGFAVLALPMYWLMGHGFAFA
LVGFTVLSVLFAAPLATVSATFPALFPTQVRYAGFAIADNAAVAVFGGTA
PVLADSVIERTGWQLFPAAYLVFAALIGLVALRFLPETLGYSLRGTGVPG
VPGELERELSVLTAEESARVRRNPAFDEVWAVDKYLRPQQRTPAGYRGVP
QLAGVSGPRIRV
333992749YP_004525363.1 hypothetical protein JDM601_4109 [Mycobacterium sp. JDM601]MQILEEVQDLPSAGNIKAQWVSLWTGPAVGAVLVVALLAFPGFFPPMSPT
MTAEQVARFYTEHTDWIRFSQITFNLCGIMLLPFFMVIVVQMKRMKTQSH
IFAYCYLTAIVSGATIFALSNVFFLVAAFRPDRNPELTLLLNDLAWIVFI
APIGMVLAQFLLLAAAVHFDDGPDPVFPRWVGPYSLATGLAMIPAAGAAV
WQTGPLAWDGLLSFWLRNGAFAAFVVVMFFVLRGALLRQAAAEGVVAG
333992747YP_004525361.1 cytochrome C oxidase subunit III [Mycobacterium sp. JDM601]MLQLEVPTAPRTRLPGDGHIWVMVLGDLVIFTGYFIIFMVYRTMNPAEFL
AAQQHLNVNIGVINTVVLLTSSWFVARSVLAARAGNHRSAVRFVYLGAAG
GVLFMILKGYEWAAKIGAGHANSDLFFSFYYVITGVHLVHVLIGLIALGV
VVRELGNPSRRRPAVIESAAIYWHMVDLLWVIIFGLLYVMR
333992745YP_004525359.1 indolylacetylinositol arabinosyltransferase [Mycobacterium sp. JDM6MSIRTTRLVAIIAGLVGFLLSVATPLLPVVQTTATLNWPQHGELHSVTAP
LISQTPISMSVKAPCALVRELPAEGGTLLSTAPAKGKDAALNGLFITVTE
KRVDVTDRNVVLATAPRAKVEGPGCTDIEVTSSHDGTFATIGGITQRYGW
PDPNLRPQIVGVFSDLSGPAPEGLSLTADIDTRFSTQPTALKRAAIFAAI
LATVIAVLALWRLDRLDGRRMHRLIPSRWRFFSLADVAVVLGFVVWYVIG
ANSSDDGYILGMARVADHAGYMSNYFRWFGSPEDPFGWYYNLLALMTHVS
DASIWIRLPDLVAGLVCWLLLSREVLPRFGPAVAASKPALWAAGMVLLAA
WMPFNNGLRPEGIIAVGALITWVLVERAIISGRLTPAALAIICAAFTLGI
QPTGLIAVAALLAGGRPLLRILVRRHRIHGTWALVAPLLAAGAIILTVVF
ADQTVRAVLEATRIRTAIGPSQAWYTENLRYYYLVLPTVDGSLSRRFGFL
ICALCLFTAMFIMLRRKRIAGVASGPVWRLMGVILATMFSLMFAPTKWVH
HFGLFAAVAGAMAALTTVLVSRQVVRWSRNRMAFAAAVLFVLALCFATTN
GWWYVSSYGVPFNADMPRIGGVTVSTIFFALFAITAGWAAWLHFAPRDRG
EGRVARALTAAPVPVAAGFMVCVFVASMAIGIVREYPSYSNGLANVRAFV
GGCGQADNVLVEPDPNDGALTPLPGRYGELGPLGGVDPVGFTASGVPEKI
VAESLRMSITQPGTDYDWDAPKKLKTAGINGSTVPLPYGLDPARIPLAGS
YSTDGQQESKLTSAWYELPPADDAHPLLAVTAAGTIAGNSVLKGYTTGQD
VQLEYGLPGPDGAVVPGGRLVPYDLFGEWPRMWRNLRYPRKQIPADAVAV
RIVAVDKSLNPRDWIAFTPPRLPEVKTIQEYIGSEQPVLLDWAVGLAFPC
QHPMLHANGVTEVPKYRITPDYNAKKQDTDTWQDGVNGGLLGISDMLLRA
HVMATYLNHDWGRDWGSLRKFDEVVPASPAELELGSATRSGWWTPGEIRI
KA
333992743YP_004525357.1 hypothetical protein JDM601_4103 [Mycobacterium sp. JDM601]MTNAITLRGIELRYVLTHFLHHRDYPATIGELADELESRGFAVAGRASKA
ISDALRWEREHGRVYRRGRGLYGPAGMPRSTEYRIHQRVMALRDRAAGQT
AARKPT
333992741YP_004525355.1 hypothetical protein JDM601_4100 [Mycobacterium sp. JDM601]METVEYGPGRLADLFGERSRRTALLWHGKQPDARTALRPLAERVAAHGVH
VVVPDWDSHHDDGGRTDLLASVGFARERADDADGLILVGWSMGGLAAAGL
AIHAGRYGAGFSHVVCLAGAFLVPDPISGQHPVAALPGGRRCPITLLHGT
ADDVVPVTASREFAAALAHHRWPVELDELSADHGSIAGARYDPEADRYAA
ATDRRTLAVAAEVAERITAAPPARTGRSSPR
333992739YP_004525353.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MVLDATGNPQSILLLGGTSEIGLAICARYLRHAWANVILACLPGDPGRDD
AVAQMEAAGAKSVRVIDFDALDTAAHPAMIDAAFSDGDSPIDIDVAVVAF
GMDADAEELWHNQAKAVQVAQINYTAAVSVGVLLANKMGAQGFGQIIAMS
SVAGERVRRTNFVYGSTKAGLDGFYLGLGEALRDDGVRVLVIRPGQVRTR
FSAHVKEAPLTVDKEDVAELAVTAAAKGKELVWAPGAFRYVMMVLRHVPR
AIFRRLPI
333992737YP_004525351.1 hypothetical protein JDM601_4097 [Mycobacterium sp. JDM601]MPTIAALALAVLGIVLAIFGWFYPSTGQKFSDDQRQEAKGKICDSQAVVR
QGTQFNTNLQNPVPGDLAGDLAVGTNARLSLFAGGAFLHQRLEANPATPD
DLSKAVGDMADTLEALSINYLAGHSPDDAVQQPLRDQLRGQIDVLDNLCQ
PQ
333992735YP_004525349.1 hypothetical protein JDM601_4095 [Mycobacterium sp. JDM601]MKRTTIELDEELVRKAQSVTGSTLRSTVESALRRLIAEAQGEDDERRRRI
TEHLASAGKQVDTDALLSDQAWR
333992733YP_004525347.1 hypothetical protein JDM601_4093 [Mycobacterium sp. JDM601]MRRRDRGRGHPEREERTDGAAGTNHPATTTTFGHTLTLTRHDLIPLSLHI
AAAQQTLCGATLTLILVASTPVHKAGMARVTRR
333992731YP_004525345.1 hypothetical protein JDM601_4091 [Mycobacterium sp. JDM601]MSPLGAQPAHADFDDVLIELFGEGLGDALTTLSADWADQDAWQLVLDPDS
WSPFFDNMGDPAVWDLILSDLDLSGVGATGFDLPGSAAFSWNEINWWMPF
GNGADGTAENPDGAAGGWIFGTGGAGWDADGTGGVIDGGAGGQGGLFGGN
GGAGGDGFDGGDGGAGGAAGLFAWFSHGGAGGDGGEAVTLGTAGGAGGIG
GDAALWGLFSTAGAGGQGGDGLAGAAGLAGTFALGGDGNGGTGENGGAGG
NGGAGGRGSYLFGAGGKGGAAGNGGAGGVGGAGADGADGTSADIHGTSGG
NGGAGGDGGEAGKAGAGGAGGWFAKAGATGATGTQGAGGVGGNGGEGGDG
LDGADGADGTAADPDGTAGTAGGDGGNAGQAGAGGQGAGGQADSGTAGTA
GKGGSGGVGGKGYDAASDDDAAAGTAGGNGGAGGDAGRGGLEADGTRAAD
GAAGVGGAGGDGKDGAAGAAGTASDPHGTDGSAGGAGGNGGQGGLQANGS
RAAQGVGGDGGAGGQGGAGYDALAAGAGAGVSGGNGGVGGDGGAGGTGST
AGQHGAGGVGGKGGSGTDGAHGGAGTAGTADDPDGGAGQAGGNGGNAGVG
GAGGDSGNGQYAASGASGVAGKGGNGGVGGAGYDAASDAGAAAGTAGGNG
GVGGDAGVGGVEADGSRAAAGTAGVGGNGGDGADGADGDNGTQANPDGQA
GQAGGAGGNGGLGGLNADNTRAVTGDGGDGGAGGKGGHGYEGQDGATAGA
AGENGGNGGAGGAGGVGGTGANAGAHGAGGVGGNGGSGGDGATGADGNVG
TASHVDGGAGQAGGAGGNAGKGGVGGANGDGTTAGDGSDGSAGVGGKGGA
GGQGFDGVDGSVGRIDGTNGGAGGAGGDGGQGGLETDGNRAAQGDGGDGG
AGGRGGHGLTGADGAAPGASGANGGAGGNGGVGGVGGQGASEGAAGAGGV
GGNGGNGGAGAAGSKGADGTASHVDGTAGGNGGAGGNAGKAGSGGLSGDG
VQAADGTDGNGGVGGAGGQGGKGYQGADSTTAGVAGGHGGSGGAGGNGGQ
GGLNADGTTRVADGAGGNGGAGGAGGKGYDGQDGADAVEGTGVGAVGGAG
ESGTHGGNGGAGGLGGSGSTQGQQGAGGVGGAGGSGGDGGDGADGANGTQ
NHVDGYDGGAGGAGGNAGKGGIGGAGFGGSAGNGSDGTAGVGGDGGVGGD
GYEGADSTTAGVAGGHGGNGGTGGNGGQGGMEADGTNAAQGVGGNGGAGG
EGGTGYTGNAGVNAIEGTGVGAAGGAGESGTSGGNGGHGGAGGTGSVAGQ
QGAGGAGGAGGSGGAGGDGADGADGTASHVDGYDGGAGGSGGNAGKGGIG
GTGLGGQATDGADGAAGVGGKGGVGGDGHAGADGALGVAGGHGGNGGTGG
NGGQGGLEVDNSRAADGAGGNGGAGGAGGKGYDGQDGADAVEGTGVGAVG
GAGESGTHGGNGGAGGLGGSGSTQGQQGAGGVGGAGGSGGDGGRGGDGAD
GTQTHVDGYDAGAGGAGGNAGKGGIGGAGFGGSAGNGSDGTAGVGGEGGV
GGDGFGGAVGSLGVDGGAGGNGGTGGDGGKGGLEVDNSRAADGAGGDGGN
GGAGGAGYDGQAGINAVEGAGDGATGGVGESGTNGGQGGAGGAGGSGSTT
GQQGLGGVGGAGGSGGAGGRGADGADGTDTHLDGYAGGAGGAGGDAGKGG
AGGVGRDGQADGGAHGAAGVGGDGGDGGTGHTGEAGSLGVDGGTGGNGGV
GGNGGQGGLEVDGTTRAVQGDGGDGGAGGAGGEGYTGQAGANPGDAGEDG
SAGGAGGTGGAGGEGFVGGAGGAGGNAGSGGSGGAGANAAAGSDADGGNG
GSAGAGGKGGAGGAGGSGTSANGSGGAGGNGGDAGTAGDGGDGAGGGGGS
VAGAGGKGGDGATGGVAGAGGAAGTGAGAAGTDGVNGTTSGISSDGGKGG
KGGDGEGFVPEFFGGTGQAGGAGGAGGQGGDAVAGGSAGVGGAGGAGGQG
AAGDNSDPLRQYGIDGGVGGAGGQGGQGGLNSDSTHAGTGNGGAGGAGGK
GGMGTNSVGDGGDGGAGGDGGLGGVGGHAGDGADVAPGGFTGGKGGTGGA
GGDSDAGDGAAGGNGGHGGVNTGKGGAGGAGGNATGDTGNGGAGGAGGDG
GDGLLSGPGAATTGGAGGAGGDGGDSKAGTGGSGGKGGGGGVGNLYAGAG
GAGGDGGDSQTGDGGVGGDGGDGGNGVTGSFGGGQGGRGGAGGAGGASDS
GDGGAGGTGGQGGIGGDGPAGTASSGIGGPNWSAGGKGGDGGAGGASNTG
TGGQGGDAGDGGRGGDGVGLAIGGVNGQNGGAGGAGGSGGTGGDSATGTA
GNGGAAGSGAAGGSGSNGADAAAGSGKAGGTGGNAGAGGTGGTGGAGGSG
GAVNGSGGAGGNGGDAGAAGQGGAGAGGGSGDTAGAGGNGGSGASGGGIG
AGGAAGTGAGTAGTDGADGTTSGTSSDGGKGGKGGDGEGFNVTTGFAQSG
GTGGTGGTGGAAVDGGAAGNGGDGGAGGKGASIGTGAIGGSGGSGGGGAV
SDATGPGFGGAGGGGGGGAYVGGTNGGTATGTATGADGGNGGAGTTTAAG
GHGGTGGAATIHADGAGSSITDGTVNGGAAGDGGLNGVVGHDGADNAMTA
SDGGTIANTTVQSGQDSDTASGGGASLAVTNGGSVADSTVTGGDAGDGFD
GGAATAIVDGTGSAIIRTTVTGGDGGAGGVGGAASVSATAGGLVSDSDAT
GGAASDTAAGGDAIMYADGTGSKVLDSSSAGGNAGAGDANGGTGGDGGLA
VVAATQGGVVSEGSATGGDGGTGTNGGHAGTGGYSEVSAGLQGGAGGSAT
GVGQGGAGGDADGAGSTGGTGGSGNIQGGFVRTGFGGDGGSASGTATGGK
GGDGFGGGHGGKGGIGSVVAGGDGAVATGDAYGGDAGDGHDGGTGGNGYS
GQIAAANDGAHASGTVTAGTGGDGTGLGVTGGQGGYAYIQALGKDSSITE
STVTGGDGSAGHDGVNGKVASDTTMQTKGEGDTITRSTVTGGDSAGTKQG
PGARIVTDGGHVTDSSVTAGTSSDTAIGGSGALNVSGGGTVTGTHLTGGA
GGAGTGAGGAANLTVNGGEVSDTTLTGGNGVDSAGGGTAAMTVGADGTVA
NSSATGGDGGAGGTDSAAGGKGGNATVTVSDGRVDAGHATGGVGGSGGAN
DPDGGAGGKGAAGGAATITVSNGGAASGEAVGGAGGNGGDALANRAGGAG
GVGGAATVTADAGTAGGAATGGAGGNGGNATTTANGAAGAAGNTGTVSAT
DGGVITNGTATAGDSVGGVAGGAASVTADGADSSVTDSSAIGGKAGAGDV
SGGKGGAGGAASVWAKEGGAVTDGHAIGGAGNTGSTGGTGGAGGAASVAA
GGADTTAEGTARGGDGGAGELGGKGGAGGAANVDAGITDAGQIVGNGDST
SGNATGGDGGAADGTGGTGGNGGVAIVRASDGTIGVAGDPSLAQAIGGDG
GAGENGGHGGHGGAGFTFVTNGGTVTDDDGAATIAQGGDGGAGIDGGTGG
NGSFAQVTAGQDGTAYGQSTAGSGGVGTGVDGKGGNGGSANIEGAAVADG
LGGPGGTAHGTATGGNGGNGGDANGGGTGGNGGKGSVLAGGVGAEASGAG
HGGNGGNGYDGGKGGNGFTGQVAALNEGAKADGIATAGTGGDGTGGGVTG
GQGANTLIQALGKDSVISGSSATGGDGGAGQDGVNGRVTSDTVIQARGDG
DSITNSHVTGGDSAGTKQGPGARITTDGGHVADSSVTAGQSTDTTLGGSG
SLTVTGGGSVTGADLTGGNAGTGTGVGGAANMTVTGGEVTDTTVDGGHGG
INGAGGAATVTVGADSSVAHSSATGGVGGDSAAGGAASLTATDGSHVENA
HATGGNAGGGDANGGSGGTGGSAAISATDGGIVDDATAQGGVGGDGADGG
AGGAGGAAMIIADGAGTGGAPVATTYSTVAGSSATGGAGGNGEAGGTGGV
GGTGYIDATVGGAVVDSDAIGGAGGDGTDGGAGGDAGGGFLRAAGYNTSV
EGSEATGGDGGKGIDQGEGGAGMWGQVIAGIDDNNSSLPNNTVVDSTATG
GSGGDGTGLGSTGGDGGGSIVQGGNGLKVDRGTTVGGNGGDGTDGGTGGV
GGIGQILTLSGGHVEIGLAEGGDGGLGTAGATGGNGGLAQVVSWSPGAYA
TGEGFGGDGGAGLGGNGGNGGIGSVMGWTGAGPNNSADGIATGGNGGDGG
VNGTNGAVGGNGGDGGRGNVQVTTAADKHVAADGTGGHGGNGGDGGDGVD
GGHGGAGGIGHAKGTTDGFGGAGGAGGNGGSLGASADGGHGGAGGAGGVG
SAGTGGAGGAGGHGGDGGTGGAGGAGGDGIGGVGATGIGGKGGAGGEGGT
FVNGTLDGHGGQGGAGASGSFSSANGGVATGTATGGNGGAGGAGGIDGNS
GGAGGAGGAGTISADGTDSSASGAATGGNGGNGGTEGGTGGAGGVGEVSA
KAGGSAEGTGDGATGGNGGDGIGGGKGGTGGIGSVNANGGSATGTATGGE
GGKATGANSAGGAGGEAWVQSNYNQLGGGTASGTGIGGAGGDATNGGDGG
KGGIGIVLANSGAKADGTGVGGDGGDATAAGATGGAGGMGQVVAGGDATS
TASGTATGGNGGAGHGGDGGDGERAYVQGVRGSVSGTATAGNGGDGSVEG
GNGGDGGYAKVEAINGNATATTSSAAGGNGGAGGADATNGGNGGYGWLKA
ENGGSVTGSDAIGTNAIGGADGGNASIIVDGTDSSVTDSAAHAGAAGVGD
ANGGTGGDGGDAQIAAAYGGAVMDGTATGGTGGSGADGGSGGHGGLGIVH
AAGANTSLSGSVATGGNGGNGSDQGVGGGGGLGAVTAGVDDNNVQLPNNT
VSNSEATGGHGGDGTGLDSTGGTGGDAVIQGGNGLLVTESEVVGGHGGAG
TDGGAGGNGGVAQIIALSKGTVDEGIATGGAGGAGSVAGATGGNGGLAQV
VSWNSGTATGFGIGGDGGAGLGGNGGNGGIGSVQGTSAAGVGNSVNGTAT
GGNGGDGGENGTDGAVGGSGGDGGRGNVQATSKADAQVHADGTGGDGGDG
GSGGAGADGGTGGNGGIGNATGADDGVGGTGGQGGAGGADGPSGDGHGGT
GGNGGTGTGATGGDGQDGGDGQADGTPGDDGGHGANNP
333992729YP_004525343.1 hypothetical protein JDM601_4089 [Mycobacterium sp. JDM601]MALRVSVDTTFLIDLQRERAAGKHNGSAHRFLSQSPDTELFLSTVVLGEF
AAGFDRTDDPIVVSMRERHTLVPVDAEIALTYARVTRELCRRGELIGSND
LWIGCTSLQLGIPVLTANPADFRRIDGLGVISYR
333992727YP_004525341.1 hypothetical protein JDM601_4087 [Mycobacterium sp. JDM601]MAETTQPSHLHLSTQVWRFLVTGALSAVVDFGLYLLLYLGAGLGVDAAKA
ISFVAGTVTAYLINRRWTFQSSAHTGRFVAVMVLYALTFGVQVGLNHLVL
RLLDYQHWALPVAFVIAQGTATVINFIVQRTVIFRVR
333992725YP_004525339.1 hypothetical protein JDM601_4085 [Mycobacterium sp. JDM601]MRRGDIWQVDFDPTRGSEANKYRPAVVVSNDRANATAGRLGRGVVTVVPV
TSNTATVYPFQVLLPATSTGLAVDSKAQAEQIRSVAVERLQRRIGRLPAI
ELTQLDEALRLHLDL
333992723YP_004525337.1 O-antigen/lipopolysaccharide transport integral membrane protein ABMSFTDIAAQSKTFARARADLADGFRRHELWLHLGWQDIKQRYRRSVLGPF
WITIGTATTAVAMGGLYSKLFHLDLAVHLPYVTLGLIVWNLLNAAILEGA
DVFVANEGLIKQLPTPLSVHVYRLVWRQMILFAHNIVIYIPIALIFPKPW
SWADLSVIPALAVIALNCVWVSLCFGILATRYRDISPLLFSVVQLLFLMT
PIIWNYDTLRAQGASRWMTVIEFNPLMHYLEIVRAPLLGAAQPLRHWAIV
LVLTALGWAVAALVLRQFRARVAYWV
333992721YP_004525335.1 O-antigen/lipopolysaccharide transport ATP- binding protein ABC traMSATDPYIETRDAWVEFPIFDAKSRSLKKAFLGKAGGAIGRNNSNVVVVE
ALRDITMSLSLGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGSATVVGRVA
PVFDLGVGMDPEISGYENIIIRGLFLGQTRKQMAAKVDEIAEFTELGDYL
AMPLRTYSTGMRVRLAMGVVTSIDPEILLLDEGIGAVDAEFLKKAQTRLQ
KLVERSGILVFASHSNEFLARLCKTAMWIDHGTVKMTGGIEEVVGAYEGP
DAARHVREVLAETRDQA
333992719YP_004525333.1 transmembrane protein [Mycobacterium sp. JDM601]MVAALLLLVAPGALIAAGSRLTWPLAVTVGPALTYGVVGLAIVPFGALGI
PWNAGTALAALVVVGALVAGLARGVRGLLDRRPGIHVAAPGTAVGPMLTV
AAGVLLGMLLIGWAAVRGLPDWQSIPSTWDAVWHANTVRFILDTGQASPT
HMGELRNVETHAPLYYPSAFHALTAVLCQLTGAAPTTGYTLAGLAASVWL
FPISAALLTWNLLQRVLSTRRLALSAATAGALSASFTALPYVEFGTAAMP
NLVAYGLVVPAFALVTGVRTHRDRIGVAVLALVGVFSVHLTGGVVTVLLL
AAWWLGPFDGALWNPLRGKRRDTLALAAVLVPTGLLLLPQLLSVREQADI
IAGHSFLTHEGRKSGLRDALLLHTRHLNDFPVQYTLVGLTAVGAGLLLYK
KVWWPLALWAVLVVGVVQSSAPLGGPAGAVIGRFTDLFYSDPRRIMAAMT
LLLIPMAGAGLAWLVAFLAEQTPKPPKWPRFGGFGVCSAVVVATVGLAWH
YLPRHAFLFGDKYDSVMVDSRDLAAFAHLAELPGAHDSLIGNANVDGSAW
MYAVAGLHPLWTHYDYPQQQGPGPHRFVFWAYADDADTDPRVAAAVRALN
IRYVLISSPTVRGFSLPDGLVSLEKSRSWAKIYDNGGASIYEWQGGVR
333992717YP_004525331.1 acyl-CoA ligase [Mycobacterium sp. JDM601]MALDTLVDLLQQQAARLQDTPAFIFCPEGDTEEARITYRELDSRARSIAV
DLQRQGAAGERVLVLCRPGVDSVAGLFGCFYAGAVAVPVDEHWPIRRIET
VVPEADARFALATAKTQAKMKAAVDGLSAGPKLSWLAMDEVEDDGPDWEL
QGIGADSLAMIQYTSGSTGIPKGCVLTHRNYVSNLEIMRWALNPPDDAPV
LNSPISGVSWLPQYHDMGFVGGILGTIYGGRTTVLMSPSAFLMRPIRWLQ
AISRFQATITAAPNFAYEACVKRSTPEQRAALDLSSLSIAVVGAGPISSE
TLRSFTETFAPAGFRAEAFIPAYGLAEATLGVTGMSDSPVPVVRHFDRTS
LGEDRVVEVPDDSGGSARLDEGEAKLGPPHDPAGALPLVACGAKAETQEV
LIVDPETRVRRGDDEVGEIWVAGPSVGVGYWGRPEETEYAFDAHLADTGE
GPYLRSGDLGFFRDGELYVTGRCKDLMTIGGYSHYPNDIELTVQDCHPAL
MPGRGAVFQLPTERYAPEYLVVVQEVHHHEAAGVDLDGLIESIRAAIRAH
HGVDAQAVVLLKPMRIPTTTSGKIQRGACRDQYVAGELVALAQWAEPRPE
NKAQGVKGALMAGLGRLVAANLGQRGGGSDQPGRS
333992715YP_004525329.1 hypothetical protein JDM601_4075 [Mycobacterium sp. JDM601]MQLALRPYVTPGVAIAGAALIAVNTAVPMAAMQSAPAPRQQLNNVVHHPV
QLTADFFGPYVDLFNNTAANLVAMGTDNGWGNLLEQIFSDPSSLSRLPEV
FDFLTSLMPQISGEDPLMILLSPILTIGMGIIGPLVTVNDAWQDILNQIF
NPSDPLDPFAAIFTAAPRLLDAFLNGTSTIGALGIDVPAFNGILVAGQNL
VIDMTAGDLVDELNIGDETIAGLLDQIGIGTMPVAGMLTGLLDSLGMGDQ
TPVDVLDSLGLADLEVAGVLTTLLDAVGIGNPTIAELMDQFGIGDVQVAD
LVIDLTHALGFENPTVVDIADSVGVADLKLADLGMTVFNALGIGDPTVNE
LLGDLGADDLTLNGLLHTAVDALGLGGTTTGGLLDAIGIGTQSTHEFFGS
LLDGLGLGNQTIMDLLSQAGLADADVAQLAVAVLGESGNVTIADVMGFAG
FGTVTVGDITDLMGITNMSVGDIVGNLEPITGVLTINDMLAATGMTPLDK
GGDALLTDSLASMTIASVLGDQLNDPLISMLGDMGTATLADMIQENFSMT
LGQMLADSGMGDQTLLELVLAGMPDQPLAELLGPMGATTLSDLINQLVPA
DQTIADMLDEAGIGNQHLSELLNQFLGDQTVANALDDGGLGSMHLDDIIS
QALGPQSLNEMLNEFGLGGQSLGDLFEQFLGTMTIGDALIDAGLGSQTLN
ELIDSMFGDSTVSSLLGDFGTQTVDELLASMGLGDLTLINAQIGEFFGSM
SYWLDGLGDQIAEILGA
333992713YP_004525327.1 hypothetical protein JDM601_4073 [Mycobacterium sp. JDM601]MVWLVAMVALVAMVVPAVRVRGSSVRVALVAMVVPAAMVVPVVMVAMVWM
PPRPVLMVVMLVMVAMVVLLVRPVRRVLGARVA
333992711YP_004525325.1 hypothetical protein JDM601_4071 [Mycobacterium sp. JDM601]MPRQRVDLPDEILAVPPPPLPILAEPYSIRFADQPGDAAMISEWMNRPHL
AATWDYAYPADQWQRHLDTQFSGGYSRPYVYNVHGEPLGYMELFRVAQDD
LATVYNALPYDVGLHGAMADPDMVEKGHGKNIFGPLVSSIFEAEPQCRRI
IGDAHAAGSHGRRFWERRGGVFLGEHYIAKWDQRIALFAWPRTPEDIPTA
RS
333992709YP_004525323.1 XRE family transcriptional regulator [Mycobacterium sp. JDM601]MLARNPAVAKHTEDVLAELGHELRSRRLALGVSAVTTSDAVGISRVTLHR
IEAGAPAVTIGAYLNVAAALGLRLRLDESHGPGRQPVQQAGPAHVTAQTT
VRVGDFAQLRAIAWQLRPETELTGIEALQLYERNWRHVDQAAMSDEERVF
VQQLADTHSAGILLV
333992707YP_004525321.1 hypothetical protein JDM601_4067 [Mycobacterium sp. JDM601]MLRFDAAMNQLLNDEHQLSVIGHRVLNGGGDGRIQLTYQDPDIQGDRGAP
ATPGATGGVSRRAAGW
333992705YP_004525319.1 prevent-host-death family protein [Mycobacterium sp. JDM601]MSTETVNIYDAKTRLSRLLAQVEGGAEIVISRHGRPIARLVPYRPDRPVR
RPGLWKDRVAIPADFDQFSDADDRDWYGA
333992703YP_004525317.1 excinuclease ABC subunit C [Mycobacterium sp. JDM601]MPQPAPEPNLTLGHVLSALGGEHDPPIGLAHIRVIRHSYNPQSHDGLRGP
DDLTDAVRVREYTRSQDISTRNFPRDPERYWVLFAADGQKRSRLWGTFEN
HGEVVDERTETGRFFDLRSHGFLTPLKDRLVVEWDVPLRWNRQAANIGRL
PVLEIADRDKVPFPGYDKVRLRFPELVDVVSDVGRYGDWHAALREVAGIY
LIADASNGKLYVGKADGAERILQRWTAYAGDGHGGNRALRELAAASIGAG
GAKTEHARNFVFSLLRVFGPGTPVSEINEAEAHYKAALVTRFGLNRN
333992701YP_004525315.1 hydrogen peroxide-inducible genes activator OxyR [Mycobacterium sp.MELRHLKYLLAVADHQNFTRAAEALHVSQPTLSQQIKQLEHSLGVELFDR
SGRTVRLTDAGAAYVHHARLAMRDLQAGERAVHDVRDLSRGHLRIAVTPT
FTAYLVGVLVHNFRVAHPGIRVTVLETNQDQIEADLLADRLDLGIGFDGQ
HAAGIEARTLFTETLCLVVGTDHPLGTATAAVPISALADEPLGLLSSDFA
TRKHIDEYFAECQVQQHIAIESNSISALLELVRRNVVATVLPDAIARERT
DLHPVPLQPPLPARTVQLLQRAGVYRSAAARAFTETLDTVVAARQESTGR
YWSNQ
333992699YP_004525313.1 lipase [Mycobacterium sp. JDM601]MTTPDGRIRMPADLEAVTVIGDEDHSGIDRAAVERIWQAARHWYAAGMHP
AIQLCLRHNGRVVLNRAIGHAWGNAPTDAADADKVPVGIDTPFCAYSAAK
AITSTVVHMLVERGGFSLDDRVADYLPGYGRHGKGRTTIRQVLTHSAGVP
FATGPRPDVHRVDDSEYTREQLAGLRAIYPPGWAHMYHALTWGPLMREIV
SAATGRHIRDILAEEILDPLGFRWTNFGVTQEDVPLVAPSHATGRPLPGP
VAAVFRRAIGGTMHEIIPFTNTPLYLTSVIPSSNTISTAFELSRFAEIWR
RGGELDGVRVVSPATMAAATAQCRRLRPDVATGLVPLRWGTGYMLGSERF
GPFGRGAPSAFGHLGLVNVAIWADPARGLAAGLISSGKPGRDPEAKRYGA
LMDRIAAEIPQT
333992697YP_004525311.1 multidrug-transport integral membrane protein Mmr [Mycobacterium spMAWLLLFGAIGFEVAGTLSLRASEGFSRLGWAVPVAVGYLLSFALLAMVL
KRGIPVGVAYGVWSGVGVAATAVLARFLFDDPFTAVMAGGVVLIGAGVFL
LEYGAHA
333992695YP_004525309.1 hypothetical protein JDM601_4055 [Mycobacterium sp. JDM601]MLVQVLHHISSDELSNQTPCSEFDVAQLTEHLLGSISMLGAAAGAEFPDR
DATESPERQVIAAARPALDAWHGRGLDGTVAIGPNQLPATMVAGILAVEF
LVHAWDYATAIGRTVQVAEPLAEYVLGLAQAIITPEGRVRAGFDQPVEVA
GTAPALQRLIAFTGRS
333992693YP_004525307.1 hypothetical protein JDM601_4053 [Mycobacterium sp. JDM601]MGTKDIASADDAHAWFVDVKADNTELGWRMEVDLDGQWRFFDSTEGDRP
333992691YP_004525305.1 hypothetical protein JDM601_4051 [Mycobacterium sp. JDM601]MHATATATVAAPASRVWEVLSDYEGMSSWAPGLKITVVRPGAPEPNGVGA
QRRIQAVPGMAPLVEEITVFDPDHRLSYRGVSGIPFRNYVGDVVLAPAGS
GTQVSYTVSADNRLPGVASVLANVLLFGLKRAVKKAG
333992689YP_004525303.1 hypothetical protein JDM601_4049 [Mycobacterium sp. JDM601]MTSVFIAATLAVILYSLWVRRDTWWSRWEAAATFAIATEGCALVLLSPWA
GTELGPRLYHWLGLWNVQHLLGSLVLIVAVIANIYHMMVRLADPDQVRPL
MRKHLQLPLGLGVAVLLVTFVKLERGHEPDMFANLTGNGWWLTAYEVAAC
WIVLYLSGYVGRLMLALRHDPRARTTVNLYLASMSFTVLACLVAIVSIWA
GGYAGPAIWGCICLSVMIFAYGLARSWRAKTAWFSPGASAAG
333992687YP_004525301.1 hypothetical protein JDM601_4047 [Mycobacterium sp. JDM601]MTSAFIGATVLVALYSLWVRRETWWSRWEIGITLAIALEVCALVLMSPWA
SAVLGPTMHSVTRIWNVQQLVGHICFIVAIAANIYHVLPRLADFGRVRPL
FRRHVQWPVRLGLVALVAVFITADADYRPDGLSTGNDTGAWAEIYWLLFC
GMLIYLSGYATRLLLLVRSDPRARETVELYTASAAFALAGLVAQLSTTWT
NADASQLVWPCACISVVIFAYGSARSWQAKAAWFAARTRPVKEPNPPPAL
S
333992685YP_004525299.1 N-acyl-L-amino acid amidohydrolase [Mycobacterium sp. JDM601]MTGHLDEIDRIVAADTFRLVDIFKDLHRNPELGFEEVRTARIVAQALGNL
GFTVTTGIGRTGVVAVLANGPGPVVMYRADMDALRVPEATGLDYASSDPS
LGHMCGHDAHVTWMLGMAKVLAETTASWSGTAVLIGQPAEELIAGARAMV
DDGLYDVAPPPDSFIAMHTVPVPVGMVAAAGGERMAGTDQLEIVFHGVGG
HGSLPQLAKDPVLMAAQAVVQFQGIISRSIAPSEGAVLTVGSVQAGTTYN
VIPDQARLLANLRWYNPEVREQLLAGIRAISEGIAHSFGLPDALMPVITM
GGGSTPLVNDADLTGRLAATLRDALGEHNVITELPEVSASEDCHLLKGPH
RDVPLAYLMVGVADPQVYAEAAARGQLFPYTPHSPDYVVDLAAIPLGARI
ASRAMLELLATS
333992683YP_004525297.1 hypothetical protein JDM601_4043 [Mycobacterium sp. JDM601]MARTPQEIFDHHLHALIARDVDDLLVDYTDDSVLITAAGVATGLDGIRAA
FSQLSDALAAAVFDIKSKTYHDEILLLEWTLDSPGFQVDGVDTFVFGEDS
IRVQTISQLVRPKG
333992681YP_004525295.1 two-component sensor kinase TcrY [Mycobacterium sp. JDM601]MSSSRPSESLRAGTRRSWSLRARLLAGQVALLTVACLGIGAVTELALYQY
LVSQLDHQLSDAARRSARLHGQPPAPPGHRPRHRPRPGPGPDFLDAPGQP
VGMVGAVVDSVDGEDRIADAGCLSTSGLREELSASATTQLAGIVAEPAPV
TRRLDGVGRYRLVATNARHGGETIIIGLPLAAVNATMVRVLLIFGLVTLV
AVAAAATAGSVVTRRALAPLRRVAQTAGEVADLPLDRGEATLPVRVAESD
TNPRTEVGQLGAAVNRMLDHIAAALANRQASETRVRQFVADASHELRTPL
TAIRGYTELAQRIPVADGVDSESLAHALSRVQSETQRMTQLVEDLLLLAR
LDSGRPLEHEPVDLSRLAVDAVSDAHVGGPDHQWELDLPDEPVTVPGDAA
RLHQVLTNLLTNARVHTGAGTVVTTRLGVDGAEAVLCVTDDGPGIPAEFQ
PEIFERFARGDTSRSRKGGSTGLGLAIASAVVRAHRGTIAVTSRPGHTEF
TVRLPL
333992679YP_004525293.1 hypothetical protein JDM601_4039 [Mycobacterium sp. JDM601]MRAEEGDESIQDYAQEAQETQDRVAPRSWWGRLLDALNPFKRRL
333992677YP_004525291.1 hypothetical protein JDM601_4037 [Mycobacterium sp. JDM601]MSSDHTVPVDPSQGEPGAPPPPAAMPFTRAGALWSALIAGFLVLIVLLVF
VTQNTDPVDLRFLAWQWSLPLGVAILLAAVCGGLVTALAGTARIFQLRRA
AKKTLAARR
333992675YP_004525289.1 prephenate dehydrogenase TyrA [Mycobacterium sp. JDM601]MCVLGLGLIGGSVLRAAAAAGREAFGYNRSADGMNAAIADGFDATTELET
ALTRAAESGALIVLAVPVPALPALLDHIRRLAPDCPLTDVTSVKASVLDA
VTAAGLADRFVGGHPMAGTAHSGWPAGHAGLFEGAPWVISVDDHVDPAVF
STVLDLILDCGSIAVPARSEEHDAAAAAISHLPHLLAEALAVTAADVPLA
FALAAGSFRDGTRVAGTAPELVRAMCEANWLHLLPALDRVIELLGDARDS
LSAADSVAELVNHGHAARTRYDNFPRHEIVTVVVGANDWRRELAAAGRAG
GMIRSALPTLDSR
333992673YP_004525287.1 cytidine/deoxycytidylate deaminase [Mycobacterium sp. JDM601]MTGPAADEDLIRAALAAAGQAGPRDVPVGAVVVGPDGIVLARAANAREAL
GDPTAHAELLAIREAAAVLGDGWRLTGATLAVTLEPCTMCAGALVAARVA
RLVFGAFEPKTGAVGSLWDVVRDRRLNHRPEVRGGVLAAECAAPLEAFFA
RQRLG
333992671YP_004525285.1 lipoprotein peptidase [Mycobacterium sp. JDM601]MMLALTGCADTTPTVVTGRAVSMLYNPGRVGGLPTAEGPSGPRGDVPPVT
ARVGNSDGGEIDRLSLFAIDDIEEFWTQHYADSLRGRFEPVSTLMSYAST
DPNSPQVCGGDVYHLPNAMYCRRADTMAWDRAKFMPAARKYFGDMAINGT
LAHEYGHALQAMAHIVNPLTRTLVREQQADCFAGVYLQWVAAGKSSRATL
STGDGLNHVLAGLIVIRDPVSTLDNPVSISDEHGTALDRVGAFQTGFDGG
AEMCAAIDMDEIRKRRGNLPHALFDSENPQSDLTIDEHVLSTLMEQLGQI
FALSRPPALATTGKCPSGHEPDPVAYCPESNTVVVDLAGLQEMSAPTDQS
TLSLPQGDNTGLSAVTSRYALAVQREREVGLESAAAALRTACLTGVAQRR
MAEPMRLPSGPGLTLAGGDLDEAITGLLMNGVVASDADDNTVPAGFTRIL
AFRSGLHGDVDGCFERFR
333992669YP_004525283.1 hypothetical protein JDM601_4029 [Mycobacterium sp. JDM601]MQLMSPTDSVFLLAESREHPMHVGGLMLFEPPEGAGPEFVGEIYQGLLGA
RDLQPAFRKRPATLLGGIANVGWAFDDEVDIEYHVRRSALPVPGRVRDLL
ELTSLLHGSLLDRHRPLWEAHLVEGLNDGRFAVYVKIHHSLIDGVSLLRL
LRRTLSADPREAELRTPWSMRPPSRPRPDAPSRLRELTGMVKGVAALGPS
TVNLVRAALFEQQLTLPFEAPRTMFNVKIGGARRCAAQSWPVERVVAIKR
AAGVTVNDVVLAMCAGALRAYLDERQALPEHPLVAMVPVSLRTEADVDSG
GNMVGTILCNLATDLADPAERLATISESMRRNKKVFSELPRTQALALSAA
NMAPLALAAIPGFVSTAPPPFNIVISNVPGPAEPMYWRGARLDGNYPLSI
ALDGQALNMTVVSNAGNLDFGLVGCRRSVPHLQRLLGHLDASLEDLERAV
GV
333992667YP_004525281.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MPTLVELLRLQAERHADKVAFSFAPDGKQITARLTYRELDVHARAIATTL
QHEGAAGERALVICRPGLDSIVSIFGCLYAGAVPVPVDTPLPRLKLVAPD
TQAAFAVATAGTRNQLQAVAADVPGLSTLRWCAIDEYTADPEDWETPDVD
SSTTALIQYTSGSTRSPKGVVVTHGNLMDNLEAIRRAYHGDEHETSVYFL
PQQHDMGLIGGVLEMIYVGCSTVLMSPIVFFQRPMAWLEAMSRFRANTTA
APNSAYRLCVKSSTPAQRAALDLSHWTTAASSSEPIHASTIQEFADAFAP
AGFRLEAFLPCYGLAEATLLVAAGPGHGVAGVRYVDAAALSENRAVDVTP
DTAAVPVVSCGPPVYGQQVLIVDPETRLQRGPDEVGEIWVSGPSVAQGYW
GRPEENAHTFAGFLADTGEGPFLRTGDLGFLCKGEVFVTGRWNDLITIRD
GNYYPNNIEPTVHACHPALLADRGAVLAVQGTQGADNRLVVLQEVDHQQQ
VAADELPGIIDAIRTAVSTQHGLEAHDVLLVPAMRLPTTSSGKIRRAECR
RQFLDGELEALAEWHAPAPPADRTPNAGGAGGLARLISNSLAQRQKQQQQ
RGIPPRAGG
333992665YP_004525279.1 hypothetical protein JDM601_4025 [Mycobacterium sp. JDM601]MSVAMSTAVTGADFDTVAAKTRELLKDNGFGVLTEIDMQATLKAKLGEDM
ERYLILGACNPPLAHRAVTAEKRIGVLLPCNVVVREDPQQPETVLVEAMN
PQLMAQVVDNPALAPIADEVTEKIRAVIDTLAGALRTA
333992663YP_004525277.1 ATP-dependent DNA ligase LigC [Mycobacterium sp. JDM601]MVLIDMMDTMDLPVAPPVDPMLAKAAVKVPADAGRWSYEPKWDGFRAIVF
RDGDEVLLQSRNGKPLGRYFPELLEALRAEVGPRCVLDGEVVVPRQIDGR
TRLDWESLSQRIHPADSRVRLLAEQTPAQFIGFDALATGSVSLLDEPFRV
RRQALADSIHAGPSCHVTRATDDPEQATVWLTSFEGAGLDGVVAKRTDGP
YLPGKREMVKVKHRRDADCVVMGYRIHKSGNGIGSLLLGLYRPDGELAMV
GGAASFTDADRLALLAELEPLRIGDVREGEPSRWNSAADKQWVPIRPERV
AEVAYDQMEGDRFRHTVKLLRWRPDRDPASCTFDQLDVPLTYDLVDVLET
333992661YP_004525275.1 peptidase M48 like-protein [Mycobacterium sp. JDM601]MNAVTLLLGYAVVLSCFAPAMLTRPDMARIPPRLAVAGWLVAVATTLAAW
VSALAVMIVGAAHSVITHTAMTFCVKTLGITPVAMLPPSVATALVVALLL
VTMSVALHTVRRVVSSLLGHRRQNLRHAEAVRIVGYPTEHDGVVAMSADQ
ATAYCVSGGRRQTVVVTTAALELLSSAGLAAVLAHERAHLRGRHHRIIAS
LNALSAALPRLPLLRSAAQSVPVLLEMCADDAAAREHGNEPLLTSLLTLS
TGHRTPDGALAAAGTAVVDRMTRLMNPDRGSWWQPRSLAMVGVIAATAAV
PGLALGLCTL
333992659YP_004525273.1 regulatory protein [Mycobacterium sp. JDM601]MEAARSVALEAGVASVTLTAVAARAGVHYSAVRRYFSSYKEVLLRLAAES
WQRWSAAVCTGLDQPGPMSPEQVVEILVSGLAADPLFCDLLSNLHLHLEH
EVDAERVIEVRRVSTAAVMAGAGAIERALPGLGPRGALDLLLAAYSLGSV
LWQRAHPPETLTNAYSDEPELLPDWNLDFTTALTRLLTATCVGLLEQV
333992657YP_004525271.1 transporter [Mycobacterium sp. JDM601]MPIILGWLALIVLLGATVPSLEQIGKENAVSASPTTAPSMQAMTEMGRVF
QESDSDSTAMIVLEADHELGDAEHEYYAEMVERLKADTAHVQHVQDFWGD
PLTAVGAQSADGRATYVQLNLVGNIGQAKANESVESVRNIVDSIEKPPGL
TVYVTGTAALANDMNHAGDKSMLRMMAVTIAVILTMLLAVYRSVTTVVLL
LATVGMELSAARGVVAFLGHHHLVGLTTFSVNLLVSLAIAAGTDYAIFLI
GRYHEARHDGEDPETAYYTAFNGVAHVILGSGLTIAGAVFCLHFTHMPYF
VSLGIPCAVGMVVSVFAALTLGPAIITVGSRFGLFEPKRKMSTRGWRQLA
TAIVRWPGPILVASLAIAAVGLLALPGYQPAYDDRKYIPSDIPANEGFNA
ADRHFSQSRMMPEVLMIEADHDLRNPSDFLVIDKLAKAVFKVVGISRVQA
ITRPQGTPLEHTSIPFQMSMQNAGQMQTMQFQKKRMDDMLTQADAMGETI
ATMREMLGYMSQLANTTHEMVVDMDELQAQIYDIRDHIADFEDFWRPIRN
YFYWEPHCYDIPICFSLRSAFDMVDSVDPMSESMDKMIAHMADMDALMPQ
MLTTFPPMIDTMQTMQTMMLTMHSTMSGIFAQMEEMGDNATAMGKAFDEA
KNDDSFYLPPEVFENPDFKRAMNMFVSPDGKAVRMIISHRGNPATAEGIA
RIDQIRTAAEEALKGTPLEDAKIYLGGTAALFKDMHDGSYYDLLIAGIAS
LCLIFVIMLLITRALIAALVIVGTVALSLGASFGLSVLVWQYLIGMQLHW
LVMVMSVIVLLAVGSDYNLMLVSRFKEEIHAGLHTGIIRAMGGTGKVVTA
AGLVFAFTMASMAVSDLRIIGQIGTTIGLGLLFDTLIVRAFMTPSIAALL
GRWFWWPINVLPHVGGKAARHREAAAAARGADADAADALADRP
333992655YP_004525269.1 hypothetical protein JDM601_4015 [Mycobacterium sp. JDM601]MTGFVRQIPQALAVAGMAAGLLATAGAPAQAQPAGFPDLDTFSPAPVDDY
ITTGPKGPGRWVNFSTPYNIACQFDATEPPAGSSQAIMCDGDMPGMANAP
LSSGAPVADGCVIGTVRSQGAAGLRLNRESASCGRQFSHGAFLGVGQKLS
YGNVTCAVGSDQLVACLDTSLGHHGFVLRPSGSTAF
333992653YP_004525267.1 hypothetical protein JDM601_4013 [Mycobacterium sp. JDM601]MSRTAATVWHASLSTLAAILYFLFVLPRWWELTGFSPHVLGTVVRIFLGL
LVAGTALPVVATLRHARKPEYGTPQLTLTLLTGSIVGHVVAGTLIAGTAI
SEIWLSLDTAGVWLFGIYGAAAAIALLGIGAFYLSFVAAMPPPPPKPIKP
KSEKQSTLRRWRAKKAKKPDAGAADGVEDDDTDEDADEDHDGHDADEDAE
SGEALETVEADSATEVTESAGEEAPELASTGAQEKLRPSGKRRAKKGK
333992651YP_004525265.1 hypothetical protein JDM601_4011 [Mycobacterium sp. JDM601]MANKIGVVGCAVAAMAAFGLGQVPAAYAPSRADPVVDHSPVHAGDAGPGP
AEALPAKVNDALDVFRGAAADAALGHPVMYGDGQCYPLILQYIRALGYPW
RNRDPSGNAFDLYEHFPTNGLGEFFDQVPTSRLDGGTNLPQVGDIVVYGP
GGYVSEHGHAAVVTAVRGNGPLFGYETADQNSGGRLFVTLNWRDLSPMWN
TLGYLRPRV
333992649YP_004525263.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium sp. JDMLKTQAKDTQTTTNGKLGLAEILVLLSGGGQPPVKVTAYDGSSVGPDDAA
LAVDLLNPRATTYLATSLGQLGIARSYIAGDLELRGVHPGNPYEMLKALA
DLEFKQPSPQTLVNIVRSIGLKHLKPIAPPSEEAPAKWRRTAAGLRHSKA
RDAAAIHHHYDVSNTFYEWVLGPSMTYTCAIYPNAEATLEQAQENKYRLI
FDKLRLQPGDRLLDVGCGWGGMVRYAARRGVRAVGATLSAEQVDWAQRAI
ADEGLSDLAEVRHCDYRDVAETGFDAVSSIGLTEHIGVKNYPSYFGFLKS
KLRTGGLLLNHCITTSDNSVYKGDAFTDRYVFPDGELTGVGSIIAEIQQT
GFEILHEEDFRLHYAKTLRGWCQNLVDHWDEAVAAVGLGRAKVWGLYMAA
SVLGFERNQCQLHHVLASNVDEEGRDDLPLRPWWTP
333992647YP_004525261.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium sp. JDMTTYKEQTHTGRLTLAEVLETLATDGHLPLRFTAYDGSSSGPDDAPLGLE
LLTPRGTTYLATAPGDLGMARAYVAGDLAAHGVHPGDPYRLLKALADELH
FKRPSPRVLANIVRSIGFEHLVPIAPPPQEARPRWLRVADGLRHSKHRDA
SAIQHHYDVSNAFYEAVLGPSMTYTCAVYPSPDATLEEAQENKYRLIFDK
LRLRRGDLLLDVGCGWGGMVRYAARHGVCAIGATLSAEQARWAQRAIADD
GLTELAEVRHCDYRDVRETEFDAVSSIGMTEHIGVANYPAYFGFLKSKLR
RGGLLLNHCITRADNKSSATAGDFIDRYVFPDGELAGSGRIISEIQDAGL
EVVHAENIRHHYELTLRDWCANLVAHWDEAVAEVGLATAKVWGLYMAGSR
LGFEHNAIQLHHVLAAKLDDRGGDDGLPLRQWWQP
333992645YP_004525259.1 N-acetylmuramoyl-L-alanine amidase [Mycobacterium sp. JDM601]MRVPVLSRVGIAIVTGLVAAAAVPSAPSAWAAPGNIAGMIVFLDPGHSGT
ADPAAIGRQVTNGRGGTKNCQTSGTTTNSGYPEHSFAWDTTLRIRQALNS
AGVRTAMSRGDDNGPGPCVDQRAAMANSLHPNAIVSIHADGGPATGRGFH
VNYSAPPLNPAQEGPAVRLAQAMRSQLQAAGIPPANYIGTDGLKGRADLA
GLNLAEYPSILVELGNMKNPADAALMESPGGRQRYADAVARGIAGYLSTQ
NMPQQSQ
333992643YP_004525257.1 recombination protein RecR [Mycobacterium sp. JDM601]MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSEIDRLTAVLTKVR
EGVRFCEVCGNVSDAQRCRICGDSRRDFAQICVVEEPKDVAAIERTREFR
GRYHVLGGALDPLSGIGPEQLRVRELLNRVGERVDGVDVSEVIIATDPNT
EGEATATYLVRMLRDIPGLSVTRLASGLPMGGDLEFADELTLGRAFTGRR
AMA
333992641YP_004525255.1 ferredoxin reductase [Mycobacterium sp. JDM601]MSANGVLIIGGGLAAVRTAEQLRRNDYAEPITVVGAETHLPYDRPPLSKQ
LLRGEVDDVALKPASFYEQHRIGLRLGCAARTVDVAAHTVTLADGDVLGY
DQLVIATGLVPNRIAVGDLDGVFVLRSLDDALALRRRATSARRAVVIGAG
FIGCEVSASLRGAGVQVVLVEPQPTPLAAVLGEQVGALITRLHRDEGVDV
RTGVKVDSVSGSEGVEAVTLSDGSVIPADLVVVGVGSRPACDWLTGSEIA
VADGIVCDEAGRTSAPDVWAIGDVACWDGNRVEHWSNVAEQAKTMVSAML
GSAVPRAGVPYFWSDQYDVKIQCLGHPRTGDTVHLAEDDGRRFVAYYERD
GVLVGVVGAGVPEKIRTARGKIAAGTSITEVLQPA
333992639YP_004525253.1 rubredoxin [Mycobacterium sp. JDM601]MAGYGCPGCGYVYDEGVGAPREGFPAGTAWAQIPDDWTCPDCAVREKLDF
EPMGVNS
333992637YP_004525251.1 hypothetical protein JDM601_3997 [Mycobacterium sp. JDM601]MTDPSTVAEAAIGISQRLYDHLTETTQVIENLIAKESPDLITDSSLLQLL
HETVAANVDTYFSAIRHNIPVAEIAAPAVALEHARRLAQRGVPMNALVRG
YRLGHSMALRVVLEEIRSAELDPDLRLDVLSEMSTLMFGYIDEMSQQVSA
VYQAERERWLESRNAVRALRVREILADEGLDVDAMTTAIRYPLRRTHVAL
IVWYPESAGDKLTAAEGFIKQLAESVAGQGAPLFIPADSTTGWAWIPLAS
SAGHDAVEQIRGCAQTASGEPWVAIGDPLPGVEGFRRSHQQALAVHTLAV
ASGVTRVSAAADPGLSAAALLGGDNVAAARAWVGEVLGPLARATDGDERL
RDTLRVFLRAGSSFKAAGEQLHFHVNTMKYRVQRAIERRGRPIAEDRLDV
EIALLLCQWYGAAVLSPLSPGDE
333992635YP_004525249.1 UDP-N-acetylmuramyl tripeptide synthase [Mycobacterium sp. JDM601]MITARGRLALAAGASARWASRITGRGAGAMIGGLVAMTLDRSILGQLGTG
RRSVVVTGTNGKSTTTRMIAAALRDLGPVATNAEGANMDAGLVAALAADR
TAELAALEVDEMHVPHVADAVSPTVVVLLNLSRDQLDRVGEINAVERALR
TGLARHPQTVVVANCDDVLMTSAAYDCPNVVWVAAGGGWAGDSVSCPRSG
EVIDRRDDHWSSTGCDFARPTPQWWFDDDSLYGPDGLVLPMRLALPGTVN
RGNAAQAVAAAVALGADPVKAVAAVSSVDEVAGRYKSVQVGQHTVRMLLA
KNPAGWQEALSMVDHRAAGVVIAVNGQVPDGEDLSWLWDVRFEHFEGVHV
VAAGERGTDLAVRLGYAGVQHTLVHDTLAAIASCPPGPVEVVANYTAFLQ
LQRRLDRG
333992633YP_004525247.1 2-isopropylmalate synthase [Mycobacterium sp. JDM601]MTSFSQASPDAFTSGRRITKPVGPPNPGQPGWNTQRGSAMPISRYRSFAD
EVENIVLPDRTWPDRVIERAPMWCAVDLRDGNQALIDPMSPARKRRMFDL
LVAMGYKEIEVGFPSASQTDYDFVREIIEAGAVPDDVTLQVLTQCRDELI
ERTFEACDGAPNVIVHFYNSTSILQRRVVFRADRAAVQEIAVAGARKCLE
EAAKYPGTRWRYEYSPESYTGTELEYAKAVCDAVGDVIQPSPDSPIIFNL
PATVEMATPNVYADSIEWMHRNLKRRDSVILSLHPHNDRGTAVAAAELGY
QAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNIDEIRRT
VEYCNQLGVPERHPYGGDLVYTAFSGSHQDAINKGLDQMKVDADAADSDV
DDMLWQVPYLPIDPRDVGRTYEAVIRVNSQSGKGGVAYVMKTDHGLVLPR
RLQIEFSKVIQQLTDGEGGEVTPKEMWDAFAEEYLNPIRPLERMHQRLIA
AETDDGTDRIEATVLVDGVETEIAGAGNGPLAAFVDALSDVGIHVNVLDY
SEHAMSAGEEAQAAAYVEASLGDHTVWGVGIASSITTASLRAVVSAVNRA
ARLG
333992631YP_004525245.1 aspartate kinase [Mycobacterium sp. JDM601]MALVVQKYGGSSVADADRVRSVAERIVETKNDGDDVVVVCSAMGDTTDDL
LDLAQQVSSAPPARELDMLLTAGERISNALVAMAVEELGCQARSFTGSQA
GVITTGVHGKAKIIDVTPGRLQAALGENQVVLVAGFQGVSQDTKDVTTLG
RGGSDTTAVALAAALNADVCEIYTDVDGIYSSDPRIVPNAKKLDTVTFEE
MLELAACGAKVLMLRCVEYARRYHLPIHVRSSYTDKPGTIVTGSIKDIPM
EDALLTGVAHDKSEAKVTVVGIPDLPGYAAKIFRAVADADINIDMVLQNV
SKLEDGKTDITFTCPRDNGPAAVAKLESLKTEIGFTEVLYDTNVGKVSLV
GAGMRSHPGVTATFCETLADNGINIDLISTSEIRISVLVAEDDLDKAVVA
LHQAFDLGGDEEATVYAGTGR
333992629YP_004525243.1 hypothetical protein JDM601_3989 [Mycobacterium sp. JDM601]MAVAALLTGPLVAHAEPPAPIPRPVLWPLAEGQVVRIGPSAGTGTLTGDY
GIGATDLCEFMEFPSAVLQICGDSFAGQGVGFGGWYSPIALRLDPDSVDD
SVGVRYTGVLGVDRPLLADPSPAGSTQLPAGIVSINRTNYLMVTTAKMLV
PQTSRLVKADPAQPGWQTVPGSVRAASYQDFGQSQISGYYDPVPTPDSVT
GWVYVVANNFDRSASVTLYRVTPDKFTDRSAWQGWAAGTGWGHKPTPLWN
DQIGELSLRQIDGKPVLSYFNGTTGNMEVRVAYDPTGLGTAPVTTVVQHA
EWPDPPVPVETLPSPFDNRLAQPYGGYISPGSTLDELRVFISQWNNSEPW
ARAPYRVIQFAVNPFKPWSAGIVHS
333992627YP_004525241.1 catalase KatE [Mycobacterium sp. JDM601]MAEHHTTTEAGAPAPSDTDSLTVGPDGPILLQDHYLLEQMAMFNRERTPE
RQPHAKGGGAFGHLEVTADVSAYTRAAVFAPGVKTEMLARFSTVAGERGS
PDTWRDVRGFALKFYTSEGNFDIVGNNTPVFFFRDPMKFQHFIRSQKRLV
ASNLRDHHMQWDFWTLSPESAHQVTYLMGDRGLPRSWRHMNGYGSHTYSW
SNAAGEIFWVKYHFISDQGVENLSQEDGERLAGSDADYHQRDLYDAIERG
DHPSWAVKVQIMPFEDAKTYRLNPFDLTKVWPHADYPLIDVGRFTLDRNV
ADYHNEIEQAAFEPSNTVPGTGLSPDKMLLARGFSYADAHRARIGTNYNQ
LPVNAPKTDVHTYSKDGKMRFRNASDPVYAPNSVGGPVAESARAAEVRWH
ADGDMVRAAYTLRDDDDDFGQAGTLVRHVFDEEQRKRLAANIIGHVSAGV
REPVLSRVFEYWHNVDEDLGRDVEAGVRANLA
333992625YP_004525239.1 hypothetical protein JDM601_3985 [Mycobacterium sp. JDM601]MRAAATFMVAGLGLAVTSTATAPAAVARPSEPGVVSYAVLPKGSVGNIVG
APMTWDAPSGQPFQAFWVDDPACNNWADIGLSEVYNDPDLASFNSAVTQT
AANDQTHFVKQAVGVFATEAAADRAFHRITDRTAGCSGRTTAMHLDNGAT
QVWAFDGGPAGATDAAWVKQEAGTDRRCFNQTRLRLNVLLQAKVCQSGNA
GPAVNVLAGAMQNSLGQ
333992623YP_004525237.1 hypothetical protein JDM601_3983 [Mycobacterium sp. JDM601]MTEGVTKALTKAETLAGELSRARERTLALVDFDEAELHRQYDPLMSPLVW
DLAHIGQQEELWLLRGGDPDRPGMLPADVEGLYDAFVHPRASRVDLPLLS
PEQARKYCATVRSKVFDELNALPGDFADGFVFGMVVSHEHQHNETMLQAL
NLRTGAPLLDAGRPLSAGRPGVAGTSVLVPAGEFVLGVDATAEPFALDNE
RPAHRVQVAAFRIGRVPVTNAEWRAFIDDGGYRQPRWWTERGWSHRMQAG
LTAPQFWSPDHTCRTRFGHLEDLPDNEPVQHVSYFEAQAYATWAGARLPT
EIEWEKACAWDPQAGARRRRPWGDGEATAQLANLGGAALRPAPVGAYPNG
ASAYGAEQLLGDVWEWTSSPLQPWPGFTPMIYQRYSEPFFGGDYRVLRGG
SWAVAPEILRPSFRNWDHPYRRQIFAGVRLAWDV
333992621YP_004525235.1 s-adenosyl-L-methionine-dependentmethyltransferase [Mycobacterium sMTGFDAAVSLSNHLAADAARTALRDDVRFGLQQDPKTLPPKWFYDDVGSE
LFDRITRLPEYYPTRAETEILREHSAEVAALSAVDTLVELGSGTSAKTRM
LLDALQNTGALRRFVPFDVDAGILETAGEAIARDYPGVQVHAVCGDFEHH
LAQIPDGGRRLFVFLGSTIGNLTAGPRADFLADLSAVMRDGDSLLLGTDL
VKDTARLVRAYDDAAGITAAFNRNVLAVVNRELGADFDLDAFAHVARWNS
GEQRIEMWLRSRHRQRVVIAALDLAVEFSAGEEMLTEVSCKFRPEQVAAE
LAAAGLRRRRWWTDAAGDFGLSLAFR
333992619YP_004525233.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium sp. JDMTTLKSERARSTKGRLGLAEILVLLAGGGQPPIKITAYDGSSVGPDDAAL
GVDLLNPRATTYLATSLGQLGIARSYIAGDLELRGVHPGNPYEVLNALAD
LEFKQPSPQALLNIIRSIGFRHFKPVAPPPEEAPAKWRRTAAGLRHSKAR
DADAIHHHYDVSNTFYEWVLGPSMTYTCAIYPNAEATLEQAQENKYRLIF
DKLRLQPGDRLLDVGCGWGGMVRYAARRGVRAVGATLSAEQVDWAQRAIA
DEGLSDLAEVRHCDYRDVAETGFDAVSSIGLTEHIGVKNYPSYFGFLKSK
LRTGGLLLNHCITLPDNSTFKGDAFTDRYVFPDGEITGAGRVITEIQQAG
FEVVHEEDFRHHYAKTLRCWSQNLVDHWDEAVAEVGLGRAKVWGLYMAAS
VLGFERNLFQLHHVLATKVGERGEDGGLPLRPWWQP
333992617YP_004525231.1 glycerol kinase GlpK [Mycobacterium sp. JDM601]MGDFVASIDQGTTSTRCIIFDHDGAEIGRHQLEHEQILPRAGWVEHDPFE
LWNHTAAVLVSALNTTKLQASDLAAMGIANQRETTVVWNKNTGQPYHNAI
VWQDTRTDYIAAALERDGHGELIRRKAGLPPATYFSGGKLQWILDNVDGV
RADAERGDALFGTCDTWVLWNLTGGPRGGVHLTDVTNASRTMLMNLETLD
WDDELLALFSIPREMLPRITPSSSRRRHAVTVSTGPVRGEVPIAGILGDQ
QSAMVGQVCLSAGEAKNTYGTGNFLLLNTGEQIVRSDNGLLTTVCYQFGD
AKPVYALEGSIAVTGSAVQWLRDQLGIISGATQVESLARQVTDNGGMYFV
PAFSGLFAPYWRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVAEAM
EADSGVHLGVLKVDGGITANDLCMQIQADVLGVDVVKPVVAETTALGAAY
AAGLGVGFWKSPDDLRANWQEHKRWTPTWSQDQRAEGYAGWRKAVQRTLD
WVELP
333992615YP_004525229.1 PadR family transcriptional regulator [Mycobacterium sp. JDM601]MNVPFGPPDGPFTHDPEQSGGFGFGAATPQQRRAAHAARRHARREFRRQL
RDHGAEPCGPFGLHPGHDPEGPGFGAGFGPEFRHGFGPGFGPGFGAGGPG
FGFGFGPPRGRGHRRGHRGRRGDVRLAILALLAEGPMHGYEIIQQIAERS
QQLWRPSPGSVYPTLQMLVDEGLISGSETDGKKRLFELTEDGRAVAEEIE
TPPWEEIADGADPGQLRLRTAVGQLFGAVGQASQAATPEQQQRIVDIVNS
ARKEIYGILGEAD
333992613YP_004525227.1 transmembrane protein [Mycobacterium sp. JDM601]MDVDAFVLTHRPAWDRLEALVKKRRRLDGAELDELVELYQRVSTHLSVLR
SSSTDSALIGRLSGLVARSRAAVTGAHAPLASEFARFWTVSFPVVAYRAR
RWWLGTAAAFLAVAVVIACWVAGDPDVQALIGTPAELDQLINHDFASYYS
DHPAGAFALQVWVNNSWVAARAIAFSVLLGLPIPALLLANAANLGVALGL
MFGAGRGGFMLGLLAPHGLLELTAVFLAGAVGMRLGWMVIAPGDRPRGQV
LAEQGRAVVAVAVGLVAVLAVAGLLEAMVTPSPLPTWLRVGIGVLAEAAF
LAYVVYFGRKAVAADETGDIVDAPDVVPTG
333992611YP_004525225.1 methanol dehydrogenase transcriptional regulatory protein MoxR2 [MyMTQTPPPPPAREALLALRNEVAKVVVGQDAVVSGLVIALLCRGHVLLEGV
PGVAKTLLVRTLSAALRLDFKRVQFTPDLMPGDITGSLVYDTHTAQFAFR
PGPIFTNLLLADEINRTPPKTQAALLEAMEEGQVSVDGVAKPLPEMFMVA
ATANPIEYEGTYRLPEAQLDRFLLKLTVPLPGREAEIDILSRHARGFDPH
DLSAVAPVAGAADLAAGRAAVRQVLVADQVLGYIVDVVAATRHSPALQLG
VSPRGATALLAASRSWAWLSGRNYVTPDDVKAMAPATLRHRVMLRPEAEL
EGASADGVLDGILASVPVPRW
333992609YP_004525223.1 hypothetical protein JDM601_3969 [Mycobacterium sp. JDM601]MPTVDIDREAAREAAERELAKPIYPRPSPKQQFIDFLETLVQRLILRGAE
LPGGWFTISVLLILLAAAVVAAVTVGRRMLRDGRGDQRLFGTTQRSAAEY
RATAQHCAAAGDWGEAIRHGLRAVARELEETGVLHAAPGRTATELARDAG
AALPALADALLRAAETFNDVSYGELPATPDGYRIVADIDEQVCALTQRRL
YR
333992607YP_004525221.1 hypothetical protein JDM601_3967 [Mycobacterium sp. JDM601]MAELKSRLRADLTEAMKAQDKLRTATLRMLLAAIQSEEVSGKQARELTDD
DVLKVLTREARKRAESAAIYTENGRGELAAEEHAEARIIAEYLPEPLNEA
ELADVVDTALAQVAEEIGERPHSKHMGLVMKAATAIAAGKADGSRLSAAV
KERL
333992605YP_004525219.1 glycosyl hydrolase [Mycobacterium sp. JDM601]MASALIEDYALLGDLHTAALLGRDGSIDWLCLPRFDSPACFAALLHDESA
GYWRIAPAGGGPATRRGYRGDTLIVDSEWDAPGGTVRVTDFMPPRGKSAD
VVRIVEGVSGRVSMRMDLAIRFDYGNVVPWMRRRDDGLIAVAGPDTLCLS
SPVGMRGENMTTVAEFEVDAGEKVPFVLTHTPSHLLPEAVRSEAVRALGK
TESFWQNWIDQCSYRGQWADAVRRAVITLKALTYAPTGGIVAAATTSLPE
CIGGVRNWDYRYCWLRDATFTLQALLGTGYVAEAKAWREWLVRAVAGDPA
KLQIMYGLDGTRRLPEQTLDWLSGYEGSAPVRTGNEAAGQFQLDVWGEVL
DGLNLALDSGLECEDTAWDIQRALLDFLEGHWDSPDASLWEVRGPQRHFV
HSKVMAWAGVDRAVHAVRNHGREGPVDRWRALADAIHADVCEHGFDTERG
TFTQYYGSAGLDSALLLIPRVGFLPWDDPRVVGTVEAIQRELSSDGFLRR
YDTSDGSVDGLPGTEGAFLVCTFWLADALHGIGRRDEARALFERLLGLRN
DVGLLAEEYDTASGRQVGNTPQAFSMVGLVNTARGLSGESTRTKPGGSG
333992603YP_004525217.1 cysteine synthase CysK [Mycobacterium sp. JDM601]MTGRSALIATHGRPRRWADNAIRLIEADARRSADTHLLRYPLPSAWAADV
DVALYLKDETTHITGSLKHRLARSLFLYGLCNGRIAEGTTVVEASSGSTA
VSEAYFAALLGLPFVAVMPASTSASKVALIEAQGGRCHFVAHAADVYAEA
ERIAREADGHYLDQFTNAERATDWRGNNNIAESIFQQMRDEAHPIPDWIV
VGAGTGGTSATIGRYIRYRRHATRLCVVDPEHSAFYPAYEQCRYDLEIEE
SSRIEGIGRPRVEPSFLPDVVDRMVAVPDAASVATARHVSAVLGRRVGAS
TGTNIWGAFGLLSEMVADGRSGSVVTLLADSGDRYADTYFSDDWLAQQGL
DPTGAAAVLSEFERSCRFAFG
333992601YP_004525215.1 bifunctional membrane-associated penicillin- binding protein 1A/1B MLKLAGCCLLAAVLLAALLFPVAGGIGLMSNRASDVVANGSAQLVGGDVP
AVTTMVDATGNTIAWLYSQRRFEVPSDKIADTMKLAIVSIEDKRFAEHSG
VDWKGTLTGLAGYASGDLDTRGGSTLEQQYIKNYQLLVLAQTDAEKRAAI
ETTPARKLREIRMALTLDRTFTKPQILTRYLNLVSFGNNSFGIQDAAQTY
FGVDASELNWQQSAMLAGMVQSTSALNPYTNPEGALARRNLVLDTMIENL
PDQADALRAAKEEPLGILPQPNELPRGCIAAGDRAFFCDYVQEYLARAGI
SKEQVARGGYVIHTTLDPDVQGSVKQAIDSFANPNVQGIASVMSVIKPGP
EAHPVLAMASNRTYGLNGDIGETMRPQPFSLVGDGAGSIFKTFTVAAALE
MGMGISAELDVPGRFQTKGMGSGGAKGCPKETWCVVNVAPYRSPMNVSTA
LATSPNTAFAKLISQVGVGRTVDMAIKLGLRSYADPGTARDYDPDSNESL
ADFVKRQNLGSFTLGPIEVNALELSNVAATLASGGIWCPPNPIDKVFDRN
GNEVAVTTEICERVVPEGLANTLANALGKDIQGGGTAAPAAGSVGWDLPM
AGKTGTTEAHRSSGFLGFTNRYAAANYIFDDSSSPSDLCSFPLRHCGDGD
LFGGNEPARTWFAAMKPIATDFGEVIMPPTDPRYVDGGPNSRVPSVVGLD
VDAARQRLKEVGFQVADQPNWVNSSARSGAVVGTSPSGQTIPGSIVTIEV
SNGIPPPPPPPPEGGPPLGPVGSTVVEIPGLPPITIPLLPPPAPGQPLPP
333992599YP_004525213.1 anion transporter ATPase [Mycobacterium sp. JDM601]MTPETTGKPAALDMAAILADTANRVVVCCGAGGVGKTTTAAAMALRAAEY
GRTVVVLTIDPARRLAQALGIDDLGNSPQRVPLAPEVPGELYAMMLDMRR
TFDEMVVQYSGPERAEAILSNQFYQTVATSLSGTQEYMAMEKLGQLLAED
RWDLVVVDTPPSRNALDFLDAPKRLGSFMDSRLWKLLLGPGRGIGKLVAG
ALGLAMKALSTVLGSQMLSDAANFVQSLDATFGGFREKADRTYDLLKRRG
TQFVVVSAAEPDALREASFFVDRLAGEHMPLAGLVLNRTHPMLCELPIER
AIDGIETLQQAPSESVSDGAKALATAALRIHAERGATAKREVRLLSRFTR
ANPRVPIVGVPSLPFDVSDLEALGAIADQLTAK
333992597YP_004525211.1 hypothetical protein JDM601_3957 [Mycobacterium sp. JDM601]MSERTAWEYANVPLITHATKQILDQWGEDGWELVSVLPGPSGEQLIAFLK
RPK
333992595YP_004525209.1 hydrolase [Mycobacterium sp. JDM601]MSLSHPAYGRLRPVTETASVLLADNPGLMTLEGTNTWVLRGPRSDEVVIV
DPGPDDDEHIGRLAELGKVALVLISHRHFDHTDGIDKLADSLDVPVYSAG
SGFQRRLGGGLIDGQVIEAADLRITVLATPGHTADSLSFVLDDAVLTADT
VLGRGTTVIDTEDGDLAHYLDSLHRLRGLGQRTVLPGHGPELPNIDAVTA
GYLAHREQRLDQVRSALAELGEDATTRQVVEHVYTDVDEELWDAAEWSVQ
AQLDYLRAT
333992593YP_004525207.1 hypothetical protein JDM601_3953 [Mycobacterium sp. JDM601]MSWLLITAIPALLMLAAVGLERIETGLSEAEATNPQFPRTRRANRV
333992591YP_004525205.1 membrane-anchored thioredoxin-like protein [Mycobacterium sp. JDM60MRMRPMSRSTWWTLAVLAVATALVAALVIELRREPVRPDRGAPVPAVAQD
LTVLRERAGLPPCRDASDGAGPAALRGVTVACAADGAPVDVAAMFAGRRV
VLNLWAYWCRPCRDELPAFAEYQRRAGPDVTVVTVHQDDNQAAGLALLAE
LGVRLPTLQDGRRQVAAALRVPNVMPATVVLAMDGSVARILPQSFATADE
IAAAVGGSGR
333992589YP_004525203.1 membrane-associated serine protease [Mycobacterium sp. JDM601]MTSSQWLDIAVLAIAFVAAVSGWRSGALGSLLSFVGVALGAMAGVLLAPH
LIEHVAGARLKLFAALFLILAMVVIGEVAGVVLGRAVRGAIRSPGVRGVD
SIVGVVLQLVVVLIAAWLLATPLTASDQPSLAAAVNDSRVLRQVDDLAPG
WLKNVPRRLSAVLDDSGLPAVLEPFNRTPIAAVDAPDPGLAASPVVEATA
PSVLRIRGVAPNCQKVLEGTGFVISPNRVMTNAHVVAGSDSVSVESGTKS
YDATVISFDPKEDISILAVPDLPLPPLPFAPSPAEPDTDALVLGYPGGGV
FEATPARVRDTINLEGPDIYRTTTVTRRVYTIRGTVQQGNSGGPMIDMEG
RVLGVVFGAAVDDADTGFVMTAEEVSNQLARIGDTAPVSTQTCVGGE
333992587YP_004525201.1 transmembrane protein [Mycobacterium sp. JDM601]MPNTLATIPLTDPHALPADPSLGELVKDATAQMSTLVRAEVELARAEITR
DVKKGLTGSVFFIAALVVLFYSTFFFFFFLAEVLNIWLQDWAAYLIVFGV
MLTVASGLALFGFLRVRRIRGPRQTIESVRETREALRPDPDRLHSSGPQS
LKAHDGKPATDPSGW
333992585YP_004525199.1 acetyl-coenzyme A synthetase [Mycobacterium sp. JDM601]MSRNPDTAPADSPSSYPPSPEFTAHANTGAEAYRAAEHDRLAFWAEQANR
LHWATPFTEVLDYSRAPFARWFADGRLNVAYNCVDRHVAAGHGDRVAIHW
AGEPANDARTITYAELLAEVSRAANALTGLGLVAGDRVAIYLPMIPEAII
AMLACARLGVLHTVVFAGYSAHALRSRIDDAQAKLVITSDGQFRRGQAAP
LKPAVDEALSAAEATSTVEHVLVVRRTGAEVAWTPDRDLWWHDVVDAASP
QHSPEAFEAEQPLFLLYTSGTTGKPKGIVHTSGGYLTQAAYTHYCVFDLK
AATDVFWCTADIGWVTGHTYAVYGPLANGATEVIYEGTPDFPDQHRHFQI
IEKYGVTIYYTAPTLIRTFMKWGRDIPDAHDLSSLRLLGSVGEPINPEAW
RWYRRVIGADAVPVVDTWWQTETGATMICPLPGVAATKPGAAMTPLPGIS
ARIVDDHGDLVSPNDTGGEPVSGYLVIDAPWPAMARGIWGDEQRFIETYW
SRFAEQGWYFAGDGARYDADGDIWVLGRIDDVMNVSGHRISTAEVESALV
GHAAVAEAAVVGALDEQTGQRICAFVVLAASHSAAGGAIVDELRERVTVE
ISPIARPHKVHVVPELPKTRSGKIMRRLLRDVADGRELGDTSTLVDPSVF
DAIRAAD
333992583YP_004525197.1 phosphoserine phosphatase SerB [Mycobacterium sp. JDM601]MTASDPGTRQPQSQGSPRDTDSRTRTAAFLDLDHTIIAKSSALAFSKPFM
DQGLINRRTVLKSSYAQFLMLLSGADHDQMERMRTHLTNMCTGWNVEQVK
AIVNETMHDIVSPLVFAEAAELIADHKLCGRDVVVVSASGEEIVAPIARA
LGATHAMATRMVVADGKYTGEIAFYCYGEGKVQAIRELAAREGYPLEHCY
AYSDSITDLPMLQAVGHPSAVNPDRALRKEAVANGWPVLTFSRPVSLRDR
LPAPSGAAVATTAAVGISAVVAGALTYSLLRRRVF
333992581YP_004525195.1 hypothetical protein JDM601_3941 [Mycobacterium sp. JDM601]MRDSLIDRVRERLASESSAFSDLRPEAVAAAIRAESGGVLGDTEMLSNLR
TLQTELTGAGILEPLLCAADTTDVLVTAPDAVWVDDGAGLRRTDIRFADE
AAVRRLAQRLAAAAGRRLDDAQPWVDGRLGGIGTGEFTVRLHAMLPPVAA
DGTCLSLRVLRPATQDIAALAAAGGIARAAVALLADIVDARLAFLVSGGT
GAGKTTLLSAMLGAVHPRERLVCVEDAPELQPRHPHLVRLVARAANVEGA
GEVGLRDLVRQALRMRPDRLVVGEVRGAEVVDLLAALNTGHDGGAGTVHA
NSPAEVPARLEALAALGGLDRAGLHSQLAAAVQVLLHVGRERGGKRRLTD
ISVLRRTDTGLVQAAPVWQVDRGLSEHVAEFRALLRERTPA
333992579YP_004525193.1 hypothetical protein JDM601_3939 [Mycobacterium sp. JDM601]MLLAMAVLAAPSTVRARAGMPRPQQPVRHRLTPGGDALALAAGLEVFALC
LTAGMPVSGAAAATARYAPPQLAEVLRRGADLLALGAEPGVAWSASPDRS
AGALDPSTTAVLRLARRSGASGAALATGLVALAAQCRAEAAHQATAAAER
AGVLIAGPLGLCFLPAFVCLGIVPVVAGLAGDVLRSGLL
333992577YP_004525191.1 hypothetical protein JDM601_3937 [Mycobacterium sp. JDM601]MAGRGRLTDDAGASTVEAAFALAALVAVLVLCLAGISAVSAQLRCLDAAR
EAARLAARGDTPAATAVVRRIAPAGAAVRLHPDGGFVVATVTVRPALLPG
LVVSAEAVSAAEPSR
333992575YP_004525189.1 hypothetical protein JDM601_3936 [Mycobacterium sp. JDM601]MAHDWLLVETLGGEPAVVAQGRQVKNLVPITQFLRRSPHLAAIRTAIAET
MRTGQSLVSITPKHDRVIRTEPVVMSDGRVHGVHVWSGPADVEPPERPTP
GPLKWDLTLGVATDTEESLANSGKDPTVEATHGRAFAEELPTRDFNPNEN
KVLALAIRAEPDKTICSSWDVTDFRGDTIRVGFVARTGWESGLGRREHLV
ARGMNWRGQLDGTVHRPDFLAQQILHGLAQPGVHRAMVDLIDWRLLKWLD
DPCPFYDWRGTVDAPRVHPDDEARVARMTTDFTAGPATGVLRLRQSDGGW
APVHVTVNRIELEAGTYAGLIALRLPTDGELAEAGLDPPADAS
333992573YP_004525187.1 cold shock protein A CspA [Mycobacterium sp. JDM601]MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQRVEF
EVGQSPKGPQATGVRAV
333992571YP_004525185.1 DNA topoisomerase I TopA [Mycobacterium sp. JDM601]MRRLVIVESPTKARKIAGYLGSGYVVESSRGHIRDLPRNAGDVPAKYKTE
PWARLGVNVDAEFEPLYIVSPDKKSTVTELKGLLKDVDELYLATDGDREG
EAIAWHLLETLKPRVPVKRMVFHEITEPAIRNAAENPRDLDIDLVDAQET
RRVLDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRIIVQRERERMAFRSA
SYWDVVAQLDASVSDPGAAPPTFTARLVAVDELRVASGRDFDSLGTLRKP
DEVRVLDEAAATALAAGLAGASLSVTSVEEKPYTRRPYAPFMTSTLQQEA
GRKLRFSAERTMSIAQRLYENGYITYMRTDSTTLSASAIDAARTQARQLY
GEEYVSPTPRQYTRKVKNAQEAHEAIRPAGETFATPDAVRNELGSDEFRL
YELIWQRTVASQMADARGTTLSLRIGGRSGSQQVTFAASGRTITFAGFLK
AYVETVDELAGGEADDAERRLPQLTQGQRVDAAEATPDGHSTNPPARYTE
ASLVKSLEELGIGRPSTYSSIIKTIQDRGYVYKKGSALVPTWVAFAVIGL
LEQHFGRLVDYDFTAAMEDELDGIAAGRQRRTDWLHNFYFGGDYGVEGSI
ARAGGLKKLVGVNLEGIDAREINSIKLFDDEQGRPVYVRVGKNGPYLERM
VAGDDGEPTPQRANLDDSLPPDELTLALAEERFATPQEGRPLGIDPETGH
EIVAKDGRYGPYVTEILPPPDDESGTTAKKGKKPTGPKPRTGSLLRSMDL
QTVTLEDALKLLSLPRVVGVDPGSGDEITAQNGRYGPYLKRGTDSRSLSS
EEQIFEITLEEALKIYAEPKRRGRQAAAAPPLRELGADPATGKPMVIKDG
RFGPYVTDGETNASLRKGDEVASITDERAAELLADRRAKGPVKKKAAKKT
TRKAPAKKATKR
333992569YP_004525183.1 DNA polymerase III subunit delta' [Mycobacterium sp. JDM601]MSGVFARLVGQQPVEAELLAAARAARYDAAHSVRTAGGMSHAWLITGPPG
SGRSIAAVCFAAALQCSADEADGGPGCGTCRACTTTMAGTHADVRRVVPE
GLSIGVEEMRSIVQVASRRPGTGRWQIVVIEDADRLGERAGNALLKAIEE
PPPSTVFLLCAPSVDPEDISITLRSRCRHVALVTPAPAAIAQVLIDTDGL
DHETAGWAAAVSGGHVGRARRLATDPEARQRRQRALALARDSATPSRAFS
AVDELVAAAESEARDLTADRAEAETEELRTALGAGGTGKGTAGTLRGTAG
MIKDLERRQNSRHKRASLDALDRALIDLASYFRDALLVATASAGAARPNH
PDMVDAAAAMAAHASGDALLRCIEAVLECRDALAANVKPRFAVGAMVATI
GQALRADL
333992567YP_004525181.1 two-component transcriptional regulator TrcR [Mycobacterium sp. JDMMSDNTDHRSPRKAILGQLPRINRPDGSPIRVLLVDDEPALTSLVTMALHY
EGWVVDVAHNGRDAVAKFHSGEPDLLVLDIMLPDVDGLQILQRVRESDAY
IPTLFLTARDSVTDRVTGLTSGADDYMTKPFSLEELVARLRGLLRRSAQL
TPPVDEVLTVGDLTLDGASRQVTFGRTPVSLSTTEFELLRFLMRNPGRAL
ARAEILDRVWNYDFAGRTSIVDLYISYLRKKIDADPPMIHTVRGVGYMLK
PQP
333992565YP_004525179.1 PE-PGRS family protein [Mycobacterium sp. JDM601]MSFVVTQPESLSGAAGDLQGIGSAVHAQSAAVAAPTTAMAAPASDAVSMS
IAALFNANGALFQDVAAQAAAVHQMFVSTLNGGGMAYASTEAANAIAAG
333992563YP_004525177.1 aminopeptidase [Mycobacterium sp. JDM601]MSKPVKPLTEATDSVAPVADPYLPGSGNTGYRVSRYELDLEYKLSSNRLS
GTATITAVTLTALRELTLDLADTLSVAKVWVNGRHPARFGTAAAKLRITL
AAELPAGAALVITVRYSGSPRPSETLWGEVGFEELSDGALVSGQPNGAPT
WFPCDDQPAAKASYLIQISTDSSYRAVANGELVSQRVRSARTTWTYEQPE
PTPTYLVTLQIGRYVTRRLPDADVPIHAVLPARLTRQFDRDFARQSQMMD
LFVRLFGPYPLTAGYTVLVTDDELEIPLEAQGISVFGANHCDGRRGSERL
IAHELAHQWFGNSVTVRHWRDIWLHEGFACYAEWLWSEHSGGPSTDELAR
RYHRQLSSLPQDLLLADPGPADMFDDRVYKRGALTLHLLRGKLGDDDFFA
LLREWTTRYRHGNAATEDFTGLAAEYAAAASVEPLEALWQAWLYSAELPA
L
333992561YP_004525175.1 transmembrane protein [Mycobacterium sp. JDM601]MRTRLASLPWVCWAALALIAAQLAVRAVVAFGGYFYWDDLILIGRAGTHE
LLSPSYLFDDHDGHVMPGAFLLAGVLSRLWPLQWAAPAASLVVLQLLASL
ALLRALRVILGWRPVLLVPLVFALFCPLGLPAFAWWAAALNSLPMCAALA
WVCADAILLARTGNRRYALTGTVAYAGGLLFFEKAAVIPFVAFTVCALLH
HVAGGRGAVAATWRAGARLWAATLAVTGGWIAVYLAVVNQRRWSLDLDMT
RDLLWRSVTHGIVPSLAGGPWTWARWAPASPWALPGPAVMALGWLVLAGL
LAVSSARKHRLVPVWLAAAGYAAACQVPIYLMRSSAFTALELAQTLRYLA
DLVVVLAILGAVGMCAPNRDASRWLDASPWRTAVVSCLAVTFTASSLYST
ATFLARWRDDPARPYLHNALPALAAARVESDAPLLDQEVDPLVLQRVVYP
ENLASHLFALVRDRPEFASATPRLRMLTSAGTLTDAQVTWVRSIVAGPVP
QCGYLVQPDLPVTLGLDGPLLPADWTAEINYLANVDGAMTLSLSDGPDVR
VRVRPGLNRVYVRLPGGGHNVTARADTAALSVCIASGPLGYVAPT
333992559YP_004525173.1 metal cation transporting p-type ATPase CtpH [Mycobacterium sp. JDMMDVFSIGRFGLETVGAAATSVLGASLDLAAIPLREGAKILAGERSDLTSR
RSWRGAGRAWIEIRGLDEDGGADIGAEVLDALRARPDVTSVRLNRPLSRV
IVEIDDDASLADLCATVGAVEKSAALSVTETAALPGDGLLLAAKGAMVGA
NAVGLAIATAGSVLRWPAAPKIFDAAASVARYQPLVRNALESRIGPARTD
AVLSLASLGSHIITMSPAILAVDLMVEGLKASEARAGALAWNRYEPELAR
WAEHPEVPRAPRPVPRPHGPAERYLRRTAVAQVLATGVVGAITRNVDMTS
SAILATSPKAVRTSCESFAATLGQGLADSHEVLPLRPDSLRRLDKIDTVV
IDPRVLTGEQRRVVQIHGATEHELPQAWNNAQRLLDKPGLRPGWHRVRMT
ARDRAEAVEALILPTHHALASAVVLEGRASGAQLVTVDTDILGELRPGFD
DIRPAPGAGDIDGMDAALAAAVTELQQAGRTVAVLSSSAAQALAAADLAL
GVMPASENDSLPPPFYADLLLADLGAAWQLLRALPAARDATERGVAISIG
ASTIAGLLLVRGVRATIPGLGAAPGRGPGPVTVGAGAGMLSGYLLARRVL
RARAPQPAPAYEWHAMSVEQVRELLGPGAVTPLAERAPVDTGPQGMFWPY
FHAVRAELSDPMTPILALCSAATAMLGSPIDAVMVGTVLTGNAMLAAYQR
LRAESRLNTLLAQQAPPARIALTGADGSRTYHEIVAEQLLPGDVIEVRSN
EVVPADARLIEQCDVEVDESSLTGESLSVGKQLDPTPGAELAERSSMLYA
GTTVIAGTALAIVTAVGADTQSRRASELASGELPEVGLQHHLSQLMHRTF
PYSAAGGVAVGALGLLRQGGLRVALGNAIAVAIAAVPEGMPLMATLAQHA
SSQRLSKSGALVRIPRSVEALGRVDVVCFDKTGTLSENRLRVTTVHPVGG
YSDDDVLGTAAQAAPAPGGAAYAHATDQAIVEGAAAAAGARPWTEPDAHL
PFRSGRAFSASALGSELVVKGAPEVVLEACKNAGAEEERQVAEMAARGLR
VIAVAQRKLTAAQLRAVRDDPEGTERITEVAGSGLTLIGFLGLADTPRAD
APQLLSDLAARGIDIRMITGDHPITASAIAAEMGVTVAAEQVITGSEWNA
LNRKEQERVVCERVIFARMSPENKVQIVQTLERAGRVSAMVGDGANDAAA
IRAATVGLGVVAHGSDSAHATADVVLTDGKIGALVDAIDEGRRLWRGVQL
AISGLLGGNAGEVMFSVIGTAVTGDSPLNTRQLLLMNTLTDALPATAVAV
STPAGPIGDAVPGLDEKKLWRAVAFRGGVTAAAGTAAWAMGRVSGTPQRA
STVALISLVTTELGQTVVDSRAPLVLATAAGSFVLFAAMVSTPGVSQLLG
CTPVGPIGWAQGVGTAAVATAAVAVAGRRSDVVKEIAAAVPEAPTVAAAP
ADKAVAAKKVPAKKGPAAKKPPAKKAPAAKKAAAKNASAKKAAAKKPTRK
LEVVR
333992557YP_004525171.1 hypothetical protein JDM601_3917 [Mycobacterium sp. JDM601]MNWIKVLLIAAVLALLIYLLLSRGSAQSRAWVKIGYLGFVVAGIYAVLRP
DDTTVVANWLGVRRGTDLMLYVLIMVFAFTTLSTYMRFRDLELRYARLAR
VVALAQAQSPEPGGSARPDEGEPKLGPPHQHRGSARLDEGEPKL
333992555YP_004525169.1 hypothetical protein JDM601_3915 [Mycobacterium sp. JDM601]MVTEIGGTGPRRSTGGLPAGPVTRASVARVGTATLLSALCGYAVLYLAAR
DLDPAGFSVFSVFWGAFGLVAGAANGLLQETTREVRFAREVGTGRPSTRH
TRPLWVAGLAGVVAAGLVAGTSPLWSGHVFVEARWLSVGLLCFGLANFAV
HATLLGMLAGTNRWTQYGALMVTDAGIRVAVATATFAVGWGLVGFLWATV
AGAMAWLLLLAASPAARSAARLLTPVGTTDFLRGAAHSITAAGASAILVM
GFPVLLQATYGELGAQGGVVILAVTVTRAPLLVPLTALQGNLIAHFVDQR
GRRLRALSIPAASVAAVGAAGAVAAGLVGPWLLRTVFGPDYHASGPLLAG
LTAGATAIALLTLTGAATVAAALHRAYALGWVGATVVSTLLLMLPLELPT
RTVVALLCGPLVGIAAHLTALRAAP
333992553YP_004525167.1 hypothetical protein JDM601_3914 [Mycobacterium sp. JDM601]MTTRYDRPSATARFGNALIRRLAEAGISVAGTRALTVRGRKSGELRGVVI
NLLSVDGVDYLVAPRGETEWVRNARAAGEVLLGPRWRRAPTRVTEVFDDD
KPVVLRQYLRRWHWQVKGFMAGVTPDSDDDELRSAAPSIPVFSLG
333992551YP_004525165.1 inorganic pyrophosphatase Ppa [Mycobacterium sp. JDM601]MQFDVTIEIPKGQRNKYEIDHATGRVKLDRYLYTPMGYPADYGFIEDTLG
EDGDPLDAMVLLPQSVFPGVIVEARPVGMFRMTDEAGGDDKVLCVPAGDH
RWDHIADIGDVPEYELDAIKHFFVHYKDLEPGKFVKAADWVGRAEAEAEI
TRSIERFKTSGH
333992549YP_004525163.1 D-alanyl-D-alanine carboxypeptidase DacB1 [Mycobacterium sp. JDM601MDSTRWRHSSTHLGIAGAVLALAAAVVVVAAVVLPDESGAGAHVVAPAPT
ATAEPGVVPVVDDAPVPTGSALTAAMSAALADPNLGRLTGRITDALTGKA
LWTQQEDLPMQPASTNKVLTAAAALLALDLSTRVTTRVTAGDQPGVVVLV
GAGDPTLSTAEVGQDTWYRDAARISDLADQVRRSGVTPTEVRVDVSAFSG
PSMAPGWDPDDIEGGDIAPIEAVMVDGGRIQPTTVESRRSRTPALDAGEA
LAAELGLDADKVSIATASVTGRELGAVSSAPLVVRLGEMMNASDNVMAEC
IGREVAAAMGRPRSFAGAVDAVTNRLATAHIAVSGASLYDSSGLSVDNRL
SARNLDAVVQAAAGPDQPELRPLLDMLPVAGGSGTLSDRFLDPRTGRGAA
GWLRAKTGSLTRTNALAGIVTDRDRRVLTFAFISNDAGPTGRTSIDALAA
VLRTCGCG
333992547YP_004525161.1 cell cycle protein MesJ [Mycobacterium sp. JDM601]MDRSGAVAGLRAALLAFAERHLPEVEPWCVALSGGPDSLALTAVAAQLRP
TTALIVDHGLQAGSAQVAGRARSQAIELGCVDAQVIPVTVGGKGFRGGPE
AAARTARYGALERARDRRPVLLGHTLDDQAETVLLGLGRGSGPRSLAGMR
PHDPPWCRPLLGVRRAATREACTELALTPWLDPHNSDKRFTRVRLRLQVL
PLLEDVLGGGVAEALARSATALRENTELIDALAEQAAPEVTAGAGLDTAG
LAGLAGPVRRAVIRRWLLAGGGRGLTDLQIRAVDRLVTQWRGQGGVAVGS
DLRGERLFAVRDDGVLRLRREPV
333992545YP_004525159.1 transposase mutator type IS256 family [Mycobacterium sp. JDM601]MTQDHSALLAQLDALKSADGGAVFAELIRAGLQALIEAEATAAIGAGRYE
RADGRTVHRNGHRPKTVSTTSGDVEVGIPKLRAGSFFPSLLERRRRIDRA
LHAVIMEAYVHGVSTRSVDDLVAAMGVQSGVSKSEVSRICAGLDKEIEAF
RTRSLAHTTFPYVFCDATFCKVRIGAHVVSQALVVATGVSIDGTREVLGT
AVGDSESYEFWREFLASLKARGLAGVHLVISDAHAGLKSAVAQQFAGSSW
QRCRVHFMRNLHTAVSAKHAPAVTAAVKTIFAHTDPEEVAEQWDRVADTL
ADSFPKVAAMMGEAKTDVLAFTAFPKAHWQKIWSNNPIERLNKEIKRRAD
VVEIFPNPASFLRLATAVVIESHDEWQVTRRYLSDVSMDELRAVIAKKHA
AEALAKQHQIA
333992543YP_004525157.1 hypothetical protein JDM601_3903 [Mycobacterium sp. JDM601]MTVAPSRALSNAIEAFAGQVYFAPECHRGYAELGFGSSPGTSGGVELPDG
PAYFCSRGSALGQASGQVIAATFGVFNPAVVVPAVDYGWTLTDAPAIRAA
RTDGSAAQLRRVLGDAPEGLDRATALLGRAADGLPLAGKPLFAGLVAAGL
VGDPLTDAWLLADQLREFRGDAHVNAWVAAGFDAVEIGLITELYRGLPPR
SYVRSRAFSEDELSAGEARLAERGLARDGVLSDAGRAARESVETATDAAC
EPIVARLGDELPELVELVGGWSKRLREAGAFPA
333992541YP_004525155.1 monooxygenase [Mycobacterium sp. JDM601]MAAPLRFGVFITPFHALGQSPTVALEYDLERVVALDRLGFDEAWFGEHHS
GGYELIACPEVFIAAAAERTKHIRLGTGVVSLPYHHPLMVADRWVLLDHL
TRGRVMFGTGPGALPTDAHMMGIDPVEQRRMMQESLEAILALFRAEPGEL
VTRHSDWFTLRDAALHIRPYTWPYPEISTAAMISPSGPRLAGALGTSLLS
LSMSVPGGFAAVESAWQVVCDQAAKAGRDEPDRAGWRVLSIMHIADTREQ
AVADCTYGLQDFANYFGAAGFVPLASEVEGSPQTPTEFVETYAAAGSCCI
GTPDDAIEHITDLLERSGGFGTLLFLGHDWASPEATYHSYELLARKVIPH
FKGQLAAPRASHEWAKGMRDTLFGRAGEAIKNAVVEHAAESGPR
333992539YP_004525153.1 membrane-bound protease FtsH [Mycobacterium sp. JDM601]MNRKNVIRTVTAIAVVLLLGWSFFYFSDDTRGYKPVDTSVAVAQIHSGNV
KSAQLDDREQQLRLVLKNPLTSVELSDKDDKAARSGKSEQVDKLIAKYPT
GYAVPLYTALTKQKAEINTVVNQGSMLGTLLIYMLPMLLLIGLFVMFSRM
QGGARMGFGFGKSRAKQLGKDMPKTTFADVAGVDEAVEELYEIKDFLQNP
GRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEM
FVGVGASRVRDLFEQAKQNSPCIVFVDEIDAVGRQRGAGMGGGHDEREQT
LNQLLVEMDGFGERAGVILIAATNRPDILDPALLRPGRFDRQIPVTNPDI
AGRRAVLRVHSAGKPIGPDADLDGLAKRTVGMSGADLANVINEAALLTAR
ENGTVITGAALEEAVDRVIGGPRRKSRIISEHEKKITAYHEGGHTLAAWA
MPDIDPVYKVTILARGRTGGHAVAVPEEDKGLRTRSEMIAQLVFAMGGRA
AEELVFREPTTGAVSDIEKATQVARAMVTEYGMSAKLGAVRYGSEHGDPF
VGRTMGTQPDYSHEVARDIDDEVRKLIEAAHTEAWEILTEYRDVLDTLAG
ELLEKETLHRADLEKIFGDVAKRPRLTMFDDFGGRVPSDKPPIKTPGELA
IERGEPWPQPRPEPAFKAAIAQATREAAARAGESGTNGSNGVPAGDAGAG
TQPDYGAPAGWHAPGWPPPPQQQPQPQPHSGYWYPPQQWPQQGYPPAQPY
PPYQPYPAPPPAPAAPPGEGDGHQRGTEKNRSEPPSGD
333992537YP_004525151.1 dihydropteroate synthase 1 FolP1 [Mycobacterium sp. JDM601]MNPTCAQVVGVVNVTADSFSDGGRYLNADRAVAHGLELVAEGAAIIDVGG
ESTRPGAVRADPRAEAQRVVPVVRELAAQGITVSIDTMNAAVARAALDCG
AEIVNDVSGGRADPAMAPLLAASGAGWVLMHWRPVDPGHPHRVPGYRDVV
AEVRADLLASVDAAVADGVDPAKLIIDPGLGFAKTAQHNWTLLKALPELV
GIGIPVLVGASRKRFLGTLLAGADGAPRPPDERETATAVISALAGLHGAW
GVRVHDVRASVDALRVVDAWTAAGSQGGTSDD
333992535YP_004525149.1 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinaseMTEAVLSIGSNLGDRLARLQSAVDGFGTAVREVSGVYESEAWGGVDQGRF
LNAVLIVEDPAVDKHGWLHRAQDLEQAADRVRGERWGPRTLDVDVISCRE
QPGGAELFSRDDGLTLPHPLAHLRAFVMVPWLAVEPEAQLTVAGRQCAVA
GLLDELEPADRTSLRLTDLVLQR
333992533YP_004525147.1 hypothetical protein JDM601_3893 [Mycobacterium sp. JDM601]MFTSRVELLKLAVIVALWAAVAAAFVSVIYRRQSDVDQARARDLKLVYDL
QLDREISARREYELTVESQLRRELASELRAQAADEVAALRAELAALRTNL
EILFDSDLSHRPALETDSAARTTIRAYSDWARSGGESDGARATPAAAAYY
PEDPVTQTTESPIIDVPEVGIPTGGIPTPAAHQTYQPPQPSQTSQPPPAE
PTYRGSHRRAADETPRRAAEDGGGARRAAEEAVPRHPAEEVQQPAGRWAQ
PPQPFVPPEPRREAESRREPAPPPTPPPAAPPPPPWVAGPPASPPASEPA
WKPVGAEGEWLPPGSPGSNWSAETPPTAADSGRHGAADPRHAGEDAVAAA
PERSAEAPSRHGRHAGPGTLADGPVNGAERARHDGEGRRRARSRHSAEPV
GSHAQPESAPGSAPGRSARHSTGAEPGTEAAPNTGGQSVAELLARLQATP
TEGRRRRRREE
333992531YP_004525145.1 pantoate-beta-alanine ligase PanC [Mycobacterium sp. JDM601]MIPNAARGAQPTFAAGELNVYARPDEIARVTRALRSTGRRVMLVPTMGAL
HDGHLALVRAARKVPGAVVVVSIFVNPLQFGAGEDLEAYPRTLDDDLALL
RAAGVELVFAPTAAAMYPDGPRTAVHPGPLGSELEGAARPTHFAGMLTVV
AKLLSIVRPDRAFLGEKDYQQLVLVRQMVADLDLDVTVVGVPTVREPDGL
ALSSRNRYLDPAQREAAAALSAALAAGERAASAGATAALDAAGAVLSAVP
AVDVDYLQVRGVDLGPAPAEGQARLLIAARLGATRLIDNAAITLGFPADD
TSVGSDGYPAAQNRRN
333992529YP_004525143.1 pantothenate kinase [Mycobacterium sp. JDM601]MLLAIDVRNTHTVIGLLAGSGEHANVVQQWRIRTEAEITADELALTLDGL
IGDDGEQLTGAAALSTVPSVLHEVRVMLDQYWPSVPSVLIEPGVRTGIPL
LVDNPKEVGADRIVNCLAAFHKFNKAAIVVDFGSSICVDVVSAKGEFLGG
AIAPGVQISSDAAAARSAGLRRVELTRPRSVIGKNTVECMQAGAVFGFAG
LVDGLVRRVRDDTPGLADATVVATGHTARELLADLETVDHYDANLTLDGL
RLVFERNRDSQRGRLRPAR
333992527YP_004525141.1 iron-regulated Lsr2 protein [Mycobacterium sp. JDM601]MTVTLIDDFDGEGAADETVEFGLDGVTYEIDLSTKNATKLRSDLKKWADA
GRRVGGRRRGRAGGARRGAIDREQSAAIREWARRNGHNVSTRGRIPADII
DAFHAAT
333992525YP_004525139.1 ATP-dependent protease ATP-binding subunit ClpC1 [Mycobacterium sp.MLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQ
QAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAA
QVLVKLGADLTRVRQQVIQLLSGYQGKETAEAGTGGRGGESGSPSTSLVL
DQFGRNLTAAAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVG
KTAVVEGLAQAIVAGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKK
VLKEINTRGDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIG
ATTLDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILKGLRDRYEAHHR
VSISDSAIVAAATLADRYINDRFLPDKAIDLIDEAGARMRIRRMTAPPDL
REFDEKIADARREKESAIDAQDFEKAASLRDREKQLVAQRAEREKQWRAG
DLDVVAEVDDEQIAEVLGNWTGIPVFKLTEAETTRLLRMEDELHKRIIGQ
KDAVNAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALAEFLF
GDDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSV
VLFDEIEKAHQEIYNSLLQVLEDGRLTDGQGRTVDFKNCVLIFTSNLGTS
DISKAVGLGFTQGGGENNYERMKLKVNDELKKHFRPEFLNRIDDIIVFHQ
LSKEEIIQMVDLMIGRVAKQLKAKDMDIALSDKAKSLLAKRGFDPVLGAR
PLRRTIQREIEDQLSEKILFEELGPGQLVTVDVDNWDGEGPQEDAVFTFV
GSQKPAAEESDLAKAGAPTAD
333992523YP_004525137.1 hypothetical protein JDM601_3883 [Mycobacterium sp. JDM601]MSVVKINAIEVPADAGPELENRFAHRAHAVENQPGFLGFQLLRPVKGEDR
YFVVTHWESDEAFQAWAQGPAVEAHAGQRAKPVATGASLLEFEVVLDVAG
TAPQA
333992521YP_004525135.1 adenine glycosylase MutY [Mycobacterium sp. JDM601]MTVDAGDLLGWFDSAERDLPWRAVGVSPWQILVSEFMLQQTPVARVLPIW
TDWVARWPTPSATAAATPADVLRAWGKLGYPRRAKRLHECAVTIARDFAD
VVPDDVETLEQLPGIGSYTARAVACFAYRKPVPVVDTNVRRVVARAVHGR
ADAAGPSAKRDHADVAALLPDAARAARFSAALMELGALVCTARTPRCDSC
PLREHCRWRLAGSPSADGPRRPAQRYAGTDRQVRGRLLDVLRDNEFSVTR
ADLDVAWPVDEVQRERALASLLDDGLVEQLADGRFALPGQDRNDSTASR
333992519YP_004525133.1 hypothetical protein JDM601_3879 [Mycobacterium sp. JDM601]MLDLEPQGPLPSQIYWRRRGLALGIAVAVIAVVAAIIFAVVNSSAGAENA
DGKKTTATQQAKPPGAPAEEAKTPVVPPAEEAPPPAPTPTAAVIPPPVLK
EGDDCPDSTLAVKGITGPQYTVGEQPQFTMVVTNIGLVACKRDVGAAVLA
AYVYSLDNQRLWSNLDCAPSNETLVKTFDPGEQVTTTVTWTGMGSAPQCP
LPRQPIGPGTYNLVVQLGNLRSATVPFMLTEPAPDAPPPPIDHLPMPEAP
PGN
333992517YP_004525131.1 hypothetical protein JDM601_3877 [Mycobacterium sp. JDM601]MELIGTAGRAGAAGRRPFGGAVDSATGSMPPQLPHSGQRPSHFAQVFPHS
EQRYSERALEVLATR
333992515YP_004525129.1 transcriptional regulator [Mycobacterium sp. JDM601]MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKDYLVLKVAQGDLTVRVPA
ENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGD
VHKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAENTDDAKA
ETILDEVLAAAS
333992513YP_004525127.1 2-C-methyl-D-erythritol 2-4-cyclodiphosphate synthase [MycobacteriuMSALPRVGVATDVHPVEPGRPCWLLGLLFPGADGCAGHSDGDVAVHALCD
ALLSAAGLGDLGTVFGVDEPRWAGVTGAVMLGHVRGLLGESGFTVGNAAV
QVIGNRPKVGPRRAEAQQLLSELLGAPVSVSATTTDGLGLTGRGEGLAAV
ATALVVPG
333992511YP_004525125.1 cysteinyl-tRNA synthetase 1 CysS1 [Mycobacterium sp. JDM601]MTDGPSLRLHDTATGAVRDFVPLRPGQVSIYLCGATVQAPPHIGHVRSGV
AFDVLRRWLTARGYDVAFVRNVTDIDDKILTKAAAAGRPWWEWAATYERE
FTAAYDALGVLPPSVEPRATGHITQMIELIERLIDSGHAYPGGGDVYFDV
LSYPEYGQLSGHKIDDVHQGEGAATGKRDPRDFTLWKGAKPGEPSWPTPW
GRGRPGWHLECSAMARTYLGPEFDIHCGGMDLVFPHHENEIAQSRAAGDG
FANYWLHNGWVTLGGEKMSKSLGNVLSMSAVLQRVRPAELRYYLGSAHYR
SMLEFSETALHDAVNAYVGIEDFLHRVRSRAGAVAVGTWTPRFAAALDDD
LSVPIALAEVHRARAEGNRALDAGDHDGALASAGAIRAMMNVLGCDPLDE
RWESRDETSAALAAVDVLVRAELQRRETARTERDWQLADEIRGRLKDAGI
DVTDTGDGPQWSLLLDGAG
333992509YP_004525123.1 glycerophosphoryl diester phosphodiesterase GlpQ1 [Mycobacterium spMAAVLAGSPVAAQPASFDLQAHRGGRGETTEESLRAFAKAIESGVTTLEL
DIVLTRDAQPLVWHDLVIEPAKCADTGPVVAADPDYPYLGKRVADLTLAQ
LRTLDCGQPLPEFPDAEVVRGNVIATLPEVFALADSYRSGVRYNIETKVD
GGNQRQIVEVILAAVRAGGKLDAVEIQSFDWRTLSLVRAAEPAIPLVALW
ERGPDPITGAAAVGADGVSPDHRIVDRAFVERAHAAGLRVVPWTVNDADA
MRQQIAAGVDGFITDYPSRARAVLAESGMPLPPATG
333992507YP_004525121.1 hypothetical protein JDM601_3867 [Mycobacterium sp. JDM601]MRLKPGRPDIGRYAHRFTVPAAAPDAPLWVTWLGVTSMLIDDGSSALMTD
GYFSRPGLIRVALRKVSPSAARIDGCLARAGARELAAVIPLHTHIDHALD
SAVVAERTGAALVGGQSAANIGRGQGLSDDRLIVAVPGTPITLGAYDVTL
VESRHCPPDRFPGVITTAVVPPVKASAYKCGEAWSALVTHRPSGHGLLIV
GSAGFVPGALAGHRAEVVYLGVGQLGLQPRQYLVDYWSETVRTVGAKTVV
LTHWDDFFRPLSKPLLALPYAGDDLDFSMRILCELAEADGVALHLPTVWR
REDPWR
333992505YP_004525119.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MSANTTETSAADQFAARELVRDWAAAAGTAEAIRAVELGETDAWKPVFAR
LAELGLFGVAVPEECGGAGGRLEDLCAMVDEAAKALVPGPVATTALATLV
VADPQLTEALAVGERVAGVAIDAGLHFDAAAGKVSGTAEWVLGATADALL
VLPAGQDWVLVDSRADGVDVEPLIATDFSRPLAKVTLSDAPAVILESGGR
VENLAVTVLSAEAAGVARWALDTAVAYAKVREQFGKPIGSFQAVKHLCAE
MLCRAEQATVAAADAARAASDSDQQQFAIAAAVAAAICIDAAKANAKDCI
QVLGGIGITWEHDAHLYLRRAYGIGQALGGQERWLRRTTALTRAGVRRRL
EVDLDDAASDIRPEIAEAAARIAALPEEQRQVALAESGLLAPHWPAPYGR
AAGPAEQLVIDQELAAAGVARPDLVIGWWAAPTILEHGTPEQIERFIPAT
LTGEVFWCQLFSEPGAGSDLAALRTKAVKVDGGWRLTGQKVWTSRADDSQ
WGICLARTDADAPKHKGITYFLLDMSAEGIDIRPLREITGDALFNEVFLD
DVFVPDEMVVGGVNDGWRLARTTLANERVAIAGGTALGNPMEELLKALFG
GQHDREPDTATADRLARLIIAAQAGSLLDQRIAQLAVGGQDPGSESSVRK
LIGVRYRQDLAECRMEVADGAGAVAGRPVHDFLNTRCLSIAGGTEQILLT
LAAERLLGLPRG
333992503YP_004525117.1 1-4-alpha-glucan branching enzyme [Mycobacterium sp. JDM601]MTRSKHTSAGRLAVNPDDINRLLSGVYHDPHAILGAHDDGERTVIRTLRP
GAAAVTVLVGGDRLPMKQVAEGLFAATLPFADLIDYRLLIDYPGVAEPQT
VADGYRFLPTLGEVDLHLFAEGRHERLWDVLGAHPRAFTTADGTVTGVSF
AVWAPNARGVGLISDVTGWEGIGAPMRALGSSGVWELFWPGFPIGGLYKF
RIHGADDVVTERADPMAFSAEVPPQTASRVTTSGHTWHDDEWMSRRPAGN
PALEAMSIYEVHLGSWRPGLSYRQLAVELTEYVVQHGFTHVELLPVAEHP
FGGSWGYQVTSYYAPTARFGTPDDFRVLVDALHRAGIGVIVDWVPAHFPK
DAWALGRFDGTPLYEHADPRRGEQLDWGTYVFDFGRPEVRNFLVANALYW
LTEFHVDGLRVDAVASMLYLDYSRPEGGWTPNIHGGRENLEAVQFLQELN
ATAHRVAPGIVTIAEESTSWPGVTRDTSLGGLGFSMKWNMGWMHDTLSYL
GHDPVHRSYHHHEMTFSMLYAYSENFVLPISHDEVVHGKGTLWTRMPGDD
HAKAAGVRTLLAYQWAHPGKQLLFMGQEFGQHAEWSEERGLDWFQLDPKR
QDGGFAAGILRLTKDLNAVYRSHPALWSEDINPAGYSWIDANDSANNVLS
FLRYATDGSVLAAVFNFSGVEHTDYHLGLPRAGRWREVLNTDAVDYHGGG
AGNLGGVDAVDEPRHGRPASAVLVLPPLSALWLEPCE
333992501YP_004525115.1 trehalose synthase TreS [Mycobacterium sp. JDM601]MATDVDDEFGQDLPDPAAGSHVEHGLVEHPTADDFGDAAALPADPVWFKR
AVFYEVLVRAFYDSNGDGIGDLRGLTERLDYLQWLGVDCLWLPPFYDSPL
RDGGYDIRDFYKVLPEFGTVDDFVELLDAAHRRGIRVITDLVMNHTSDSH
PWFQQSRHDPDGPHGDFYVWSDTSERYADARIIFVDTEESNWTFDAVRKQ
FYWHRFFSHQPDLNYENPAVQEAMIDVLRFWLNLGIDGFRLDAVPYLFER
EGTNCENLPETHAFLKRCRKVVDEEFPGRVLLAEANQWPSDVVEYFGDPE
TGGDECHMAFHFPLMPRIFMAVRRESRFPISEILAQTPPIPQLAQWGIFL
RNHDELTLEMVTDDERDYMYAEYAKDPRMKANVGIRRRLAPLLDKDRNQI
ELFTALLLSLPGSPILYYGDEIGMGDIIWLGDRDAVRTPMQWTPDRNAGF
STANPGRLYLPPIQDAVYGHQSVNVEAQRDTSTSLLNWTRTMLAIRRRYD
AFALGGFRELGGSNPSVLAYVRELSGDEGHTVLCVNNLSRFPQPIELNLQ
HWDGHAPVELTGSVEFPAIGKLPYLLTLPGHGFYWFQLCEPKEDMS
333992499YP_004525113.1 malto-oligosyltrehalose synthase [Mycobacterium sp. JDM601]MSPTVWPGSSAPLGAGYDGGGTNFALFSEIAEQVELCLIDEDGEQACIPL
EEVDGYVWHAYLPTVSPGQHYGFRVHGPFEPADGHRCDSSKLLLDPYGRA
FAGDFDFGQALFSYDMTAGGEAVSDETLPRVDSLGHTMTSVVINPYFDWA
SDRPPKTPYHETIIYETHVKGMTQTHPDIPEELRGTYAGLAHPVVLDHLK
SLNVTAVELMPVHQFMHDDRLLQLGLRNYWGYNTFGFFAPHSRYAANRTP
GAAVAEFKTMVRTFHEAGIEVILDVVYNHTAEGNHLGPTINFRGIDNAAY
YRLVDEDRSLYMDYTGTGNSLNARNPHALQLIMDSLRYWVTEMHVDGFRF
DLASTLAREFYDVDRLSAFFDLIQQDPVVSQVKLIAEPWDVGEGGYQVGN
FPGLWTEWNGKYRDTVRDFWRGEPETLGEFASRLTGSSDLYEATGRRPGA
SINFVVAHDGFTLHDLVSYNEKHNEANGDDNTDGESHNRSWNCGVEGPTD
DPDIAALRARQMRNIMATLMLSQGTPMIAHGDEIGRTQHGNNNAYCQDSE
LAWMDWSLVQTNADLLDFTRRVTQLRKDHPVFRRRRFFEGLPARHGDEVG
DIAWFTPAGQEMNQDDWDSGFDKCIMVFLNGEAIREPDVRGQRIVDDSFL
LCFNAHQDEVEFAVPGGDYAQEWSVELDTAEPAATDERVVPATAALPVAG
RSLLVLRKVR
333992497YP_004525111.1 malto-oligosyltrehalose trehalohydrolase [Mycobacterium sp. JDM601]MTDFAVWAPAPAAVALDVDGVSYPMTRADGGWWRTTVEAAGDARYGYLLD
DDPAVLPDPRSARQPDGVHARSALWDETGPAWTDDDWAGKPVEGAVIYEL
HIGAFTPAGTFDSAIAKLDHLVDLGVDFVELMPVNAFSGAHGWGYDGVLW
YAVHEPYGGPDGLARFVDACHGRGLGVLIDAVFNHLGPSGNYLPRFGPYL
SQARNPWGNAINIDGADSDEVRRYIIDCALRWMRVFHADGLRLDAVHALV
DTTAIHLLEELAAETDTLAAQLGRPLSLIAESDRNDPRTITRREDGGYGI
TAQWDDDIHHAIHTAVSGERQGYYADFGSLATLAATLRSGFFHAATYSSF
RRRRHGRPLPTSQIPATRLLAYTCTHDQVGNRALGDRPSQNLTAGQLAIK
AALVLLSPYTAMLFMGEEWGALTPFQFFTSHEDPQVARATAEGRKAEFAE
HGWDADEIPDPQDPDTFRRSKLDWDEAGGHGHRQLLGVYRALIGLRAEAD
LADPWLTHLTVDYDEDDRWIAMRRGRLALLCNLGEATVGVPVSGEPVLAW
GSPSYGDQTTRLPGHAFAVLRT
333992495YP_004525109.1 flavodoxin reductase Hmp [Mycobacterium sp. JDM601]MTETIPDEPLGSHVLELQITEVVAETEDACSLVFGVPDGPDDPEIPAERL
KYSPGQFLTLRIPSERTGSVARCYSLCSSPFTDDALTVTVKRTSDGYGSN
WLCDHARPGMRVHVLAPSGTFVPKSLDTDFLLLAAGSGITPMMAICKSAL
SQGSGKVVLVYANRDERSVIFGTALRELAAKYPDRLTVVHWLESVQGLPS
SATLAQLIAPYTDRQAFICGPGPFMQASRDALDALQVPAEQVHLEVFKSL
ESDPFAAVKITAAPEGSADTAPATVTVELDGQTQTLEWPRHVKLLDLLLD
KGLDAPFSCREGHCGACACVLKKGEVAMEVNDVLEPQDLAEGLILACQAH
PETDSVEVTYDE
333992493YP_004525107.1 biphenyl-23-diol 12-dioxygenase BphC [Mycobacterium sp. JDM601]MSIRSLGYLRIQATDMAAWREFGLKVLGMVEGDGPTEGALYLRMDDFPAR
LVVVPGDTDRLLSSGWECANAAGLQEIRQRLEAEGTPYKEGTAAELAERS
VVEMITFDDPSGNTLEAFHGVALQHRRVVSPYGHRFVTEEQGLGHVVLST
KDDVEALHFYRDVLGFRLRDSMRLPPQMVGRPADGDPAWLRFFGCNPRHH
SLAFLPMPTPTGIVHLMVEVGEADDVGLCLDRAYRRKVPMAATLGRHVND
KMLSFYMKSPSGFQIEFGCEGLEVDDDDWVARESTAVSLWGHDFTVGIES
333992491YP_004525105.1 transcriptional regulator [Mycobacterium sp. JDM601]MLSGTTIGDVWDARLTIEPPAVRRLAETATKSTIKELDAELESIRSVIDD
PREFGKAGVRFHVRLVELSGNHTLAAVIGMLSVIIERELAKSLVEIGVDS
DEVRRANRRALRGYDKVVELIRERDGEAAEAAWREHMNSARRYVAKTQKQ
DRVIDLLY
333992489YP_004525103.1 hypothetical protein JDM601_3849 [Mycobacterium sp. JDM601]MSVSLVKQRRGDFNHQAVISAVEINFQDMLPTFRYRHLIQDGSYLYGGFA
DDEGRRYTVLRKVSGELSAGLVLNASDGTNLAPHPRAAETMRGGTLRYQA
DDNGFHIRPSSVKGSLGEPFSLDMSRDVTVWNEGDVMQIEGRIVGDCGLQ
WYDPCRDGGDLYVSHVLRASGTLLGRHVEGFFAVDQQHLLPGTVWRQTPY
FQRLEVAWFTMGVEYDDGTIEVGQLCHGGDDWGFAIMANQDGPFKLTRDI
TGKPSFGDDEFPTRVDYTIDGQDWAWQAHPDGVMPGYAADPHYRPADGWC
TRANEKRSVVASFGWIDAFNDGRC
333992487YP_004525101.1 lipid-transfer protein [Mycobacterium sp. JDM601]MEAVLEALTDAGLDRSDIDGLSTWPGSSGPAPGFTGAGVWDVKDALGLEL
EWFSAGSETGGQLGAIINAVAAVRAGLARHVLCFRTVWESTAQTAGRRAS
IIGSGAGRVEGSHQWMVPFGAVSATNWAALLATRHFHEYGTTREQVAGLA
TTLRANAELNPKAVLRDPMGIDDYLNARMISEPLCLFDCDIPVDGSTAVI
VSAADAVTGLGSRPVVIEAMGSALHGRPYWDQYQDLTSMAAHDAAKALWR
NTCLTPADVDIGQLYDGFTILTLIWLEALGLCGKGESGEFVRGGMRIARS
GALPLNTGGGQLSAGRLHGFGHLHEACVQLRGGAGDRQVAVAPEVAVVAA
GGGYLAGALLLTTCR
333992485YP_004525099.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MSKTSVGIYSTQPAELKSDNSAELQCQIDQLPAPEHVEHPNGWATVETYT
IVYGRGGKKTGIVIGRLEDGGGRFLAQVAPGDEDLMSLLECADNPIGSRV
YVSAFGYGNRLTRSDEVAAQLFPKRAPALRDEYEFVQVRRDGHLLEVSIN
RPDVRNCLHPPAHEELDSIFDAFFADRDLWVAIITGEGAKAFCAGNDLIY
SASGKPMYVPLSGFGGLTGRRDMHKPVIAAVNGFAMGGGFEIALACHLVV
ADEAAKFALSEVKVGLFAGAGGLVRLPRAIPPKLANELILTGRRIGAEEA
RELGVVNRIAPEGQALVAARELAAEILDGSPTSVRLSLKVMAQTQGIPDT
VDAVTAPNDVIDELMTSADAIEGMTAFAMKRPAEWKNR
333992483YP_004525097.1 acyl-CoA transferase [Mycobacterium sp. JDM601]MIDFTDGPAGFAGRFLADLGADVVLVEPPEGADSRWAQPQHNGHGLGFAT
AHANKRGVVIDVDTDAGRSQLLTLTNSADIFLESQRVGRLTELGVGQQVM
RQRNPNLTVVSVSDFGQTGPYRDYKSSEAVFVAMSSLLTRSGAPGREPLL
PPGRLATQTAAVDVAYAALLAYFRVQRGADGDYLDVSLFDLVVQDLDPGF
GMAGTATMGQPMINMPPGRPDVRMMYPILPCADGHVRMFVASAKQWRALF
TWMGEPEELSDPALENLLGRFMNWANKIQPALVEFFADKTRAEIVSRGSE
LGIAVGPLNTAEEILTSDHVRERNSFVGAEIAPGVQATIPNGYLEFDGVR
AGFRHRAPELGEHTAEVMAEVSEREPAVHQQVPARPLTGVRVLDLGVIVV
GAETGRALADQGAEVIKVENRAFIDGARQADAPDKVSYSFSLGNRGKRSF
GLNLRSDAGKELFGKLVADSDVVLTNFKPGTLESLGLGYDKLKAINPRII
VVESSALGHTGSWSKRMGYGPLVRATVGLTALWRHPDAVDGFGDDQTVYP
DHAAGRVGTAAVIAALIERERTGVGRRINLAQMETVFSQLATEYVRESLQ
PGTLVAKGNACEFDAPSGVYSCVGEDSYCAVTVDGDEDWANLANAIGRSD
LADNPAYATATGRVAHRTILDAGVQEWIAALTPREAQERLQAAGVAAGAA
AHVKDLLTNPQVVARGRLGELAQPGYDGPLEAFLGPALFANIPEPELCPA
PAMAADTRELAGKLLGLSDTEIDELIGAGVLEAPAEAT
333992481YP_004525095.1 lysophospholipase [Mycobacterium sp. JDM601]MTQPLPDTETWRFADKQLEIIRGGPEDASVPILLVHGVCHGAWCWQRYIR
IFAERGHHVIALSLRGHGASSGGDRLHRFGLDDYVDDVADVLGAVGRRAV
LVGHSMGGAIVQRYLATRSPAVRAAVLFASATAGGLGGRRFIDVIRGIGP
TAMINALRFVSGRGGTADQANNTPFFSGRLSAADAHAHAERLGPESLRAV
CDLLRRGFSVPQELPPMLVIGSRDDALFGARSQRITAQTYGVREMLLDGL
CHDMMLDPHWRTPAEHILEFIAALD
333992479YP_004525093.1 long-chain fatty-acid CoA ligase [Mycobacterium sp. JDM601]MTSISEALGRLWRADDDARLLQQHGDWVAWGRVRRLAEQIDEQLTAVGCG
TGGRVAVVLGNRTESVAALIAIMRGERTLVTISPLQPVERLSRDLAASGV
AFVLAPQAIFGDSAFTAALPELGAAAWSVESDAVQQRTALSAAQIATAPG
VAVEMLTSGTTGAPKRIPLSRTQLESSLASALQHNDKSDGSERAPLSGTV
GFVVLPIVHIGGLWGLLQSLVTARPFVLLERFTLPAWRAAVVEHRPGMVS
LPPPAIRAVLDSDMSTDELSSVRAVTAGAAAVEPAMVDEFYERFGIPVLA
VYGATEFSGAVAGWTKKDFDVRWVEKKGSVGRAFPGVRLQVVDGEGNLLP
AGETGRLRVSSPQAGGSPDSWVTTSDLAHLDADGYLYIDGRADDVIVRGG
FKVAPDAVVRALRAHPAVLDAAVAGLPDERLGHIPFAAVELRPGVSIDPD
ELREHCRASLTPYEVPAQVHVIDELPRGAALKVDRQRLIALLEANR
333992477YP_004525091.1 UDP-glucose 4-epimerase GalE4 [Mycobacterium sp. JDM601]MSRRLVASGHQVTATARRAPAYPISGIDFVAADIQDAASVRKAMAGHDAV
VHLAWVVAPLKSESDTAAVNLGGTQNVLDAMNSTGCSRLVFSSSVLAYGA
VPGHPPLLREDDERRPESAHFYAAHKKAAEDMILAAAPESVLVRSGIIAG
RDVDNLIFRFFSGPALPVPDPQRAQQFVHTDDVARFTADAVSAEGSGPVN
VAGEGSLTMREIADVMGQTVLPVPETALRKGIAAAWKFQLAELAPAELGA
LLYMPVVDTTRLREEWGFSCAWSSRDALFDMARAAHGLKTFGKKTVTLPW
RVAMHSDPRRSRLSAITLRRTYAGEVDRAIADLTDTLSRHPGADPYRRAA
HQALVSDLIDYLELLADVGQLQGYSPTVRICATEAAQQARATL
333992475YP_004525089.1 hypothetical protein JDM601_3834 [Mycobacterium sp. JDM601]MSALLTATVSLRREHPHVARYLAVIRQDIERHPELAELGSYDALFDEFWR
ATANAQSELGRAVALRAVIEGLLAVGGAGLGLDEVAAGAVVLRTVFDTGL
GSQS
333992473YP_004525087.1 hypothetical protein JDM601_3833 [Mycobacterium sp. JDM601]MTQQQRYTGGHYGFQAVGSFIEPQADAHWRDIARLPMDMQYFYGSARSEN
GDYWWPIRGFYADKARFLHLSESKNGSDFTYATDENNSYGGPVEHRRRDD
RWEVVTPEGDVLMAADDSRMEWNDGTELSMTGELVGPGIQFLAPDDDDAF
AYTSRLFKTTGTIKGIPVTGLVFHDTMHAMAGKHFLTGPLITKLEAAWVA
FATEFEDGNIHTGHLIHGTEDFNLMIIHRTDGPSLIAREIVVEAELDNPE
TMSENAYPERVAYTGGGQTWVWEANGGPRCPVRKDLPEGHRWRQGWVHHI
DETRKPKTTEALMETYNGRLVETGALRQKVSS
333992471YP_004525085.1 branched-chain amino acid ABC transporter substrate-binding proteinMATVYHGRPIEPYRLGVLIDLPEHPGLSDCWPDAVRLACEEAKARGLLER
DVEVVVREVYAQPWSSAHGLIKAYRELVEDERVLGVVGPFTSDNCLALLP
EIERLQVPTATICGSIRFAGDYAYAFANGGLADEPGVMAAWLRANGHRRV
AVLRERTQIGEEYSEFFRYELQTHGLTITAEPPVYPATSVHELVEALNIC
RDSKPDALVYLGLGGVNQWVRPALERIEWDPPRIQTTAFVSATYSEERAQ
RLEGWVGVDQYDERNEVFVQMRRRFAKRFGYDYATSGLSTGYDIGHAFAL
ALGRMRFATPTALRDAMDTLRRIPACTGGPGTIITLGPRDHRAYKGADFL
ILRRAHNGTTTFEGVAPVVPWRQPS
333992469YP_004525083.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MAASSLAITDEHVELGESIVGQLRRSKALAITRATADGTDARLREIWSAA
AELGWLGLAVDEPFGGSGFGLSELTIVVEVMGHELCPGPFLPTVALSAAL
NRCGCADAQKAYLPALATGASVGAIGVNSDVELSGDGLATGRSRAVLGGP
DADVIALMTGEDIIVVDTSAPGVAVTTATAPLDSSRAIGDVTLTDVAIAE
DNLIRGGARQFRTVWRILLAAEAVGLARAALSAATEYVKVREQFGRPIGT
FQAVKHHLADMLVDTEMTTAAVWDAARADDIDGAWYGAAVAAWHAVRTAV
STTEKNIQLHGGIGFTWEHDAHLYLRRAKAISALLANGDDALADIVSAHR
SGRARGPSFTLPAEADRYRTDARAAANAIRALPQDKQRDHLVDSGYFVPH
WPKPWGRAADPTEQLVIDEEFVDIDFPDMGITGWVTLTIVQAGNDEQRAR
WVEPVLRGHEFWCQLFSEPNAGSDAAAVRTAAVKVEGGWRVTGQKVWTSS
AQRCQWGIATVRTDVNGPKHAGVTMMAIDMRAPGVDIRPLRELTGEAQFN
EVFLDDVFVPETDVIGEVGQGWRVARATLGNERVSISGGSGSISLTTVDV
AALLDAAAGPQRESMFRRAGEVFAESYTLRPLNIRLAARAVVGGGVGAEA
NVTKLLKAESSQHLTELASQLAGAALITGDAPEVARDYLFARCLTIAGGT
SEIMRNTIAERILGLPRDPLAK
333992467YP_004525081.1 hypothetical protein JDM601_3827 [Mycobacterium sp. JDM601]MIEALGGVIMVHALATPPQLTAAGAPDADTTAQITVFVQQILHGRVTAQP
SR
333992465YP_004525079.1 hypothetical protein JDM601_3825 [Mycobacterium sp. JDM601]MSAPTIESEQSTDIGYVFEVPDRPNGPAVRRLLRRSGALLGAVGTVATLT
AWRSKRPRVRAIALGLLAPGGGQLYTRSPLRFVATVAGFFASLVAWFGSG
NIIAPVLVWLTAATNAGSHAAGGRRTWNGARRVIPTAVAGAAAAGIVARR
RAFHAAQARGRTRAEYLTTAPRLDPQPKDAASEELSPTDLAVLRSLLDRA
LQPLENFDGFDRIDQFQTSAMRYQCNFMQYALATAQLHATPSFHGYLSAA
QRNLIDKLTLPAVWRYWAFEQTWGNLSLDWDPMKRDNIMLSGYLGMMLGA
YESNTGDDRYRRSGALPFRLGKRDWPYTHDMVSAAVHDNMQRSGMTLFPC
EPNWIYSACNMPAISSLMMSDRLHGTRYIESVGEDFRRRLHGEFITPDGR
ITAIRSSRLGVTIPMLTSTMADCGLASMLHAFDPELAQRCWTIARREFID
TTGPEPVIVLRGWDAIDTGNYRKTTLGAVAPVMWAAAEMGDTDLVAQLTT
TLERHAQPTETGGARWYAELSTNMNAMAALARFNPPGGQRALISAGPGTQ
ILTGPVLDDVVYPEVLVASARTDGADLRLVLRPGAGAARVSIGVRHLHPG
GRYRVNGAVDSEVTADNQGRSHLEVDLIDRTEVSLTPAP
333992463YP_004525077.1 hypothetical protein JDM601_3823 [Mycobacterium sp. JDM601]MTATAEYATTGPDGTRLSPGLWLTAVVELGVAVAVGAVLLRGNADTAVLH
HPQMPDVHHGPVQPHWTAGFFVSAAVAAALMLGWTIVRRRALALGAAGGL
IAVVAAEPVRTLALQSHLIAMVILEVVLVAAPLLIVSGVRGRTDQRTRRS
SAWMAGVIAAVLANSAFLIVLHVPAIHGRAAALTAVPGWLIMAAVVTGVG
YWSAILLTTGRAPLALRRAALTIGQEVAAILGLAALIVPATHTHQVNPLG
LSAATDQRLGGALMLITCAAVTLPLIKHLAK
333992461YP_004525075.1 hypothetical protein JDM601_3821 [Mycobacterium sp. JDM601]MACCLLIAALFTRVNEWLHRHGLVGTNRTVLFPTASSPIPAAQGGPR
333992459YP_004525073.1 3-oxoacyl-ACP reductase [Mycobacterium sp. JDM601]MGGAGGLGAATARRLAAAGMNVVIADLAEESGTALAVELGGAAEFVRTDV
TSEDSVRAAIAKAADKGLLRTAVIVHGGPVAASRIVNKAGACYPVETFRR
TVEIYLTGTFTVLSRAAEQMATNEPLESGQRGVIVSTASIAGYEGQVGQS
DYSAAKGGVIGMTLTAARDLAPLGVRVMTIAPGTFFTPTYKMEEAEAQAM
WGPAVPNPKRMGHADEYARLVLSIAENDNLNGTVVRLDGAQRF
333992457YP_004525071.1 oxidoreductase [Mycobacterium sp. JDM601]MRLVGKVAIVTGAAGGVPGEVMGFGGATAWLFAREGAKVVLTDLSDECGE
ATA
333992455YP_004525069.1 pyruvate phosphate dikinase PpdK [Mycobacterium sp. JDM601]MLDTVLDLGIDDAVESALAQLHTPEFALDTRKRFCHMYRRIVLNDEHGDV
PIDPFAQLGGAIGAVFASWNSARAIAYRKHHGLSNLGGTAVVVQAMVFGN
MDAQSGTGVLFSRNPMTGANEPFGEWLPRGQGEDVVSGSFDVEPVAALRE
EQPAVFEQLMDSATKLERIATDVQDIEYTVEQGKLWLLQTRVAKRSAQAS
VRLALSLRDEGLIDDSETLRRVRPAEIETLLQPSLQPETRLAAPLLAKGL
PACPGVVSGTAYSDVDDAIDATDEGQDVILVRVATSPDDIHGMMAARGIV
TEVGGATSHAAVVSRELHRPAIVGCGAGLAESLAGKQITIDGTEGEVREG
ILQLTAWSEADSTDLAKLSAIVAAHSPLRAHRDGDHSVLEHNTEAGVRAA
LDAGLSDVISEHPLITMLIAVHLQHNAKATEN
333992453YP_004525067.1 oxidoreductase [Mycobacterium sp. JDM601]MGLPAPPQLGTSMLPPDTYRGKVVMVTGGGTGLGKAMATEFARLGAAVAI
ASRNTEHRENGVRALEELGAQAIGVALDVRDDAAIAMTFDEIEAQLGSVD
VLVNNAAGNFPSQAVKMSANAWRSVVDIVLNGTFLCSTEFARRAIEHQVP
GAILNIGATYSWTGGPGTAHSAAAKAGVTNLTQSLAVEWAPKGIRVNCLA
PGLFPHNDLPPVLLARQNPQADGQRIPAGRVGRPHELGWAATYLCSPFAS
YLTGHTLVLDGANWLRRGLSMPDFVPIDEQFP
333992451YP_004525065.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MDFLPDADQNSLVEATREYIDSRFPLIDPPTRLDDARWKEITELGWLSLA
ITENSGGAGATLLDEVFVFREIGRGLVRGPILSTLAAARLAVWTGHGDLA
EELVSGRSRVARAVALPGTDELLLLDADDAPLTLFLDADRVVLAQTAQQL
NIRPGLEDGTSVCRTGHNVLETGEIVCDDAATVSRIRRTLRILTSAQLTG
IAGATRDLATVFAKERIQFGKPIGAFQAIKHKCADMATAALAAENVTFFA
ALTEDSDYHALAAATNTRRAAFANARANVQIHGAMGFTVEDSAHRFVKRT
HTLCTTEGFENSAARLGGLPSIDSSEES
333992449YP_004525063.1 hypothetical protein JDM601_3809 [Mycobacterium sp. JDM601]MVLMLAGTSISDVWDARLTIEPAAVRRLAENATDEQLGLLDRELDGSRDT
APLQFLGSAQREDQILDLLY
333992447YP_004525061.1 hypothetical protein JDM601_3807 [Mycobacterium sp. JDM601]MTGASGDFGACIIPEILARDHEVVGLSRRPHSLPSPQYRHVSADIRDVDA
VEAALDDVDAVVHLAWTTHPMHDVEATRAIDVGGTHAVVTAMERAGVSRL
VTASSVMSYGARPENPPLLTEGDPLRPSRKHIYSMHKAEAEALITASSLN
AVMVRATNIMGRTTTGVTQEGFATPAIVAMKGGRNRFQFVHPDDLSRFFV
DALDHPEWSGPVNLAAPDTITMREVAAILNKRYLEVSPDRAEALLGFLWN
RGWFSLDPGAVEAFLNFPLVDTRRLTEEFGFHCAWSSADCVEDFGRTNRG
HVFLGARKVTVPWRWPWAWAPEIGDREGNRPAAPEGVAGEFDTPVDPNWQ
LFTAANTSEAFPGPMTPLSLELGLNSLRAGGAQAADVLRADGDLRRVLRE
EQTGAFGHGIYANLSVVFALSTTLPGSGFDAAAWQKMLFGDGGGLPVPEF
DKPSALTMLRRVPGIVIQLTGFAKEIHDIDRRARHSARDAAFYAKLSDAE
LQAQLSRSFDEVCHAWGTAAQASAFVVPVMDLIQKRAGSDFATRIRSGTE
DLASAGIACGAYRLAEEARKDDVVTRLLRELPAEPVLEELREKRPQFVKI
LDTVIAEYGHRGPRETELSNPVFADAPHRLLEVATKLLDSSERVVEEVPP
MSRRLRLLAAVGSLFQRLRETVRDATIRRTHQYRLIAREIGRRLAARGII
DHPDDVFYLVRDEIKNPPADARAVVARRREERRRLEVRRPPLNFAGEWQP
IDSAVTKLQPGESLQGVGVSAGLAKGRVRVLTVETMDDLEPGEVLVAAFT
DTGWTPFFAYAAAVVIDTGGEMSHAAVVAREFGIPCIVGTSHGSVALKSG
HIIEVDGSSGQVTRVE
333992445YP_004525059.1 hypothetical protein JDM601_3805 [Mycobacterium sp. JDM601]MATHYHGRPIEPYRLGVLIDLPDHPGLSDAWPDAIQLACDEVHARGLLER
PVELVVREVYAQPWASAHGLIRAYRELVEEHDVMGVIGPMTSDNCLAVLP
EVERLGVPTGTICGSTKYVGDYAYAFANGGLADEPALIAAWLKANGHRRI
AVLRERTQIGEEFAQFFRYDLQPNGLVVTAEPPVYPATSVAELVDALEVC
RDSKPDALVYLGLGGINQWVRPALEQIGWDPPRIQTTAFVSATYSIERAQ
RLEGWVGVDQYDERNEVFATVLERFTARYGYTPANSGMSTAYDLGHAFAL
ALGRMRFATPQALRDALDTLRRVPACTGGPGTIITLGPNDRRAYKGADFL
ILRRAANGTTTFESVAPVTPWEQPS
333992443YP_004525057.1 hypothetical protein JDM601_3803 [Mycobacterium sp. JDM601]MKSPVNRKLGSYGYAPVGAIIDTDPAQFWGEVNGIPMGMQYFYGSVRSAA
GDYWWPIRGFYPDKARYLHLAESKIGEDFTYSKDHNNSYSGPVEHGQRDG
KWGVWRPDGTPMTLTWDDKMEWHDDDHVSLIGDLVGEGVQFFSPDQEVPS
SYASRLFKVRGTVKGTEVSGLVFHDSIHIANGVDYIASPAIAKHEAAWVG
FATEFEDGHVHAGHLVHGTDEFNIMVIHRTDGPPLIARDLDVSVELEGEP
FAKTTFPTKVTYRGGGQTWIWEANEGGRCPVRDDLGDEHRWRQGWVHQEG
ETRKPMTTEALMETYNARLLTTGALKKATA
333992441YP_004525055.1 hypothetical protein JDM601_3801 [Mycobacterium sp. JDM601]MLAGHRFQDVRLQDWSAVAATDELLDRFAGEGQSPLVDYDALLDQVDED
333992439YP_004525053.1 hypothetical protein JDM601_3799 [Mycobacterium sp. JDM601]MSDGQFATTDYAFDDQQTVRSTWTIQSACTKDRVCGGQVTSDAGWSALAR
SVDGRIWKVERDLPAWQTCPDGSTSPGHQTFTFYPSDVNGVTKIGSPYLE
GRDKTTGVSGACGKFKFLTIVMPFRLDRIG
333992437YP_004525051.1 hypothetical protein JDM601_3797 [Mycobacterium sp. JDM601]MPATHKVSKSNKVKPATKPRRSLTEPVKAFAQRPVQSVETVGRAVRMLFD
VIRFSVSDAISGRLPLGELITQAWTLYKVTALPAIMMAVPIGALVAVQVS
GLINQVGANTLVGAASGVGIVRQGAPITAGLLMGGAAASAIASDLGARAI
REELDALRVIGVNPTRHLVVPRFLALIVLAPVLCGIIIASAVTASFILSL
AVSDVAPGTYWMSFGSFAKMVDVWFALGKAVVFAAIVGIVSSLRGVEAKG
GPRGVADAVNAAVVLNVVGIFMANLAITQIETMFFPMQVA
333992435YP_004525049.1 hypothetical protein JDM601_3795 [Mycobacterium sp. JDM601]MTILHASEQQEARILGRVGMAATAAAVILALVYVAVRPAGRDAAETVSLT
IQAPYVGQGVQTETPVIMHGVKIGEVTAIRSVPGGGVQMEATLDSGPTRG
LTNTMKVDYRAANYFGITGINLTPGEGGQPLRSGMQLNITPEGNFSLQAL
LYRLGALTNGVFDERLIRVFERATRYVDGLNPLLETALIVGSALAKVQTV
STAQLLENTAGVSSALPSVIDAATSSADVLINSYYGMGHTPETSQRIKEK
SKYYKIMDDKHKQRYDANERFWLANRDNDVFFDGQIVPQMDKARTDLFGR
IGQLESSHVDDLFPLVESIRGLVDTVPEIFSPEDFAETVMDLRGRFERIY
GSSPDQHSLQVRIVLDRLPGIAAPLGYAPGEPEPAQPQVPAASDAQDGEP
LPIEQQPAQAGQPS
333992433YP_004525047.1 MCE-family protein Mce6C [Mycobacterium sp. JDM601]MQEMSSRRAQRFWGTAALALITVIGVVVAMLYIKPPGETIFSFYTDDAAS
LRPGDTVRVAGVVVGTVKDLALEADQIRVRASVNEKAFVGDQSQIQVRML
TVVGGYYVTVIPMGRKPLGSTVIPKERVTMPYNLMQTLADSTKITEDVST
RPIKESIDQFQTALTGTNTQTVSAILDAGNSVVDTLTRQRGQITKILDLS
DEYIDRLAQYSGKLEEYLRRISILEQTLILYGRAFGDGLTRLGGVGWILM
PAIDDYFAHRDDFLDRTRNILGDFRTIEVRHGAAVRWLQRIHDRMEVALD
KQNNFTRPELLATDICIPVHGSPC
333992431YP_004525045.1 hypothetical protein JDM601_3791 [Mycobacterium sp. JDM601]MAAVLSGLVLPLSSCAETNILSVDSLPVPGTNATGGYEIVLEFANVLNLP
DRAKVVMDGTRVGSVRDIALEASGVAVALRIDDGVVVPSDIHAVLQQATV
LGDTYVALERNTDAASSGHQLRPGERVPQSQTTSPPQLEDTMASMANFVG
SGSIQRAQDTVIKINRITPPRPEIRAMAARVATDLDDLSDNIDDVDLWLD
GFAKSAALMAENTSNFETWFTPLGVKSFAHVFVLTHFMAPLMPTIGSIYY
NGYWLVPTLASAVAAVSAMQKGKWVFEEEVHKWERLVNDQILPNEKYPAI
NITSVVDTDGRDLTNNLQDVLRMIGATQ
333992429YP_004525043.1 hypothetical protein JDM601_3789 [Mycobacterium sp. JDM601]MGAISEQNGAADQNDTTTSEETATAEPAGSSVTEPKTGGGRQVSVSVSVR
TLVAWVLTVAAVAAIGILTWLYLGEKAKVTASEQMIANDHHAEQIALDYA
VRAARIDFKDLESWKENLVANTTPELRDKLTDAGKSMEQLLVPLQWHSTA
TPLVAKVRSTDNGVYVVDTFVGVNTKTMQAPEGLQSTATYSVTIDSNQDW
QISEVGGIGSVVGQK
333992427YP_004525041.1 hypothetical protein JDM601_3787 [Mycobacterium sp. JDM601]MNMRMVAPLRAFGVTAAVAAVAIVGVSAIGSADAPALGGPAVDACRDLGG
NIQAGTICHVTADTDAYSIDMRFGVDYPDGRAVADYVHQLHRTFVAAAEA
PGAKNLPYQMFVNVEEFKSGQPLRVVPSLGQRFPGAQAYGEPWQGTESMA
LKIFTRLDVDSVVPRSRYKTFTFDHNKNRALSFGDLFAPDSKPLDAIYPY
AAADVERQQLARHYKLPPKDGLDPAFYQNFAITDDALIIFTDTGRLVPDE
SGDIVITIPRNGIPPLQI
333992425YP_004525039.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MQIRQYTDSQKPALVLYPSGATVSFAELEARANRLAHHFRLAGLREGDVI
AIVMNNNEHIHAVMWAARRIGLYYAVINTHLTAAEAAYIVSNSGAAAVVG
ARATADLCRGLDEQLGSRMPTLRMIADAEIQGWQRYPECVADHPELPVPD
EREGDLLQYSSGTTGRPKGIVRQLSGLTPADAPMLLTPMFDRLGIDRDSV
YLNPAPVYHTAPAYWSMSAQAVGATTVLLEMFDARGALAAIEQYRVTHGQ
FVPAMFVRMLKLHERVRSSYDLSSLRRVVHAAAPCPVGIKQQMIDWWGPI
LDEFYASSEGAGSTYITAEEWLARPGSVGRPLVGVAHIVGDDGRELRPGE
AGEIYFSGGMSFSYLNDEAKTAASRNRDGWATVGDMGYLDEEGYLFLTDR
RHHMIISGGVNIYPQEAENMLITHPKVLDAAVFGIPDAEMGQSVQAAVQT
VDPADATAEVAAELIAWLRDRLAHYKCPRSLAFEAQLPRSDTGKLYKREL
IEKYSALIASE
333992423YP_004525037.1 hypothetical protein JDM601_3783 [Mycobacterium sp. JDM601]MIELKVLQAVRLKGRVQPADVATTTGEAPGTIADAITAATQAGYLVESKT
IRLSIEGRSRLSELLADERAGTDGAAIAAAYDDFRNVNAEFKALVSDWQL
KDGEPNSHEDKDYDGAILSRLAAVHQQVRPIIGRIAVEVPRLSGYSDKLE
AALAKVQAGDLPWLTRPIMDSYHTVWFELHEELILAAGLTREAEAQAGHA
N
333992421YP_004525035.1 hypothetical protein JDM601_3781 [Mycobacterium sp. JDM601]MKSADSLDELRAGGHPMVPVGSAHADGLTPHPDWCSGALMGKRYVDSSGA
EVLVTRAGIGTLGVGVTAMTLKAAAPLPASD
333992419YP_004525033.1 HAD family hydrolase [Mycobacterium sp. JDM601]MEVDVSNSGAGVPTLLIDYGGVLTSSVPAAFANVCARFGVDLNGFMAACR
MGHPDGPFAQLELGLDDVEFARVITPILTEHANDPVDGLAWVRELQKTSL
DIDKTMLAAVADLIDNGVPTVLFSNSFGPLERYPWAQLPTFTDTVISSVV
GMRKPDPRIYEIALQRCGRPAHECVFVDDSEANLAPARALGIRSIHHQDP
ATTIAELNAIFG
333992417YP_004525031.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MQHDATAPSPAGLDELDIDLSETDAGFGAEWSSWLDANLPAIHADYATAT
SAADKHAVARKWQARMSEGRWAAIHWPPEFGGRSATARQQLLFYLLSAER
RVPPLAGRIGLNLCGPTLIAHGTPEQQQRFLPPMLDGSEVWCQGFSEPDA
GSDLASLRTRGEVDGDELVISGQKIWTSGAQVADWMFALVRTDPDAPKRE
GISFVLVPMRTAGVDVRPIRQISGDAEFNEVFLDEVRVPVTNVVGRLNDG
WNVTRTTLANERAILFMGQQMALTATLRKAISMAKTPDPFGVRAADDPHL
RNRLAQGWIDVELVRLNGMRNLAKVLTGREPGPEGSMSKLFGQHVEQHLH
ELALDLGGEFAILDRGADDAPNKGKWALGWLRTRASTIGGGTSEIQRNVL
AERILGQPRDPWADA
333992415YP_004525029.1 regulatory protein [Mycobacterium sp. JDM601]MYAAHGKAGFTVDLVAKTAGCSRPAVYARWPTKEALLLAAVRSFDAGLEV
ADEGSARDQLVSVTRQMLEGFSSVHGMATFRIVLDSRDDQVLRREWEKIN
TVRLRSATEVLERGVARGEWRADVASTEFLRSLTGATMLQGIYTHMSFPE
RLTDAGTEARRLVDFLLDGRLLEAD
333992413YP_004525027.1 hypothetical protein JDM601_3773 [Mycobacterium sp. JDM601]MRILVTGASGVFGRVICRDLVRQGADVVALARRTVDIPGVVSISGDIRDA
GAVEGAMQGCERVVHLAFLLAPLRSATGVEDINLGGMRNVLRAMESTGAN
HLVFTSSTLAYGPWPDNPDVIPERHPLRPHPDVLYARHKAQCEELIAQSG
IPSVITRTCVVAGRDMDNYEFRFLAHPLLVAPTGEMRPWQFLHTDDVGRF
HSQAALGDRTGIVNVGPLDTGISIDEIAEVLGKPLIRLPFSVLRSGAGAA
WRADLLELSPADLDGFRYMPTLDTTRMASEWGYTPVYDSRSALADARAGV
RAVTYLGTARIPTPWRTPVPDHQWTRDHLPPQEHRIDPAPAGLRGEFDDY
IDDRYPTLTTANVGEAFGGTLTPMSLLVGRDALRLAGAIQVEVLGMRDAD
VIAAQRTLSIASVGHRLYTNLSVVHAMAAAMPGTNAREVDEHILGIAHVP
EASKERVSMLTSLRSALGFPNAVMRMAGSGRRIAAVDERLSVMNVCADLP
VLNGNALLTLVDSIRELTLDSWAYSTMTNLVASAAQALVRKVAPDLGLDA
MRGGTTGLASASLLAGVRHLVDLARAQPRAARLLRDEPSDDLIKRLDDVD
PMFARAFWKLIAEAGHRGPGETELANSMYGDRPAQLIDVVRMALDVPPVS
AAATPALSGASKRAVGALNAAVRRRERSKDVAMRSTHLLRRALREVGRRQ
VDAGVFAEIGDVFYLTPEEIAAPRLFAERIADRRAERARLSALHLPPMFT
RHWEPLNSVAAECGDVLQGVGASPGVVRGPVRVVATLDEIDEFEPDTILV
VRVTDVGWTPLFGCVAAVVTDVGGLHSHAAIVAREFGVPCVVGTTSATSD
LHDGDLVEVDGTRGTVTRVR
333992411YP_004525025.1 oxidoreductase [Mycobacterium sp. JDM601]MHTTCRICQQKCGLTVTIEGGRIKRIGPDKEHPLSWRDFCVKGRAAGELV
HHPRRITTPMRRCGDTYLPATYGEAYDDIATRLARIVGDGGADSVGCFYG
NPAGFHPSALGGLLRFMMALGSSNLFNWASVDTNAKTVTCGEMYGVTLLP
LIPDVDACDCLLLVGANPAESKMNWASSVPNGWRRILDRVDAGADLLVVD
PYRTPTAARATMHLRVRPGEDWALLLGMVKTIFDERLEDAAACSAESGED
DLRTLAAEVDWGVLTRRSGVAQAVIEDAGRRFGAAETAIALARTGPSQTT
RGTLALWLTEVLGVITGNWDRPGGRYFQRGFAPVELSEYAPEKEPRARLT
GRPAIGGCHPLADLPAEILTPGPGQIRALFVEHGNPVVAGPDGANLDRAL
ADLDLLVCVDMVQRESHRHADWLIPGTHWLERDELVDPLFATFNELPFVQ
FTPMALPPPVTVREEWAFYQELGATLGLAGYVRDQPADFEDRWREAVEGG
NRTTWDEVKANPHGIVLGTREFGYARSMLKTPGQRIRLAPRRFLDEARRQ
AVSHVDVNDGEFPFFLGNRRRLGSMNSHLNDLPSIRRLMDGNGVEIHQDD
AVELGISTGDMVRISSPTANIDLRAVVSANPSPGTVIIEHGWGSRVFDPV
SSQTPDVLGVNRNLLTSARHEDPLSYMSGFNDTRVAVRRVDGASDDLS
333992409YP_004525023.1 transposase ISMyma01_aa2-like protein [Mycobacterium sp. JDM601]MAMLRERFGVSQRRACSVVGIHRSTMRLTPRAITDEEAELRAWLRKFSTD
RPRWGWRRAAVMARKAGWTVNNKRVRRLWREEGLRVPQRRKKKRLTGIGT
AIGAMSPIRPNVIWAMDFQFDTTADGRTLKMLNVIDEFTREALAIHVDRA
INADGVVDVLDRLALMHGAPHYVRFDNGPEFIAHAVNDWCRFNGTGSLFI
DPGSPWQNAWIESFNGRLRDELLNSWRFDSLREAQVIIEDWRIDYNANRP
HSAHRGLSPAEFALQWTTTHQPLAA
333992407YP_004525021.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MAAMRAEMTALESDRQAPTVFHPWLVRQDVIGLGWPQPHGRPATQTERFV
AHEEMDSAGLPTYGLEQAEAVGWMLATFGPDELAAEHLPHILDASWSYAG
GYSEPEAGSDMLALRTKATRDEDGDFVVSGQKMWTSGAHLADWIFTLVRT
DPNGSRHKGLSLLMIDAHAPGVTIQPVRVMGGWRVNACFFDDVTVPVGNL
IGTEGEAWSMMSRALDMERSMSFGGREARLLLTRYLHRIGERCIELDEAK
YRQIGEFIMELQAERLLGQQVVALGDRGESASGEASMSKLHGPAVAQRVA
QWLVDELGPDAYTVDSGDRLAEDAEHFLRAATVLSIIGGTSEIQRNIIAQ
RWLGLPRG
333992405YP_004525019.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MTTTETERVWLEKDHESHVARITISNPEKKNAMAPEDCELMGRLLDDVGD
DDAIKVVILRGEGGVFTTGVDLNRAYGWYSTPGDDRRPSQRRRLTVDRKG
QRMFHEFIGFPKVTIVQLESYALGLGFELALSADLVVASRQARIGMPAAR
FLGPVLGNVALFLHRLGPVVMRDLMLTGRMAPAEEFESMKLFTRFVDESD
VAAETEALAAQVAKMPADGITIAKEAYRLVEASSALALEETTAYLFHSYG
TNLRFEPDEFNFVKERKKSGTSEAFKKRDEHFGSGSTAQ
333992403YP_004525017.1 hypothetical protein JDM601_3763 [Mycobacterium sp. JDM601]MSSAKADRPVRIANCSGFFGDRLAAAAQLLNSGEPIDVLTGDWLAELTMS
ILAKNRGRGRAGYARTFIAQMNQVLGTCLQRGIKVVSNAGGIDPQGCADQ
VRAVAGRLGMPISVAVVDGDDLTDRIDELRSAGELLRHLDTRDPWRGDTG
DVVAANAYLGGHAITAGLAAGADVVITGRVADAAVVTGAAAWWHGWSPDD
VDALAGATVAGHAIECGTQVTGGNLAFFTEVADLTEPGFPIAEIAHNGSS
VITKAANTGGTVSVDSVSAQLLYEIAGPRYPVPDVVARFDSVRLHQLGRD
RVQISTVRGEPAPSHAKALLTFPGGYRNAMTLAITGTGRRAKAELGERAV
WAQIPGGRERFAESLVEVVGASLDSEAPDDQSYLRISVADPDADAVGREF
SSAVVATALGSYPGLYLTTPPGAASEFMVGWPTLIDVARLDPRAQLDGKT
LTVAKPVTVAPLIADTPRTPCATDIADTELVEITIGDYLGARSGDKGGNA
NLGLWVREKRLLPLLDHLTDPVRLPQMFKEFGRHQIRVFPLPNLLAVNIV
VVGLLGNGVAASLREDPQAKSLGERFRAARTSVPAALLPDLTHMEN
333992401YP_004525015.1 acetyl-/propionyl-CoA carboxylase subunit beta AccD [Mycobacterium MAALLAEVDGLHGKVAEGGSAASVQRHRERGKLPVRERLSLLADRHGFIM
ELSPLAGWGTTDPLGGGLVTAVTEIHGRAVMVIANDPTVRGGSLSPTSIA
RTLRAMDIAETNRLPVVTLVESGGADLEKQADIFVPGGEQFRRLTELSAA
GIPTVSVVFGSSTAGGAYLPGMSDYTIFVKDRGYAFLGGPPLVKMAIDED
VTEHELGGADMHARVSGLADYLAADEPDALRQARSVIFRFGLADPVPGGP
APVHDPDELLGIVPEDPKTPFDIREVIGRIVDGSQFDEFKPLYGPNLVTG
WAELSGMPIGVLANNGILFSPESQKGAQFIELCNQIGTPILFIQNITGFM
VGSAAEKGGIIKDGAKLINAVSNSQVPHVTLMVGVSYGAGNYAMAGRAYR
PRLVLTWPTHRIAVMGGRQLAGVMSIVRKRSAQSRNIEFDHTADETQRAE
DEARIEAESTALYATGRVWDDGIIDPRHSRAALTVAFGISRDTPRPGSRQ
RAGFGIFRF
333992399YP_004525013.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MERQPPSLDAFRQQAKAFLDVHAEHRPDGFPDAMYAQFRYLRDPERFRAD
CVAWQRLLFDNGFAGLTWPREVGGQDLPSAYALAWADLEAEYEIPRGLFG
VTLEMVGPTLLAVGNDEQKKHCEAILRGDEVWCQLFSEPAAGSDLAAVAT
KAVSTETGWRINGQKVWTSEARHAQYGYLIARSDPTQSRHKGLTAFVVDM
STPGIDVRPLKQMTGGASFSEVFFDDVDLPADAALGEVGAGWAVAMTTLG
FERFSSFGRSLGRLVRQAGELGWDDSVARDAFIDAVIDQRALAAFEAGMH
RRLVTGQPPGPEAALAKLATGKVASQISDAVAKRLGNDLSKPDPTLDDWR
LVVLSAPAFHIAGGTDEIVKTMIAERVLGLPKG
333992397YP_004525011.1 FadR family transcriptional regulator [Mycobacterium sp. JDM601]MVADNIRRKIILGEFHDGDFLPNEAQLLAQYGVSRPVLREAIRILQSESL
LTIRRGSKGGARVNAPRPEPVARQAGGLLQYGRTTVFDVFRARSIIEPPA
VRLLAENATPSTVQRLKEALQLESESITDARRWGKIHADFHTLVVELSGS
NTLALFAHIMSGITTAHTQAVWQHATDDAQKRTDSELAHRVHRKLVRLVE
EGKAADAEALWRRHLEETTEKMLSNQGQRDLLDLID
333992395YP_004525009.1 hypothetical protein JDM601_3755 [Mycobacterium sp. JDM601]MIDELTILRLVAIKGRVTADAIADSLGADAAQVQAQLEDHTERGLFKNTP
MGYRITPVGRERCTELVVAECQAADAAAVAEIYEVFTEHNTELKAIITDW
QTRGPDQPNDHTDAAYDAEVLRRLLGLHRQVMPLVDRICSAATRLTHYRA
RLAKAADAVAAGNNNYVSKPILDSYHTVWFELHEDLIGLAGRTRAGEAEA
GRGA
333992393YP_004525007.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MGRVRGKTALITGAARGQGRHHAIRLAEEGADVILIDVCADIPGVGYPMA
TPQDLDETVRLVEKFERRAVPVIVDVRDRYSMDQAVQTAVQTLGGLDVVV
ANAGICPIGPDYPVTAFADAVDIDLVGVLNTIHVALPLISQGGSIIATGS
VAAMLPNAVNNPGNGPGGAGYGLAKQFISDYVVVLARQLAPQGIRVNAVH
PTNCNTDMLHSPPMYRAFRKDLAEPTRADAEEAFPHMQSMPIPYVEPDDI
ANAVVFLASDESRYVTGLQLPVDGGALLKF
333992391YP_004525005.1 long-chain fatty-acid CoA ligase [Mycobacterium sp. JDM601]MDLIETMQRRMNAAGDEPLLCYRGEWRSRSQFAAAAQTIDALLVESGVGR
GDPVGIFMRNRPGLVAALTVVFATERPLIVLNPLTPDGAVGDDVLALRPA
AVLADGEDWARPELVKAVSTCGALGVQVDVPCGAESAATVVTPRTNAPCA
VIDDGVAVLMPTSGTTGPPKRVPLRYNEIEQALNGAQEHYMTGSARSGSV
RGGGVQIISLPSTNISGLWAIVTALNGGGRALLQDKFEPLAWSEAVAEYQ
ARSVSLPPAALRMVLDAGVEPAKLASLKAVWAGAAPTGTDLATRFEETYG
CPVLLSYGATEFTGGITGWSLKDWQQWKDTKRGSVGRAHPGVEISVINPD
TGEGLDAGEHGILQVRSAQASGGNAQWVRTNDLGSVDADGFVWIHGRADD
VINRGGFKIFPAELEDCLEAHPRVREAVVFGVADDRLGEVPVAVVVTAGE
VSVDELIAWTRRRLPGYKVPARIQLTDAIPRNSAMKILRKQVREEFEPST
AATQ
333992389YP_004525003.1 hypothetical protein JDM601_3749 [Mycobacterium sp. JDM601]MPIERGKIREFAAATGATDPAYQTANPPVPPTFMATSMHWEPHDPPLSTL
LGLNLSRVLQGGQEYTFIGALPQAGDCLRAETSVESVTEKRSSRGGAMTV
IVVLTRFTRPDGSVAAEGRATVIERAAS
333992387YP_004525001.1 hypothetical protein JDM601_3747 [Mycobacterium sp. JDM601]MATTVECHHAADERRLHAFWGAMNHCCRCHHPDVAEVDALAEFGSAAA
333992385YP_004524999.1 lipid-transfer protein [Mycobacterium sp. JDM601]MWIVGAAMTKFGRFPDADLVDLGASAARSALADSGTTIHQMQTVAVGNVF
EGITGVGQRIMHQIGQTGAPVYNVSNACATGATALRTALLALRAGEADLA
LAIGCEQLGKRGLLAAGEEPRGSEFSRRGRDGVIVEPEGVIGSALMPSVF
AEAGVAYLARNSEATVEHFYKVAQKNHLNSTLNPLAQYRKEFSLEQIAGG
DVIAYPNTALMCSPTGDGAAAVVLATDAALSKLDPGVRDRAVKVSASVLV
SDPWVEQAEASWDVDTVTRNAARQAYEVAGIGPDELDMVELHDCFATAEL
VHYENLGLCEPGGAASFLDSGGPWRGGKTPVNISGGLLSKGHPLGATGIA
GVFEVVTHLRGEAGDRQIDGANVGLAHVLGLGSACAVHVLERRAG
333992383YP_004524997.1 hypothetical protein JDM601_3743 [Mycobacterium sp. JDM601]MFYALYGAHQVVGPLAFRRQDGRRRGVVSRAVQHLFGLSDALPAGFYLVN
QPVGCLRNRQ
333992381YP_004524995.1 hypothetical protein JDM601_3741 [Mycobacterium sp. JDM601]MSGRILVTGGTGAAGAATVKWLKRMGADVVVLARRAPTVPVAGVEYVAAD
IQDAEGVSRALAGCDAIAHFAWTVSAMQSAEIAEGIDIGGTTNLLRAMAD
HDCRRMVFASSITVYGGHADHPQPFTEDETPRPAASFHYENNKVRAEQMI
LDSGVEAVNVRPTVIVGRSSWSAPANIFRHPVVVTPGRDARMQLVHVDDV
GRFCALAALGGPTGTVNLNADDALTFTEMARIVGRPVINSGTRFAQLLAG
LIGRAENFSSVPDLIDLFLHYPLGDTRKLREEFRFRCAYSSADAVADMTD
WSSSTWTVGTRSVRKPLRLGVPAVHPRHTSGAGGSVTRIVPPEYTGEFDN
VTGDPELPEWSAANLSEAFPGPMTPFSLGLANRILFSGANMLDHLFPMDR
DLIATVSTKQVGTIGHRLYNNMTVMKRLAGAIPGQTPESFELQMNGTPLP
EGYQAPPMSRADLLAGVQAAVKGGPQILGLGREVADMERRAQRLVADRPD
LTAISDELLLSRLELVSDTVVRAWDINLMNTFMVSLPMNLIARRYGERSA
MNVRAGTQNLRSAALLRGVRELADLVARDDGLRRLIADSPREVVLDKLRS
DAPGFATKFDRLVADCGHRGPGETELSNEVYADAPELLLRSVLGSIRGAE
TLAEEVTSGSPMSRALTRVAVSAMERRENGRDVCMKVTYELRLVLREWGR
RLVNRDILDSADDVHYLTLDEIYYPPASSKETVARRREERERLAKLDYPV
HFTQPWAPDDAGLVDDAEMVTGQAVSPGTARGIVRILAHPDDDFEPGEVL
VTNVTDTGWTPFFGCAAAIVTNVGGAMSHAAIVAREFGIPAVVNTMTATR
QLRDGQLVEVDGTAGTVRVINAKVS
333992379YP_004524993.1 hypothetical protein JDM601_3739 [Mycobacterium sp. JDM601]MDFEAVSGYGTVYSATINHQPWLPHLIEPYAVIVVELDEQSGLRFVSRMV
AMPVDQVAVGMRVRVVFEPLGDGLYAPLFTAAEGVPR
333992377YP_004524991.1 hypothetical protein JDM601_3737 [Mycobacterium sp. JDM601]MSTPGEGIDVALVRHGLPLRVEGVTRPDPQLSESGLAQARAVAEVMTLLP
VSVIASSDLARAQQTAAPTAEKLGMAVDIHADLAEFDNGADYYIPIEDMI
AEGDLRLEMWRNSLSEPETARLYAEFRQEAAAAVGRVAQETPSGVAAIFC
HGGVIAACVAKALGDVQAPLVEPHYGSVTRITINHEGQWKLLTYNEIQHV
ERQIEGAP
333992375YP_004524989.1 ferredoxin [Mycobacterium sp. JDM601]MKVSVDSGRCMGHGQCYTWGPDVYQPDDQGYCVVPVAEITGDLAEQAIAG
AEACPESAITISE
333992373YP_004524987.1 NAD-dependent aldehyde dehydrogenase AldA [Mycobacterium sp. JDM601MDHYRDMVARAGVELGRELPQLAGPPVTGQRVVREPWGVVAAITPWNAPH
LLNLWKVGPALATGNTMVLKPAPEAPSCALLLGELAVQAGVPAGALNVIT
GGADVGQAMVADPRVDMVAFTGSSAVGRAIAQSAGATLKHTLLELGGKSA
LLALSDADIPSLVAAVVRFVTLTGQGCGLLTRIVVPDPLHDSVVAALVAA
LQRVRVGPADDPEVLMGPVISAAARERIEATVRQAVADGASIAFGGGRPA
GVPDGGFYLEPTLLTNVTNDMAVAREEIFGPVVVVIRYSGEPDEGVRIVN
DSPYGLVGAVWTADTALGLQLAGRIRAGQVRVNATASSNEAPFGGYKQSG
IGREVGQEGVLEYTTVKYVGWQTASDN
333992371YP_004524985.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MGARVAVVTGAASGIGRVAATRLAADGWAVAAVDLPGAALERAASELGAT
AFPCDVSDAEQVSMAADAVRARVGAIDRLVNAAGIATAGRIDALAPEQFS
RTMAINYLGTVHWVQAVLPDMQRQRRGEIGLIASMAGWMPSPQMGAYTAT
KFAVVGLAETLAMEQRHSGVIVRCVCPMAVKTPMLDDILGQGRHERLRRL
VPLITPEKVVDALDKSLAKRGGKVMVLPDLSSALAWRARRWTPGLLTAAL
SVTETA
333992369YP_004524983.1 hypothetical protein JDM601_3729 [Mycobacterium sp. JDM601]MREQLMRYARDIYRYFTSAEGIASLRIHLEAQQFPQLYHAYRERVVDPNF
VVNVAALDAAAHHGGLRETADPVAVLEAIGGGVLIHALFSQHAGAAPEAT
APSEDQLEATLMNFVNLALDTPRT
333992367YP_004524981.1 hypothetical protein JDM601_3727 [Mycobacterium sp. JDM601]MSSNGRVLVTGGTGALGAATTKWLVRAGHDVVVFARHEPDTLPRGARFVP
GDIADGESVRRAMCGCDTVVHLAWALSGSITHEQAEPVNMGGTRNVLRAM
GDTGCRRLVFSSSVTAYGAHADHPQPWHEDEELAPAHGLVYEWHKAKAER
CVVESGVEAVRVRPTVVVGREAHNAPANVYRQLMIPTLGGAKIQMIHQDD
VGRFFAHACDSAAVGAVNLAADDVLTWSQVAQLARRPGFPTPPGGLVPAV
RLISKLAPVARSAPELFDMFLHWPIADTTRLREEFRFQLGYSSAEAIADQ
GRHATSHFVLGMKEIRRPTKLDRARPYPPAQGDTEGHSLEVVSGEPSGEL
DTRRADPGYPEWTCANLAEAFPGPMTPLSIQLIGDALFTGADQVALLLPL
NEQLRDNVRRRQLAVFGHRFYQNVSVLREMASAIPGQTAEDFDHQINGRP
YPADYIRPKSRLRDVPLYVKFAAVAGPRLLGVSSAVRDVEQRADEMCSLD
TSLSDLPDERLHARIDTLWRDCIDGWKVGLLCTFLVSAPTSVLERRYGIA
AAAQRTEQSSGLASSRLLRGVRELSVLAKQRPEVTAVLSNVRPNSWEELQ
RRDPQFAELVQRLLEVAGHRGPGETELANAVYADEPGLLLRAIASATDAT
PVTADSPKLDFLGRRFTKLSWLTMSQRERCRDAVMRLTHQLRLALREWGS
RLARRGFLLSDIDVFYLRYDELFCSSTDLVAVSSRRRDERDRLAKFDLPL
RFSQPMDLTAISSTDDTKSAIFGVPAVSGVVRGRVRVMRSPDDDLEPGDV
LVAKVTDTGWTPFFAAAVAIVTDVGGMMSHAAIVAREFGIPAVVGTEIAS
QVLHDGQLVEVNGYTGQIIVLD
333992365YP_004524979.1 hypothetical protein JDM601_3725 [Mycobacterium sp. JDM601]MGLTISEHERAALTEAAGFGLFAAISGRRSRRFPAGGVIPAGPLAYRSHR
PVQPLSDVERALLLSLMAGVTGWHDGIAHHPGYAPALPNYPGSATGRAMP
SAAGFHTSQVFFTDDTGCYLLPTRNQPPREFDTLEGRISHTADSYVRLSD
SRLQLPREEPYMEGHNTWIGNHPGSLLAFAVADLAEHLLENLWFFAANGY
PVRDDINGREIPGIQAFSGLAHADDPIPLSFVEQYTLTEASAELSIAAHN
GALGLQAMGLGGWIFDGLDRLSVLGGSGDPRAPGFGFVADTDPRWPFPNV
TGLPGHFETLSPPHVASVADGVAKLVARKFGPGGPSHRETAGPWTDSPGV
RGSALPPDGIAELVTVQASYIYDTFGKLPGTVPTVHVLMYLQAQHLDTDF
YDELYGPGAYLRTHAEHQQRWHAS
333992363YP_004524977.1 aspartate aminotransferase [Mycobacterium sp. JDM601]MTDSTLGSGGVALRAGIPPFHVMDVWLAAAERQRSHGDLVNLSAGQPSVG
APGPVRDAAAAALRANQLGYTVALGIPELRAAIAGSYADRYGLAVDPDDV
VVTTGSSGGFLLAFLACFDAGERVAIASPGYPCYRNILTALGCEVVEIPC
GPETRFQPTAAMLAALAETGPLAGVIVASPANPTGTVLEPAELAAIATWC
DETGVRLISDEVYHGLVYEGAPQTSCAWQTSRNAVVANSFSKYFAMTGWR
LGWLLVPTALRRAVDRLTGNFTICPPVLSQYAAVAAFTGESIAESDGHLR
HYAANRALLLDGLRAMGIDRLAPTDGAFYVYADVAGHTDDSLAFCARLLA
DTGVALAPGIDFDTERGNTFVRLSFAGPTTDIEEALRRIRGWLPLG
333992361YP_004524975.1 hydrolase/amidase [Mycobacterium sp. JDM601]MCTRLVYLGPNGNIITGRSMDWKLDLATNLWSLPRGVKRDGRAGANSIEW
TAKYGSVVATGYDICTTDGLNEAGLSANLLWLAESEYPSRDGSRPVMSVA
TWAQYMLDNFATVADAVAALQTEPFDVLTEGVPGEERLATLHLSMSDSGG
DSAIVEYVGGKQVIHHSRDYQVMTNSPIFEQQLAVNAYWEQLGGTVMLPG
TNRAADRFARASFYVNAIPKVEDPKIALASVFSVVRNVSVPFGISTPNEP
NISSTRWRTVAHHTRKLYCFESALTPNVFWVDLNKLDLSEGAPARKLDLG
RDESNTFAGESSAEFVVTEPFTFLEITT
333992359YP_004524973.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MKFDLDQDQRDFAASIDAALAAADVPGAVRAWSHGEPDAGRRVWNQLAEL
GVTALAVPEEHDGIGAHPVDLMLAIEALGRWCVPGPVVESIAVAPVLLAG
APDAAAQLAALAAGELIATVALPPHTPRALDADRADLVLHAESGRAGTAQ
AGTRHASVDPSRGVFDVTATGDSWDADTARAYEVGALATAAQLIGAGQAM
LNASVDYAKQRTQFGRVIGGYQAIKHKLADVHIALELARPLVYGAALSLS
QDSADTARDVSAAKVAASDAALLAAHSALQTHGAIGFTSECDLSLWLLRV
QAVRPAWGDVTAHRRRVLEAI
333992357YP_004524971.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MSPEPQTTPAALDHIARTLPDHDALVTEDDRFSYARLRDEVRRAAAALIA
LGVAPGDRVALWSPNTWHWVISCLGTHYAGGVLVPLNTRYTAPEATDILA
RSKAKVLVGMGRFLKADRLGELDRDELPELRHVVRVPVELTDGTWDEFIA
AGASVTDDEIDARAAAVGPDDLSDILFTSGTTGRSKGVLCAHRQSLAGPA
AWAECGQMTADDRYLCINPFFHNFGYKAGILACLQTGATLIPQLTFDPAG
ALRAIAEHRITVLPGPPTIYQTLLDHPDRDRHDLSSLRFAVTGAATVPVV
LIERMQNELDIDIVLTAYGLTESGGFATMCRPDDDAVTVATTCGRPIADF
ELRIDHGPDSEAGEVLLRSANIMLGYLDDDDATAAAIDADGWLHTGDVGT
VDAAGNLRITDRLKDMYICGGFNVYPAEIEQVLARLDGVADVAVIGVPDE
RLGEVGRAFIVRRAGSDEALDEQKVIAYAREHLANFKAPRSVTFADSLPR
NPGGKVVKHELREWA
333992355YP_004524969.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MSSVSDLSTAPEEIAGHGLLKGKTVLVTAAAGTGIGSTTARRALLEGADV
VVSDYHERRLSETRDELAALGLGRVEAVVCDVTSTAAVDELFETAVAKMG
RLDVLVNNAGLGGQTPVIDMTDEEWDRVLNVTLNSVMRSTRAALRYFRGV
EHGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEYGVRIN
AVSPSIARHKFLEKTSSAELLDRLAEGEAFGRAAEPWEIATTIAFLASDY
SSYLTGEVISVSSQHP
333992353YP_004524967.1 acetyl-CoA acetyltransferase FadA6 [Mycobacterium sp. JDM601]MSEIAPISQAYVIDAGRTAVGKRNGSLAGVHPVDLGALAFRGLLDRVGVD
PAAVDDVIVGCVDAIGGQAGNIGRLAWLAAGYPEGVPGVTVDRQCGSSQQ
AISFGAQAIMSRTADLILAGGVQNMSWVPISSAMIVGEQFGFTSPTNESK
KWLERYGDQEISQFRGAEMIAEKWDLSREEMERFALQSHQRAFTAIAEGR
FDREIIPVDVDGVAFRVDEGPRESTLEKMAGLKPLVEGGRLTAALASQIS
DGASAVLLASESAVQAHGLKPRARIHHISARGDDPVFMLTGPIPATRYAL
EKTGLGIDDIDVVEINEAFAPVVQAWMKEFPIDPAKVNPNGGAIALGHPL
GATGAKLFTTMLHELERTGGRYGLQTMCEGGGTANVTIIERLDS
333992351YP_004524965.1 transcriptional regulator [Mycobacterium sp. JDM601]MTATKTGYHHGDLCAALIDAGLQLTRTGGPEALTVREATRRAGVSPNAAY
RHFADRDALLAAVAMAIHDKMAARMLKPVNRRGSAQTRARDQLRAVGLGY
IGFALDEPGWFAVAFFGADPVGDDRVPPPLRALVDGLDAMVEAGVLQANR
RAGAEWPCWSAVHGFAELALHGPLRGTSRDELDALARRTVDDIISGLVR
333992349YP_004524963.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium MSTTTGLKTINLVCVPTPDQDKAVAFYESLGFEKRTDIEMGDGYRWIEVY
PPTGIAGIALAPPPPESGPVEPAVTGITLTTDDIDATLAAMKELGIDVDE
QVSRMGDPVPPLFWFRDPTGHTLMVAEV
333992347YP_004524961.1 2-nitropropane dioxygenase [Mycobacterium sp. JDM601]MSRLKTPLTELVGIEHPVVQTGMGWVAGARLVSATANAGGLGILASATMT
IDELAAAIAKVKSATDKPFGVNIRADGADAGDRVDLMIREGVKVASFALA
PKQELIAKLKEAGSVVIPSVGAAKHAKKVASWGADAVIVQGGEGGGHTGP
VATTLLLPSVLDAVAGTGLQVIAAGGFFDGRGLAAALSYGATGVAMGTRF
LLTSDSTVPDAVKQRYLAADLGGTVVSTRVDGMPHRVLRTELVEKLESGS
RARGFSAAIRNAAKFKKMSQMSWPTMIQDGLAMRHGKELTWSQVLMAANT
PMLLKAGLVEGNTEAGVLASGQVAGILEDLPSCAELIEGIVADAVEHLRA
ANSFVV
333992345YP_004524959.1 CoA-transferase subunit alpha [Mycobacterium sp. JDM601]MTTKVTTLDDAVAELRDGMTIGIGGWGSRRKPMAFVRAILRSGVKDLTVV
TYGGPDLGLLCSAGKVRRAYYGFVSLDSPPFYDPWFARARTTGAIEAREM
DEGMLRCGLQAAAQRLPFLPIRAGLGSSVIDFWEGELKTVTSPYPTDGAH
ETLVAMPALNLDAAFVHMNLGDARGNAAYTGIDPYFDDLFLMSAQRRFLS
VEKIVPTEELIATTSPQTQIINRMMVDNVVEAPGGAHFTIGAADYGRDEK
FQRHYAEAARSDETWAEFTATYLSGSEDDYQAAVKAFGANQESGAQA
333992343YP_004524957.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MTGGVRGVGAGISAVFADQGATVVTCARRPMDGLPYEFHACDVRDDDAVR
GLIETVVAKHGRLDVVVNNAGGSPYAPAAQASANFSRKIIELNLLAPLQV
AQHANAVMQAQDCGGSIVNVTSVSGRRPSPGTAAYSAAKAGVDSLTATLA
VEWAPKVRVNSVVVGMVETEQSELFYGDAESIAAVAATVPLGRLAKPADI
GWAAAFLASDAASYISGASLEAHGGGEPPAYLDASSANK
333992341YP_004524955.1 transcriptional regulator [Mycobacterium sp. JDM601]MTLTGTGGVGKTRLALQLADELAGRFRDGAWCVDLSPITDPELIPERVTK
TLGLPDRPDRSPLDTLVSLIAGRQLLMVLDNCEHLLDACARLTATLLAAS
AELTIVATSREPIGVAGEVTWTTPSLSLADEAVDLFRQRARLVRPSFTET
ADDAALVAEICRRLDGVPLAIELAATRARALSLVEIADGLGERFQLLTGG
ARTAVLRQQTLRASEDWSHDLLSESERVVFRRLAPFRGGFDLDAAHAVAG
STDLPRGQIVDKLTQLVDKSLVIADSAGESTRFRLLQTVQQYALEKLEQA
GEAEAIRARHRDHYAALFDAGVTAGYGWHIAQAELEIDNLRAAFAWSREH
GDIELAARLASSLFPLWIHSRTLEGLAWFDAVLTAPASMAPATRARALAD
KTIFEALTGNYGHADQAEEAVAIARRLDDPTLLAWSLAACGFTCSYSPEL
ALPYFEQAIALSPALDDDWRLAQIYGVQAYSVFVAGDLATTQVAAEKGQR
LADAVGDWSVSRLCRLCLGLTHLHRGELPMAVEKTRGVAIEAEAAGDPLF
STQSLAVLAEALACQGDTRGARAAADACVEAAADLIDFHRAVSFGTVVDV
SLAAGDVSGAVGAGAAAFDACALPQLMAITGNPVARAALASGDLVTARHL
VDEALAVGSGFQRILLLEIRARVAMAEGELKQAEQDARHALAIAAETGGY
LAVPELIESLAAVNCAAGQHHRAARLFGLAASARDIAGTVRFKVYDAEYA
DAVNALREAMPQDDFEHHWAQGTASSIAEVIAYASGTEGRRKRPSRGWAS
LTPAEHNVIRLVSAGLRDKDIASKLSVSPRTVHSHLNHIYAKLDISSRVQ
LVQVAARHI
333992339YP_004524953.1 hypothetical protein JDM601_3699 [Mycobacterium sp. JDM601]MAGTTVTTVTAGRCVGAGCAVRTGVAGSGRPAAAGVTTGAAGTDRAGVAT
ATTLPTMGIGRVAVGTLTAVTGRAGVTALATLATISVGARSTVGRRTAGT
TSTGRATGTAIAAVAAGTTITTGSGRVSSVEALTTGATIATVAAQTTGTT
GTDHRTTGATGTTGTAHTTRGTARAINAHTGAVGTIGARGTVTAVTARTT
IAVITGRTTGTTIATGRTGCSTRVTGRVVTGATPAAVTADGGGAGCALRT
GVAGSGRPAAAGVTTGAAGTDRAGVATATTLPTMGIGRVAVGTLTAVTGR
AGVTALATLATISVGARSTVGRRTAGTTSTGRATGTAIAAVAAGTTITTG
SGRVSSVEALTTGATIATVAAQTTGTTGTDHRTTGATGTTGTAHTTRGTA
RAINAHTGAVGTIGARGTVTAVTARTTIAVITGRTTGTTIATGRTGCSTR
VTGRVVAGTTVTTVTTAARRASRIAVGAARRPGTADATGATSTDVAAAST
VAAVGVCRCSVGAVTTIAGLAAAAAIARASPDAGRPASGTTVTAGAADAT
VATGGTVGVAGVAVSPVEGVTADATVAAIAAGTVAAVGGVVAAAARPTGA
TRAASAAGTALLSGVAIHVLGIAVGAVGAIGSVAAVAAIAAVAASAMSTC
GGAGTADTAVTAGATVAGVGAVSTRSSAVDPVESVAPGTADPTGTTVAGR
GLGTVGVQATRATVAADTTIAAGGAIDGFRGAIHTCQAGATGAAVTADTT
DTTGTRGGVAAITAVAAGTALTGVATGATVLAGVAIDMPGVSGSAISTVG
AIAAIAAIATDTTDTVGAGLSAATADTARTAGTTIAGVGAGCARRGTVGT
VEAVAAGAARAAGASITGRGLRAVNVETTQTAVATGATGATGRTVGILRG
AIDTG
333992337YP_004524951.1 hypothetical protein JDM601_3697 [Mycobacterium sp. JDM601]MTGAAAVARAPVGTILAIDAASTSGTALTSDQAGVASGPARPTLTAARVV
LGALATGTTGSAAAAGATGTAVATVAADPGRAVGRGAAVTARTTVTGDTA
AAAGTADVPLATTGIAGRTALAGAATSAGPADAAMAAGATVARVPAARTA
VTAGAANAADTAGVARSAVLRRGGTRRTLATGPAVAALPAVAVRSGVAAL
ATGTAGLAGLGLAVAALAAVTAVTGADRISALLAISSRATGTATALATSA
SSTALATVATGTTATRGRVSATAGTGTTITAVARATSSTTVATNTASTLT
TGTAVGGRTTHATSTTVATGTTVAAIAAVATIRAVAATTGRSIRARRARQ
PGATSTAGTASATSTTDTAITRQRTALTTSTTSATSTGVSTIGAVTGTIR
DTGSTISTSTTGTTSTTVADRPGVAALATVTAGLAGHTLAVAALAAVTAV
TGADRISALLAISSRATGTATALATSASSTALATVATGTTATRGRVSATA
GTGTTITAVARATSSTTVATNTASTLTTGTAVGGRTTHATSTTVATGTTV
AAIAAVATIRAVAATTGRSIRARRARQPGATSTAGTASATSTTDTAITRQ
RTALTTSTTSATSTGVSTIGAVTGTIRDTGSTISTSTTGTTSATVADRAA
VTAGTTIATVGTRGRRRVTGRVVAGATVTTIALHTMGIGVITGSTISTRR
RAGTAATTGTTIGQRTTVTAVTAGRVLRGTGSTLAAVAGLTSVTTITGTA
TGALVTGTAVGGRTTHATGTAIATLATGASSTTSAAVTVTAVGKRSGHTG
SAIAAGTTGCTGTTSTTSATVTRNRATSTTGATSATGTTGVTSTTSFAGV
SGAIGAGVADLAVTTGTTSATVADRAAVTAGTTIATVGTRGRRRVTGRVV
AGATVTTIALHTMGIGVITGSTISTRRRAGTAATTGTTIGQRTTVTAVTA
GRVLRGTGSTLAAVAGLTSVTTITGTATGALVTGTAVGGRTTHATGTAIA
TLATGASSTTSTAVTVTAVGKRSGHTGSAIAAGTTGCTGTTSTTSATVTR
NRATSTTGATSATGTTGVTSTTSFTRECAVFTIPAG
333992335YP_004524949.1 hypothetical protein JDM601_3695 [Mycobacterium sp. JDM601]MATVSQPLSKPVSEADRIAAAQAYIDALVSHDATAVRFSPDCTRVEVGIK
TGFSGNHLRRSLNRGPQFRLIAAATLPEYSVEGDEVRAVFDIITKPSLFG
RRVCAHVDEVFVIPADSPDGIATIHHIRAGIKPFIQR
333992333YP_004524947.1 cytochrome P450 [Mycobacterium sp. JDM601]MSSVKVPPGFDFTDPEIYAERLPDAEFARVRAAAPVTWIDQPDDKSGGFK
DGGYWAITSHHDVKEVSRLDEVFSSEINGAIPRYNDDIERENIDVGRLLM
LNQDAPRHTRLRRIVSRGFTPRHILPLHDDLERRAQNIAKEALARGTGDF
VVEVASELPLQAIAGLMGVPLEDRGKLFNWTNQMTSYDDPEYAHYDPKTS
SMEIISYGLQLAEMKRHNPGNDIVTTLIEADIDGEKLGDDELGFFIILLA
VAGSETTRNSITQGMMAFTEFPEQWELFRRERPETTADEVVRWATPVTSF
QRTATRDYELSGVQIKKGQRVVMFYRAANFDPEVFDNPQQFDILRDPNPH
VGFGGTGAHYCIGTHLARMSVNLMFNAIADHIPDLKPLDKPDRLKSGWLN
GIKHWRVDYTGKSA
333992331YP_004524945.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MDFSPDPEQQAVADVVTSVLDRDNSWEALVAGGVSALAVPERLGGDGVGL
SEVATALTEIGRHGTVSPALCTLGFGLVPLLELATDAQQDRYLSGVAKGA
VLSAALDEPAAALPEQPAVTLAGNRLSGTKIGVPYAEQAEWILVTADSGV
AVISPKAAGVRLTKTPTANHSDEYAVVFDDAEADAVLDGASVHRVNQLVL
AMVGAYASGLVAGALRLTADYVGSREQFGRPLSTFQTVAAQLSEVYIVSR
TITLAATSVVWRLANGLDADDDLGVLGYWITSQAPPVMQLCHHLHGGMGM
DVDYPMDRYYSTIKDLNRLLGGRSNRLVTLGELCSSI
333992329YP_004524943.1 hypothetical protein JDM601_3689 [Mycobacterium sp. JDM601]MSDLSAGIEQILASGRSEPRTGRDPVNQPMIRHWVDAIGDENPIYIDEEA
AKAAGHPGIVAPPAMIQVWTMMGLGGERPADDPLGKVMELFDGAGYVGVV
ATNCEQTYHRYLRPGEEVSVTAEVTDIVGPKQTGLGEGYFITQKIRWWVG
DENVADMNWRILKFVPKDAGDAAPAAAPEDLDPAKMMRPSWSKDSAYFWE
GVVAHELRIQQRPDGSLQHPPVPAIWKDKTETTDFVVASGTGTVFSFVVH
HAPKVPGRSVPFVIALVELEEGVRMLGELRGVDAAAVRIGMPVRAIYLDF
PAGDAGPAWTLYAWEPVEGGGA
333992327YP_004524941.1 lipid-transfer protein [Mycobacterium sp. JDM601]MLSGKAAIAGIGATDFSKESGRSELRLAAEAVLDALDDAGLKPADVDGLV
TFTMDSNLETAVARATGIGELTFFSQIGYGGGAAAATVQQAALAVATGVA
EVVVAYRAFNERSEFRFGQVMTGLTVNADSRGVEYSWSYPHGLSTPAASV
AMIAQRYMHEYGATSADFGVVSVADRKHAATNPKAHFYGKPITIEDHQNS
RWIAEPLRLLDCCQETDGGVAIVVTTPERAKDLKHRPAVIEAAAQGAGAD
QFTMYSYYRDELGLPEMGLVGKQLWAQSGLTPADIQTAVLYDHFTPYTLI
QLEELGFCGKGEAKDFIAGGAIELGGRLPINTHGGQLGEAYVHGMNGIAE
GVRQLRGTSVNQVPNVEHVLVTAGTGVPTSGLILG
333992325YP_004524939.1 PPE family protein [Mycobacterium sp. JDM601]MTAPVWMASPPEVHSAALSSGPGPGPLLSAAGAWSSLSLEYTAIADALRS
QLGAVQAAAWQGPTADRYAAAHLPYLAWLAAASADSAALAARHETVATAY
VSALAAMPTLPELAANHAIHGVLVATNFFGINTIPIALNEADYVRMWVQA
ATTMASYEAVSGAALASAPQPAAAPPILAAHDHDHDHDHADEDDHDHDHD
HDHDHDHDHDHDHGGGIHDGSLTPADPEWWTDFFSELGYYGEVLLNDLLT
NPGAFMTDLSWIVADLTFHAAQIASTLSQFAPALIQPALRPGYRESGLGG
GLGRPGRRSATADRGRRRRTDHRGIAGRRGRVHHRFECPGGAGSRHDRVD
IDAGNQRSSRSGAARGTAGRGKPGILPALRDRTCRCLRAGERHIPHPRSH
EDADPG
333992323YP_004524937.1 dehydrogenase [Mycobacterium sp. JDM601]MAEQEYDVVVVGSGGAGMVAALTAAHQGLSTVVIEKAAHYGGSTARSGGG
VWIPNNEVLKRAGVKDDAESARTYLHTIIGDVVPAEKIDTYLQRGPEMLS
FVLKNSPLKMCWVPGYADYYPEQPGGKPTGRSIEPKPFNARKLGADMAGL
EPPYGKVPLNVVVMQQDYVRLNQLKRHPRGVLRSLKVGARTMWAQATGKN
LVGMGRALIAPLRIALRDAGVPVELNTALTDLYVSDGVVRGVYVRDSNAS
EESEPRLIRARRGVILASGGFEHNEQMRVKYQRAPITTEWTVGAKANTGE
GILAGEKLGAALDIMEDSWWGPTVPLPNAPWFALSERNSPGSIIVNMAGK
RFMNESMPYVEACHHMYGGQYGQGPGPGENIPAWLVFDQRYRNNYIFAGL
QPGQRIPKKWLESGVIVSADTLEELATKTGVPAAALTATVERFNEFARTG
VDEDFHRGESAYDRYYGDPTNKPNPNLGQIAQGPFYAAKMVPGDLGTKGG
IRTDVRGRALRDDNSVIEGLYAAGNVSAPVMGHTYPGPGGTIGPAMTFGY
LAALDIAGKA
333992321YP_004524935.1 2-keto-4-pentenoate hydratase [Mycobacterium sp. JDM601]MLSAQIRDELAAELAQAERSRVPISPLTAAHPDIDVVDAYEIQLINIRQR
IAEGARVVGHKVGLSSEAMQQMMGVDEPDYGHLLNEMQVFEDTPVKASNY
LYPRVEVEVAFILGADLPGADCTEEHVLAATEAFAPAIELIDSRITDWKI
KLCDTIADNASSAGFVLGKQRVKPGDIDIKGIDASLTKNGEVVAKGRSDA
VLGNPVTAVAWLARKVESFGVRLKAGDIVLPGTATRAIDVHPGDDCVADF
SGLGSVRLVFE
333992319YP_004524933.1 4-hydroxy-2-oxovalerate aldolase [Mycobacterium sp. JDM601]MSDHIFDVRITDTSLRDGSHHKRHQFTPEEVAAIVAAIDAAGVPVIEVTH
GDGLGGSSFNYGFSKTPDQELIRLAAQTANDAKIAFLMLPGVATKEDMKE
AQGNGGQICRIATHCTEADVSIQHFGLARELGLETVGFLMMAHTIPPEKL
AAQARIMADAGCQCVYVVDSAGALVLEGVRDRVAALVAELGGDAQVGFHG
HENLGLGVANSLEAVRAGAKQIDGSVRRFGAGAGNAPVEALIGVFDKVGI
KTGIDFFDIADAAEDVVRPAMPAECVLDRNALIMGYSGVYSSFLKHAVRQ
GERYGVPAHELLHRAGQRKLIGGQEDQLIDIALEIQRERAEAGK
333992317YP_004524931.1 hypothetical protein JDM601_3676 [Mycobacterium sp. JDM601]MGLLSMAGVLAPVVAHAQPCDQTVGESIDAYLNRHPDVRAELDEKGRQED
PGAPNPTLSYLERHPHVRQALITLSQQCV
333992315YP_004524929.1 hypothetical protein JDM601_3675 [Mycobacterium sp. JDM601]MTSPQISLQLKTFTDDPGHGWDATLALGAAMDAAGVDRVVVSDHVVFGEN
PDAYADPRLGGVAGGRQPTGPDGQWLDPLIVLTALAATTTRIRLGTAVLL
AALRRPAVLAKQLATLDVLSDGRLDLGVGVGWQREEYEAAGLVFERRGRL
LDHTLEVCQTLWTQQRSSYASPELSFDNIHQMPKPVQPGGVPIWVSGTVN
DAVARRLARFGTGWIPWGPAIRDPAGAIAAMKDRIAGLGGDPTGLQVLGH
AKTVKRADGSLDPAATAASAPALVAAGVTDVRVTCSLPRDAEGATKLLSE
LVEAFRAAT
333992313YP_004524927.1 IclR family transcriptional regulator [Mycobacterium sp. JDM601]MAPRQSARSSPPTERVVALLDFLAQHPDQGFGLSDLARRTGLSKPTCLGI
ATTLTEAGYLTRDDPDKTYRLGPGLISLGRAAQQSLRVGPAAREQLRRLS
VEFATSAALSAVLDDRITVLELVAAPNARLGVQAGQSYPFAPPVGLMFVL
WDDAALRDWLARQPTIPLRSESERLRRVVAECRSDGYLVERLTPGGQRLY
AMMAGLPSDLPDELRALLGELVSDIGERVYLRDKARVAGTRERHDISVIS
APVYDHHQRQAMVVSLHAQRALTDTEITKWARGLLRTADALTGQLGGSKP
PSLLGSAP
333992311YP_004524925.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MKMTGMLNGKVVVISGVGPGLGSTMANRFAAEGADLVLAARSADRLEEVA
KQVRAAGRRALVVPADITDDDQVANLVEAATGEYDHIDVLINNAFRVPSM
KPLAQTSFQHIRDAIELSGLGALRLTQGLTAALAEANGAVVNLNSMVIRH
SQPKYGAYKMAKAALLAMSQSLASELGEQGIRVNSVAPGYIWGDTLQGYF
AHQAGKYGTTVEQIYAATAANSDLKRLPTEDEVASAVLFLASDLASGITG
QVLDVNCGEYHN
333992309YP_004524923.1 hypothetical protein JDM601_3669 [Mycobacterium sp. JDM601]MSPEERGVPAVEDLARSMLALYGPHDDHHDEPDTDDSGPDTRYSRQPLFP
VDPARYEAIRAATERDSERYLHSGLVPVECRHCRASVEVKKLGPGYTSVQ
WSSESLTQCAFFAAEREAGHASSRSRGCPNLAKSIRHAVAEGHLEETSSA
PPPGDGID
333992307YP_004524921.1 siderophore-binding protein [Mycobacterium sp. JDM601]MQLFSFNGRSPRIDPSAFVAPTATLIGDVTIEAGASVWFGAVLRGDDAPI
VVREGANVQDGSVLHVPPGVPVDIGPGATVAHMCLIHGAHIGAEALIGNH
ATVLDGAVIGSRTLVAAGATVLAGTKIPDGMLVTGAPAVIKGPIAGTGAE
MWIDANPPYYRGLAQRYRDGLEAVEPS
333992305YP_004524919.1 hypothetical protein JDM601_3665 [Mycobacterium sp. JDM601]MRIRVSVGLLGAAVSLGVAFAGNATAEDIDDGWPYGGVGGLTPSSLALPG
FLVIAQGYGTNEGQHAFGPIVDNWGDYTATHDVDKTDDWYTVHDNTFIIP
GLYTNQHTEVTNVLDDAAGYPSVGTVFDETELFRSNSPVGAIDWFTSSTL
NDPEVGYASQFTMWPLFMNTFLYTDDGMKDVVSSFGQQFTVFELPFTDAS
GAGDASDAGGGFAQLLAELAGAAPGATDLL
333992303YP_004524917.1 oxidoreductase [Mycobacterium sp. JDM601]MMKYTLSVAMGPIDELVALAQSAEEVGFDAIALPDSLFYMESAAADYPYT
PDGSRMWNAETPWVDPLIAAAAMGAVTSTLRFYTNVLKLGSRNPLLLARQ
VGSVANLTGNRFALGVGIGWAPEEFEWCGVPYARRGARVDEMIDVIKLVL
AGGMVEFHGQFYDFDRLQMSPAPSLPVPFYVGGHTDVALKRAARIGDGWT
SAMMTGAQLAETIGKLRALLAEYDRADLPFEYQAVCIDKFGVDGHRELAE
AGVTDNIVIPWMLDGLGFDAPLAAKRDSLKRFADTYIHSGWQE
333992301YP_004524915.1 lipid transfer protein or keto acyl-CoA thiolase Ltp4 [MycobacteriuMSTRDVAVVGFAHAPHVRRTDGTTNGVEMLMPCFEQLYRELGIERADIGF
WCSGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDGAWALYEAYIKVL
TGEVDTALAYGFGKSSAGQLRRILALQTDPYTVAPLWPDSISIAGLQARL
GLDGGQWTQEQMARVALESFAVAERVDSVESSDSLDELLERPFFADPLRR
HDIAPITDGAAAIVLAAGDKARELCENPAWITGFEHRIDSPVLGSRDLTR
SPSTTASARAASGDDMPAVEVAEIHAPFTHQHLILTEAMRLPSRAKVNPS
GGALAANPMFVAGLERIGFAAQHIFNGSAGRVLAHATSGPALQQNLVAVM
EGRN
333992299YP_004524913.1 coenzyme F420-dependent oxidoreductase [Mycobacterium sp. JDM601]MKLGLQLGYWGAQPPTNHAELVAAAEDVGFDAVFTAEAWGSDAYTPLAWW
GSSTSRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGQRFGKPLARTREYIDILRQVWAREAPVTSAGPHYPLPLSGEGTT
GLGKALKPITHPRRADIPVMLGAEGPKNVALAAEIADGWLPIFYAPRLAD
MYNEWLDEGFARPGARRTREDFEICATAQVVITSDRAAAFAGIKPFLALY
MGGMGSEDTNFHAEVYRRMGYSEVVDDVTKLFRSDRKDEAAKVIPDELVD
DAVIVGDIDYVRKQIKVWEAAGVTMMVVAARDTAQVQQLASLL
333992297YP_004524911.1 hypothetical protein JDM601_3657 [Mycobacterium sp. JDM601]MHINAESEGETAKLQRHEQIATPPKIWWIIAGFLLAFGVAMCCSFLPGRE
GFSLQHYRELILYMAGFCVLFAIGMGYGEAKLRYPIAQGQRLQFIIASIF
SAGLFAMLYLTTYYLTTRAIVRPRE
333992295YP_004524909.1 hypothetical protein JDM601_3655 [Mycobacterium sp. JDM601]MFVDPAMLTAGESHSHSAANHAHTGAASLHQPGVTAGIFGSFGAADVYHN
AICTAHSDHITILNGHRRTLTDVGDKAHYAARAFTGMDQHNAAELRAVQC
NSST
333992293YP_004524907.1 hypothetical protein JDM601_3653 [Mycobacterium sp. JDM601]MFSVSADAAQAMIDYSGLQVFQHRPGQAVVNLMLARYIDGDLGKYHEFGT
AVMVNPPGSSARGWRALGSAGAFIHHLPVDQEFTLEAGRTIWGFPKVMAD
FTVRDGKRLGFDVAAGGEHIATMEFGRGLPVPGLFTSRPRTLQAFSHLDG
VTHQVPWEMKVSGVRGTVGGTTLRLGTHPYAQELAALGLPKRPMMSSTVG
HVEMTFGDAEVAGR
333992291YP_004524905.1 hypothetical protein JDM601_3651 [Mycobacterium sp. JDM601]MQLIGGIPVTSPARTALDLACRYPQVNAVAAIDALGQATDLKITDVELLA
ERYRGRRGICDARMALPLVDTGSDSPRESQLRLVLIRAGYPPPQTQIPVY
DEWQQLVAVLDMGWKEVMVGLDYEGEHHRTNRRRFNQDIRRHETVTGLGW
IDLRITLEDTEGGILGRVAAAWARRACTPSDFRARFSR
333992289YP_004524903.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MSESSQQPHALVEQRGHTLIVTLNRPEARNALSGEMLAIMVEAWDRVDND
DEIRSCILTGAGGYFCAGMDLKAANKKAPGDSFKDGSYDPSRIDGLLKGR
RLTKPLIAAVEGPAIAGGTEILQGTDIRIAGQSAKFGISEAKWSLYPMGG
SAVRLVRQIPYTMACDLLFTGRHITAAEALEMGLIGHVVPDGSALDKALE
IAEQINNNGPLAVQAMLRTIHETEGMHENDAFAIDTKIGIKVFLSEDAKE
GPRAFAEKRRPEFKNR
333992287YP_004524901.1 hypothetical protein JDM601_3647 [Mycobacterium sp. JDM601]MHIGGLAILDTSQAPNYSFELVRQLLIERLPQLPQLRWKVSGAPLGLDRP
WFIEDNELDIDFHVRRIGVPAPGGRREVEELVGRLMSYKLDRSRPLWEVW
VIEGVNGGRVATLTKMHHAIVDGVSGAGLSEIMLDVTPEPRPPEPQAIGS
PTDDGIPSFERRAIGALVNVAVMTPFRIGRLLQQTVRQQIATIGLGVARK
PPRYFDAPVTRFNASVSPHRRITACRVELARVKAVKDAYGVKLNDVVLAM
VAGAVRQYLGERGELPDKPMVAQIPVSTRTEASQGEVGNKVSSMTVSLAT
DLEGAGQRLKMIHENTQSAKQMAKALSAHQIMGLTDTTPPGLLQLAARAY
TATGLSNRLAPINLVVSNVPGPSFPLYMAGAEVESLVPLGPPVMDVALNI
TCFSYRDHLDFGFVTTPEVAEDIHKMADAIEPALADLEHAAGRSKPRAGR
R
333992285YP_004524899.1 hypothetical protein JDM601_3645 [Mycobacterium sp. JDM601]MAGTVPATIGIAYAPVGQNGVVTLGALQNGVAWSTIKVPLAIAAIHANRP
DAQDLAARAVTASDNDAAEKLWSELGPAPQAAQQVQAVLRAFGDTGTAVE
SRRLRPEFSAFGQTQWPLGRQAVFAAHLPCLAAGAPVYSLMRNTVTSQRW
GLAGLSVPSKGGWGPGPGGGYLVRQFGIVRSPHGDLAVAMAAEPNDGSFD
SGVAALNQMTQWLSANAAALPGGRCAG
333992283YP_004524897.1 hypothetical protein JDM601_3643 [Mycobacterium sp. JDM601]MAEAFNKAGNASARDQIEQVRADADSIPSWTFEVKSELFFRPSALAQLLT
GVYYVHGAAHPNNYVSTVVIDSRSAKPITLSDLFSNEQDGLNRLSEQTKR
IWPTVYGDGEPMADEPGNRPIAENFANWIPTAEGMELHFADYQFGHGLPV
ITVPWSSLTDVLAPDMAALAQR
333992281YP_004524895.1 hypothetical protein JDM601_3641 [Mycobacterium sp. JDM601]MQSYSPPQVVRVGDVRDATQGSGNYLSDSSTGYGYMGWYSRHYDTPDTVA
PLPPR
333992279YP_004524893.1 hypothetical protein JDM601_3639 [Mycobacterium sp. JDM601]MTHPAPTHPPLLFCAPNLRCAEVAGQLVVLDLSAGVYDVINEVGAAMWAQ
LTRLPDERNLIGLAEEYGIAPATLEADFADFATAQLTAGRLVTDQRPTPP
SIERSPRRAPTILRALWERAAAERDLRRGFATAYANRVGPTADTAAPRTP
VELLMRRFRTAESLYPARQAPLDCLPRSLALTRFLRTAGWPARHVMGVAL
YPFEAHAWVELNGTALNEGDLRRFTVIQQA
333992277YP_004524891.1 hypothetical protein JDM601_3637 [Mycobacterium sp. JDM601]MTDTQAIAAFADIEAIKQVKYRYLRALDTKHWDDFAATLAEDVTADYGKS
MGSDHTFSDRDSLVEFMRTSLPGNLISEHRVNHPEITLTGADSATGIWYL
QDRVIMPDFNLMLIGAAFYHDTYRRTADGWKISATGYQRTYDATMPLSDI
PGFKVTFGEALHR
333992275YP_004524889.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MQISYTAEQEELRRELRSYFTTLMTPERREALSSTQGEYGTGNVYRETVA
QMGKDGWLTLSWPKEYGGQARSAMDQLIFTDEAAIAGAPVPFLTINSVAP
TIMAFGTEEQKKFFLPKIAAGELHFAIGYSEPGAGTDLASLRTTAVRDGD
DYVINGQKMWTSLIAYADYVWLAARTNPEAKKHRGISMLIVPTSAEGFSW
TPVHTMAGPDTSATYYSDVRVPVSNLVGEEHAGWKLVTNQLNHERVALVS
AQPIFVALDEVREWAQHTKDSHGNRIIDSQWVQLNLARVLAKAEVLKLIN
WELASSDSASPSPADASAAKVFGTELATEAYRLLMEVLGTAATVRQDSPG
ALLRGRVERMHRACLILTFGGGTNEVQRDIIGMVALGLPRNR
333992273YP_004524887.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MTANSAIDLTGKVAVVTGAAAGLGRAEAIGLARSGATVVVNDIAPALESS
DVIDEIAAAGGKGVPVAGDISQRSTADELVSTADGLGGLSIVVNNAGITR
DRMLFNMSDDDFDAVIAVHLRGHFLLTRNAAAYWRQKAKEADAGTVYGRI
VNTSSEAGLMGPVGQANYGAAKAGITALTLSASRALSRYGVRANAICPRA
RTAMTADVFGEAPEGAAGEVDPLSPEHVVTLVRFLASPASASINGQVFVV
YGPEVMLMAAPTVEHKFSAAGQAWEPSALSDTLGNYFADRDPRRTFSASE
LMESD
333992271YP_004524885.1 hypothetical protein JDM601_3631 [Mycobacterium sp. JDM601]MSYDATLRFRRLFRWVPKAVDDFGEQALFYADSIRYVPNALTKYRKETVR
LIAEITMGTGALAIIGGTVGVATFLTLASGGVIAVQGFSSLGNIGIEALT
GFLSAFLNVRIVAPVVAGIALAATIGAGTTAQLGAMRVAEEIDAVEAMAV
HAVSYLVSTRLVAGLIAIIPLYSLSVLAAFFAARSTTVFINSQSPGLYDH
YFDTFLIPTDLLWSFLQAIIMSIAVMLVHTNYGYNAAGGPVGVGIAVGQA
VRTSLVVVVVITLFVSLAVYGGSGNFNLSG
333992269YP_004524883.1 MCE-family protein Mce4B [Mycobacterium sp. JDM601]MNTRGTLIKVAIFTAAMLLVSAGLVVVFGEFRFASNHTYHADFASASRLK
GGEDVRIAGIPVGTVKRVALTPDNTVSVTFDVDKRYQLYDSTRALIRYEN
LVGDRYLEIASGAGELRKLPPGGTIGREHTQPALDLDALLGGMRPVLKGL
DGTKINEISNAIIELLQGQGGALTQMLANTSSFTTTLASRDQLIGDVINN
LNTVLATVDDKSEQFDATVDRLQQLITGLAEGKDAIAGAIGPLATVETDL
TDTLRRTRRPLQGVIENARPLATVLNKRKQELNDVIDPLEENYLRLNALG
AYGSFFNINYCTVSMKLNGPAGSDIILPMGGQTDTTKGRCSPVKN
333992267YP_004524881.1 MCE-family protein Mce4D [Mycobacterium sp. JDM601]MTRPSSRILLAGALAALLAAGVYLVLPAQRGYRITGYFASAVGLYPGDDV
RVVGVPVGRIESIEPRAENVKITMSVNKDVPLPADVHAVMMAPNIVSARV
IQLAPAYTGGERLADGAVLGEDRTAVPVEWDEVKKELTQLSAQLAPEQGK
LNGALSAFVNQAADTFDGNGDSFRSALRELSATTGRLGDSRTDLFGTVKN
LQVLVDALSGSNEQIVQFTDHVAAVSAVLADSSADLDVTLGTLNQALRDV
RGFLHDNNDALITQVNKLSEFTKVLSDQSENFEQVLHITPHGLVNFYNIY
NPAQGSLAGLLSLPDFANPVQFICGGVFDVGSVPDNFKRAEICKERMGPV
MRRWSMNFLPFLFHPINSITAYKGQIIYDTPETEAKAQTPVPYLKWMPAP
GVTPPSTDDVAALFLPPSEPGQLGQAPGPHGPQQPGAGAPREGG
333992265YP_004524879.1 MCE-family protein Mce4F [Mycobacterium sp. JDM601]MLTRLVRIQLGIFAVVTVLAVGAIAILYLHLPSRMGIGTYKVTADFIGGG
GIYKSANVTYRGVTVGRVEDVRLTDHGIDAQIRLNSSTKVPGNVTATVKS
MSAIGEQYIDLVPPEGAAAAGVLHNGARIGQDRTAIGQDIAGMLDQAQTL
VNSVANSRLRDLLRNTFEGFNGSGQELARMIASSRQLIDEANANFEATEG
LIDQFEPFLDAQIRSGDDIKTLARSLATVTTEVRNADPQLREVLQILPSV
TDEANTTFSGIRASFPTLAASIANFGRVGVIYRKSIEQALVVFPALMAAL
ITVAGGAPIEEGAKLDFKIDMHDPPPCVVGFLPFTEMRTPADETVRELPK
DLYCKAAQNDSAAVRGARNYPCMEYPGKRAPTIQLCRDPKGFVPIGSNAW
RGPPVPYDTPITDPRMITPMNKFPYIPPSSDYDPGPPVVALPPGVPAGPG
PAPNPPYPLPYPPNELGPNPPAPWPYYAPPDQNLPTNPGGNGGLPAYGRD
PAPGPAPGPLPAETPAQANGVAYSSYDQRTGKFVDPAGSTGVFVSGADKW
LPAENWADLMLEPRQT
333992263YP_004524877.1 MCE-associated protein [Mycobacterium sp. JDM601]MAGRQSMNRGWSGLVALVVLLGVFVGLGATAGKLYWNRVEARGEQLARTE
LVELAKAEIPKVLGYEYKTVEGSLTETFPMFTGDYRREFEARAINDIIPQ
ARERQLVNQVDVTGVGVQDAKRTAGSVLVFISRTITSGKSKEPLHEGSRL
RVDFRKVDSKWLISNIVPI
333992261YP_004524875.1 alpha alpha-trehalose-phosphate synthase [Mycobacterium sp. JDM601]MVANRLPIDIEVLPDGTTAYKRSPGGLVTALEPLLRKRRGAWVGWPGSPD
GPAEPIDIEDLRLHPVALSATDIADYYEGFSNATLWPLYHDVIVKPIYHR
QWWERYVDVNRRFAEATSEAAGPGATVWVQDYQLQLVPKMLRSLRPDLTI
GFFLHIPFPPVELFMQLPWRREIVDGLLGADLVGFHLPGGAQNFLFLSRN
LTGAATSRGAVGVRGRFGEVSLADRTVRVGAFPISIDSGDLDHKARERGI
RRRAKEIRAELGHPRKILLGVDRLDYTKGIDVRLKAFNELLAEGRAKRDD
TVLVQLATPSRERVESYQILREDIERQVGHINGEYSEVGHPVVHYLHRPV
PRDELIAFFAASDVMLVTPLRDGMNLVAKEYVACRSDLGGALVLSEFTGA
AAELKQAYLVNPHDLEGVKDAIEAAINQTSEEGRRRMRALRRQVLTHDVD
RWARSFLDSLAETAE
333992259YP_004524873.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MATSETTSAQAGDLVDYEILDDGRIARIWLNRPETHNAQNRTLLVQLDEA
FGRAEADDAVRVVILAARGENFSAGHDLGSEAALAERRAGPGQHPSFRSH
GGTREPVVEKTYLQEWHYYFSNTCRWRELRKITIAQVQGNAISAGLMLIW
ACDLIVAADDARFSDVVGVRLGMPGVEYYAHPWEFGPRKAKELLLTGDSL
DADEAYRLGMVSKVFSVEELEDKTLEFARRIAQLPTMAALLIKDSVNAAA
DAMGFSEALRHGFHIHQLGHAHWAAHNDNKFPVALPPEVPDWRTAKATDV
ARRDQP
333992257YP_004524871.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MGVYAVTGSASGMGQQAAEKLRAAGHRVIGVDLRDADVIADLSTADGRAA
GGEAVLAACEGRLDGAVLAAGVGPAPRATPLILQVNYFGVVELLEAWRPA
LAAAGAAKVVVVASNSTTTVPAVPRSAVRALLAGKAAKATRRLRLLGPGA
PSLAYAASKIAVSRWVRRRAVEPSWAGAGIRLNALAPGAIMTPLLERQLA
TPGQQKAVRSFPIPVGGFGDPGRLADWMLFMLSDAADFLCGSVIFVDGGS
DAYFRSDDWPRSVGLSRLPRYLMRFRAFRGATPPAH
333992255YP_004524869.1 hypothetical protein JDM601_3615 [Mycobacterium sp. JDM601]MGFRPYTDLVGLAKQLIAVSTAPARIGLSIADAGLGVATAALGLARQTLG
EPETHGPANSMAQMLGLEDAIARANRLAKLMDDDAPLGRALAPGGPADRL
LAPGGLVDQLTGPGGVLDRLTAEGGGLQRALQPGGLVDQLTDENGLIERL
LSEDGLADRLLAEGGLIDKLTARNGPLEQLANVADTLSRLAPGMEALEPA
IETLQEAVIALTMVVNPLSNIAERIPLLPRRSSRRPPPPRTVRSQRVVDP
DPTDLERPTEPH
333992253YP_004524867.1 two-component system response phosphate sensor kinase PhoR [MycobacMAKPPRGILPLRVSLVAATLAMVAIGLLAQGYAVTTILRHRLISRIDATL
IDAAHGWALEQRGRSPVKADEDPNPGRPPTSFYVRDVDPDGSVWTVVNDQ
NAEPLLPPDNDVGSVPVTIGSVDGSGVQWRALSVHAESGRLITVARDLSD
PRATLRYLAWSRVAIGVGVLLVLGAAGYLVVNRSLRPLAEVERTAAAIAA
GQLDRRVPERDPRTEVGRLSLALNGMLAQIQQAVASSIASADNARVSEER
MRRFITDASHELRTPLTTIRGFAELYRQGAARDVELLMSRIESEARRMGL
LVEDLLLLARMDAQRPLERRWVDLLVLATDAVHDARAIAPDRAIELEVFD
GPGTPEVLGDEARLRQVLSNLMSNALEHTPEDAAITVRVGTAGGDAILEV
VDQGPGMSEEDVQRAFERFFRTDSSRARVSGGTGLGLSIVDSLIRAHHGT
VTVSSPPGHGCTFRVAVPRLAETAAQPAELPAEIN
333992251YP_004524865.1 hypothetical protein JDM601_3611 [Mycobacterium sp. JDM601]MSAVTTFLSSPEAVGVWSLDTEQSSIRFENGTMWGALKVRGAFTDFSGSG
EIKDAKTVSGRIDIKAASIDTGLGTRDHDLRRSNFFDTDHYPDITIVVKS
GEPAGGDAARLNADLTVKGITGPLPLKVDITPLGDGGVRLTTETTVTRKQ
FAVEGNFLGMVGNKTKLKASVVFRKV
333992249YP_004524863.1 cytochrome P450 [Mycobacterium sp. JDM601]MFVLTSTQPACPFGPGFDFTDPDVLLHGMPIAQFAELRKTAPVWWNEQPA
HSNIFDDGGYWVVSKHQHIKEISRDNEVWSTNAKGAVMRLPDGITADQLE
LTKALLINHDPPEHTRLRKLVSRLFTPRSVGALEEKLAQSARDIVAAAAE
KDSGNFVDDIAMKLPLLAIADLIGVPEADRERLFHWTNSIMNTDDPDFDS
DPAMANAELMGYAYTMAEQRRRCPADDIVTRLVQADMDGESLGETEFAFF
VILLAVAGNETTRNAMTHGINAFAENPDQWELYKRERPETAVDEIVRWAT
PVHCFQRTAKIDTELGGVAISKGQRVGLFYSSANYDEEVFERPFAFDVLR
DPNPHLAFGGQGTHYCIGANLARMEIRLMFDEIANQLPDITKLAEPQRLR
SGWINGVKDLQVAYHG
333992247YP_004524861.1 hypothetical protein JDM601_3607 [Mycobacterium sp. JDM601]MAIRVALIGTGNAGRIALRGLISNPAYELTGVWVSTAAKVGKDAGELAGL
DVHTGIAATDDVDAIIAAKPDAALYCAMGDTRLPGALRDVCRLLAAGINV
IGTAPGVLQYPWGVIPDKFIAPVEEAAQQGNSTVYVNGVDPGFINDLVPL
AFASTCQHVEQIRCLEIADYATYDGAEVMFDVMGFGSSLDEVPMLLQPGI
LSVAWGAAIRELANGLGVTLDAITDSSEREPAPEAFDIAAGHIPKGGVAA
LKFEIRGIVDDRPLIVVEHVTRLRSDLRPDWAQPAQPGGSYRVEITGEPS
YTVDIRPTSRHGDHNYAAIAAGVGRVVNAVPAVVAAPPGIVTTLDLPLVT
GGTQIITESSKG
333992245YP_004524859.1 ferredoxin [Mycobacterium sp. JDM601]MAFRVKVDLDLCQGHAMCELEAPDYFRVPKRGKVEILNDEPPESDRRQIE
EAVRACPTRALSIEEKKD
333992243YP_004524857.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MPRFDPPPARRPAIVAGASSGIGAATAEELARRGFPVALGARRADKLAKL
VDTIRADGGEAVAFPLDVTDPDSVKSFVASSIDALGEIELLVSGAGDMFP
GRIHEMSTEAFNDQIQVHLIGANRLATTVVPDMVARRRGDVIFVGSDVAL
QQRPHMGAYGAAKSALVAMVNNMRMELEGTGVRASIVHPGPTMTEMGWKL
SAEQVGPMLQDWAKWGQARHSYFLRPADLARAIAFVAETPRGAHVVNLEV
QPEAPLHDTDSDRQHLQLGEEGMPQT
333992241YP_004524855.1 hypothetical protein JDM601_3601 [Mycobacterium sp. JDM601]MAAVTPANGAPAVPSTVAGAPGTRNRRQEETFRKVLTAGVEMLREKSYAD
LTVRAVAARAKVAPATAYTYFSSKNHLIAEVYLDLVRQVPYFTDVNEPMP
SRVNQALRHLALVVADEPEVAAACTAALLSGSGDPAVRTVRDRIGAEIHR
RIVSAIGPGADPEKVSALEMTFFGALVNAGSGAFTYHQITDRLSYVVSLI
LESGASR
333992239YP_004524853.1 dehydrogenase/reductase [Mycobacterium sp. JDM601]MGQFDDKVAIVTGSGGGIGQAYAAALAAEGAAVVVADINLEGAQNVAKQI
VADGGKALAVEVDVSDPESAQAMADAAVNEFGGIDYLVNNAAIFGGMKLD
GLLTVPWDYYEKFMRVNLDGALICTRAVYEHMAERGGGAIINQSSTAAWV
YANFYGLAKVGVNGLTQQLSRELGWRNIRINAIAPGPIDTEANRSTTPQA
IVKQMVQQLPLARMGTPEDLVPMCLFLLSDQASWITGQIFNVDGGQIIRS
333992237YP_004524851.1 4-carboxymuconolactone decarboxylase [Mycobacterium sp. JDM601]MDELRRTGLEKMNEVYGWEMPNIEGDPYFDLTVDHLFGSIWTRPGLSMRD
KRIMTLTAVTAIGNRNLAEIQINAALLNGELTEAELKEMAVFVTHYLGFP
LGSALNGAVDAVVARRKKAAAKGQAEDKKANVDAAVKMHGGG
333992235YP_004524849.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MTDETLLSGRAAVVVGGSRGVGRAVADLLAACGAGVVVNGRDPDAVDGTV
AAITGSGGRAVGVAGAANAEATATALMAACRDEYGSVDVLINCAGIAEPP
GSSILSISGAQFQELLDAHLGTAFHTCRAAAPIMAEQRRGSIVNSGSVAF
LGDYGGTGYPAGKGAINSLTLAMAAELAEHGVRANVVCPGAKTRLSTGAD
YEQHIRDLHARGLLDEFTMQASLDPAPTGYVAPLYTYLASDLASTVTGSV
FLASGGFVGRFDRPAPAVLGYRDHHGSSPWSIAELHAMVTGS
333992233YP_004524847.1 hypothetical protein JDM601_3593 [Mycobacterium sp. JDM601]MSANFSDQQVADAKKDVCAAAVLARQAVANNMHLKNPDPENPVAQLAVAA
NARLSLTAGAAYLRGRVEEKAAVSQDIAEAARAMAGELEHLNLSYLVGQP
NSEREQLGRDLDARIAALGKLCQ
333992231YP_004524845.1 hypothetical protein JDM601_3591 [Mycobacterium sp. JDM601]MMAAMPGLSRRAALRLGATVGAAGALGVSSLVGVRPARATPTLPTMTTGS
FASAARGGISTNWAIARPPGQTESLRPLIALHGKGSDAATVMAGGVEQGL
AEAVAAGLPPFAVVAVDGGGSYWHRRTSGEDSGAMVTDELLPLLADQGLD
TSRVAFIGWSMGGYGALLLGGRLGPRRTAAICAVSPALWLSPGAAAPGAF
DGAADFTANSVFGMPALGSIPIRVDCGDSDPFYSATRAFIDQLPNPPAGG
FSPGGHDESYWSSQLPAELTWAAPLLTA
333992229YP_004524843.1 NAD(P) transhydrogenase PntA [Mycobacterium sp. JDM601]MNIGVLSEAQPGETRVSATPTTVAQLIKLGYEVVVDAGAGEASSFTDAAY
VEAGATIGDARAADIVFGVNAPATEQLDAMKPGATLVSLLAPALNPDRVE
DLARRPITALSMDAVPRISRAQSLDVLSSMANIAGYRAVVEAAHVFGRFF
TGQVTAAGKVPPAKVLVVGAGVAGLAAIGAAGSLGAIVRATDPRPEVADQ
VKSLGGEYLSIEDPEAEVSATGYAKEMGDSYKAREAELYAEQCKDVDIII
TTALIPGKPAPRIITADMVASMSPGSVIVDMAAANGGNVEGTVADQAVVT
DNGVTIIGYTDLAGRLPAQASQLYGTNLVNLVKLMTPGKDGQLVLDFDDV
VQRSMTVVRDGESTWPPPPVQVSAAPAKATEAAPVVKQESKAPMTAGRRL
GLVVAAAAVLFALVALAPAALQVHLTVFALAIVIGYYVIGHVHHALHTPL
MSVTNAISGIIVVGALLQIGHGDPAITALATAAILLASINVFGGFAVTRR
MLAMFSRS
333992227YP_004524841.1 adenylosuccinate lyase [Mycobacterium sp. JDM601]MSIPNVLATRYASAAMTDIWSPRAKIVAERRLWLAVLRAQAELGVPVPEK
AIADYEAVLENVDLESIAARERITRHDVKARIEEFNTLAGHEHVHKGMTS
RDLTENVEQLQIRQSLELVFSHGLAAVARLVSHAVAYRELVMAGRSHNVA
AQATTLGKRFASAAQETLIALQRLEELIGRYPLRGIKGPMGTAQDMLDLF
DGDTAKLAELERRVAEFLGFSTVLTSVGQVYPRSLDHDVVSALVQLGAGP
SSLAHTIRLMAGHELVTEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLR
GYASMAAELAGAQWNEGDVFCSVVRRVALPDAFFAIDGQTETFLTVLDEF
GAYPAVITRELDRYLPFLATTKVLIAAVRAGMGREAAHEVIKEHAVAVAL
AMRERGAEPDLLDRLAADERLPLDRAALDVAIADRQAFTGAAADQVDQMM
AEVTALVERYPSAAGYVPGAIL
333992225YP_004524839.1 K+ transport system NAD-binding component [Mycobacterium sp. JDM601MPNSLHLLAFWTRRPNKPRPKPIRVPTTVETTEVIFLFMRRMRAPFIVVI
AMFSVCTTGLMLMPGVDAQGNPYRLTVFDAFYQMTITLTTVGYSEVPHAF
SYPQRMWLSMSIYLVVISWAFAIGVFFSVINDTAFQDAIAAQRFRRQVRR
MVEPFVIIAGYGQAGRAVGAELDEHGRRFVVIDKQESRVASVTSGQLSSD
VPAIEGDCASPPVLGVAGLAHRDCEGVLALTNDDDANLAVVMTVALLRPE
VPVFTRCSDPKIQARIERFAPAGIINPADRFGDYLALSIHRPVNHQLLRW
LMDNEEDQLPPLRRGLATGRWVVCADPEFGDELVRDLTASGLAVDLVDPA
EDELDVADAVGFIAGTNSDTTNIAVAEQARLANADVYLVVRQQTNAKKAL
LDALQIDSVYIAPELVAREVLARTLTPVFWSFVEHAFGRDEAWATRVRDH
LQETCGRRTPSRDVIVLSAEQAPAIADWLRRGETLTLGDLIRRPDDREVR
LPLAALVLMRDGAPTFMPDPDTTLALDDQVLLVGKPEGLSQVREVCNYPA
TVEYLATGRDVPLTWVWARLTARMRRRADAARPH
333992223YP_004524837.1 transmembrane protein [Mycobacterium sp. JDM601]MTSRLLPYATSPGRLLAQLFSDAIVAVWTFLWVLVALAVHGAVATIAGVG
RQFEQGANGVAESLASAGHSADRIPLVGDAVSKPLTAAGEAAVDIAGAGH
NLNTTAGWLAYLLAIAVAAPPILAVAMPWLALRLRFFLRKRAVLALAATP
AGLQLLALRALANRPHRALTAVSPDPVGAWRHQDLPVIAELAAVELRSAG
LARHPRSLSAAS
333992221YP_004524835.1 phosphoribosylaminoimidazole- succinocarboxamide synthase PurC [MycMSRPALSDYQHLASGKVRELYRIDDHHLLFVATDRISAFDYILDSQIPDK
GRILTAMSVFFFDLVDAPNHLAGPPDDPRVPEEVLGRALVVHELQMMPIE
CVARGYLTGSGLLDYQRSGSVCGIPLPPGLVEASKFANPLFTPATKAEIG
EHDENISFARVIDLVGPVRAGQLRDRTLQVYLQAADHALTKGIIIADTKF
EFGVDEHGNLLLADEVFTPDSSRYWPADHYQAGVVQESFDKQFVRNWLTG
PGSGWDRAGTEPPPPLPDEIIAATRARYIEAYERISGLSFDDWVGPAA
333992219YP_004524833.1 glutathione [Mycobacterium sp. JDM601]MSLADIPLTTLDGQSTSLADYADRAVLVVNVASKCGLTPQYSALEKLARD
YADRGLTVLGVPCNQFMGQEPGTAEEIQNFCSSTYGVTFPLLAKTDVNGD
DRHPLYAELAKTADADGTAGDVQWNFEKFLLAPGTVVANRFRPTTVPDAP
EVIAAIEAVLPS
333992217YP_004524831.1 hypothetical protein JDM601_3577 [Mycobacterium sp. JDM601]MTGQLIVSVSGIGARSRADAEAFCAQLDTRAVPVSLLVAPRLGADYRLDR
DPGTVDWLTQRRTAGAAIVLHGFDEAATKKRRGEFATLPAHEANLRLLGA
DRVLEHLGLRTRLFAVPGWTVSPGTVLALPRNGFRLLAGLHTMTELVLDC
AVRARVVGIGAGFLTAPWWCRMVVATSERVARRGGVVRLSVGARQLSQPG
VVAAMLDAVDTALGYGCRPVPYRWPVAADVADVASELSA
333992215YP_004524829.1 Zn-dependent hydrolase [Mycobacterium sp. JDM601]MRLTHFGHSCLLADFVDTTVLFDPGTFSHGFEGITGLTAILITHQHPDHV
DTQRLPALIDANPEAALYADPQTAAQLGSPWRPVHVGDSFELGSVRVRGV
GGQHAVIHPELPMIDNISYLVGDAGHPARLMHPGDALFVPGEPVDVLAAP
AAAPWMKIAEAVEYLRAVAPRAAVPIHQGIIATDARGIYHGRLAEMGRTD
FQVLPPESAVAF
333992213YP_004524827.1 phosphoribosylformylglycinamidine synthase I PurQ [Mycobacterium spMSIRVGVITFPGTLDDIDAERAVRFVGAEPVSLWHADADLKGVDAVVVPG
GFSYGDYLRAGAIARFAPVMGEVVDAAKRGLPVLGICNGFQVLCEAGLLP
GALTRNAGLHFVCRDVWLRVASNQTAWTSRFDADADLLVPLKSGEGRYVA
PPQVLDELEGEGRVVFRYLDNINGSLRDIAGVSSANGRVVGLMPHPEHAI
EALTGPSDDGLGLFYSALDAVLAA
333992211YP_004524825.1 hypothetical protein JDM601_3571 [Mycobacterium sp. JDM601]MTCAAIFLVATIEEGGEAAVHEALPDLAGFARAIGFRDPTKRLALVTSIG
SDAWDRLFTGARPAELHPFVELTGPRHTAPGTPGDLLFHIKGETMDVCFE
LAGRIVKAIGDGITVVDEVHGFRFFDNRDLLGFVDGTENPVGDEAVEATA
VGDEDPDFAGGSYVHIQKYLHDMAAWEALPVTEQERVIGRTKADDIEFDD
AVKPANSHIALNVITDEDGNELDIVRHNMPFGTVGSGESGTYYIAYARSP
EITEQMLRNMFLGDPPGNTDRILDFSTAITGGLFFTPTADFLDDPPPLPG
AAVPAPTESATPVETAGPGVDGSLNIGSLKGISQ
333992209YP_004524823.1 phosphoribosylformylglycinamidine synthase II PurL [Mycobacterium sMAVTPGPAIDTVEHAAATPDHPQPFAELGLKDDEYQRIRDILGRRPTDAE
LAMYSVMWSEHCSYKSSKVHLRYFGETTTDEMRKAMLAGIGENAGVVDIG
DGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLR
FGAADAPDTRRVLDGVVRGIGGYGNSLGLPNIGGETVFDPCYAGNPLVNA
LCVGVLKKEDLHLAFASGTGNKIILFGARTGLDGIGGVSVLASDTFGGDE
TGSGRKKLPSVQVGDPFTEKVLIECCLELYAAGLVVGIQDLGGAGLACAT
SELASAGDGGMAVELEKVPLRAANMTPAEVLSSESQERMCAVVAPENVDA
FMAVCAKWEVLATVIGEVTDGDRLQITWHGQTVVDVPPRTVAHEGPVYHR
PVQRPDTQDALNADRSDKLPRPASGEQLRATLLALLGSPHLCSRAFITEQ
YDRYVRGNTVLAEHADGGMLRIDEASGRGITISTDASGRYTKLDPYAGAQ
LALAEAYRNVAVTGATPVAVTNCLNFGSPEDPGVMWQFAEAVRGLADGCA
ALGIPVTGGNVSFYNQTGATPIHPTPVVGVLGVIDDVNRRLPTAFGVEPG
ETLLLLGDTRDEFDGSIWAQVTGDHLGGLPPKVDLQREKLLADVLCAASR
DGLVSAAHDLSEGGLIQAVVESAIAGETGCRILIPEGPEAVDPFVFLFSE
SAGRVLVAVPRTEESRFRSMCEARGLPVARIGVVDQVSQQVEVQGQFSVS
LAELRSTSEAVLPGIFG
333992207YP_004524821.1 hypothetical protein JDM601_3567 [Mycobacterium sp. JDM601]MPAAADPAQTRAAVLAVAAWLRDETLPAPDRTALAAAVRLTARSLAEAAP
GASVELRVPPFVAVQCVAGPRHTRGTPPNVVETDPRSWLLLAAGLLSTAE
ATAAGKLRLSGSRAAEIAGWLPLVKLDAC
333992205YP_004524819.1 dioxygenase [Mycobacterium sp. JDM601]MARFPKPPEGSWTQHYELGTEPVSYRDSISPEVYEKERAAIFQRAWLNVG
RVEQLPRKGSYYTKELKVANTSIIVARTTSDEVKAYHNVCRHRGNKLVWD
TMPLEETSGNCRQFTCKYHGWRYDLDGNLTYVQQEEEFFDLDKSRYGLVG
VHCEVWEGFIFVNFAAEPEQSLREFLGPMVTALEGYPFGKMTSRWQYRSE
VNSNWKLFLDAFQEFYHAPVLHGNQTPVAFRVAAEEAGFEAPHYRLEGPH
RLVSTSGVRAWEMSAEMRKPIEDICQSGLFGPWDPPDIGPVPDGLNPANC
DPWGLDSFQIFPNFTILFWGQGWYLTYHYWPTSHESHIFEGTLYFPQPRT
PRERVAQELAAVSFKEYGLQDASTLEATHTMLGTGAVDHFLLNDQEVLIR
HFHHETARWIAEYEHANAKV
333992203YP_004524817.1 imidazolonepropionase [Mycobacterium sp. JDM601]MSESGTTVLRAARWLDIDAGVLRSPAVIVIEDGRIAAINPEAPVADSAED
IDLGDVTLLPGLMDMELNLLIGGPGSPEGLPTPMHGVQDDPVYRTLRAAV
NARTTLEAGFTTVRNLGLMVKTGGYLLDVALQRAIDQGWHVGPRIYPAGH
AVTPYGGHLDPTVFQRLAPGIMPLSVAEGIANGVPDVIACVRYQIRHGAK
LIKVSASGGVMSHSTSPGAQQYSDAEFAAIADEAHRAGVRVAAHAVGDVA
IQACIRAGIDCIEHGFLASDETIAMMVDHGTFLVSTTYLTDAMAVDRIAP
ELRKKAAEVFPRAKAMLPKAIAAGVKIACGTDAPAIPHGQNAKELAALVQ
RGMSPVQALRAATTTSAELIDAEHELGRLAPGYCADIIAVPGDPTRDIAV
TGDVRFVMKDGRVFKRS
333992201YP_004524815.1 von Willebrand factor A [Mycobacterium sp. JDM601]MSAPGPATPDRFKFIAGYLAGRSVEVAQAPAGEAAHTNGHAIFVSAGASA
ATQRREILVQGALLGAGSLEPRLVKALRARPSVARRYLALEGDRVLSDVA
TRLPLAAALRSGSPPRTATADESLRLARTRVNIADPPEWFGVIKPARLLQ
SAGTAGAKAADADLRFELDATDAPADGDDDEADAGESKILKLFDNPVFNA
QALSEFLRKLLGGSRSGDSNSGGELPARALRRTRSAGPNARPLPSRIRFT
DGKAAATAGIGGAWYPEWDVFSNTYRPDWCRVVNFPLTAAAPTSEAGVVH
DDVLRRRLSRVGLGPMVLRGRPDGDELDLEALVDVFVDLRSGHSPPEHVY
TERRKLARNLGVLILLDASGSSTDTDPAGLAVHDHQRRAAATLAVTLEQL
GDRVAVYGFRSQGRHCVELPAIKTFGQRFGAVGRARLNQLQPSGYTRLGA
GIRGAAQILKAEAGTPNRLLLVLSDGFPYDVGYEGRYAEADVSKAIEELR
ADGLGCLCLTIGVTGEADRPVFGAAGHASATTLAELSPRMDELFSAALAE
LAAPKPGPRRSR
333992199YP_004524813.1 hypothetical protein JDM601_3559 [Mycobacterium sp. JDM601]MGSGVSSQQNVSVAARPESAGSRGGGAIRIWAAAGGALLALQLYVWARWI
TGPYFERVPVGPNDPPMYMKVPLMANAIVLWVGLPFAIWWFFIRPWRRER
RITLDGMLFLSIGLMFFQDPLLNYFNTWCTYNTWLFNRGAWTSHIPGWAS
PEEPGRQVAEPLLTNLPGYAYGVLLITIVGCAVMRKIKARWPGISNLRLI
AVTYAISFVFDFVMEGLVLLPIGLYTYPGAIRSVSINADTYYQWPVYEGL
MWGAVQAALCCLRYFTDDRGRTVVERGLDGVRGGFARQQFTRFLAIFAGV
SACFFAFYMGPAQWIALHADPWPQDHQKRSYFTGGICGDGTDKPCPHPAL
PMPSNRSGYINVDGQLVMPDGVSVPPIVPFEPGK
333992197YP_004524811.1 3-oxoacyl-ACP reductase [Mycobacterium sp. JDM601]MTTEVSPRVAVVTGGASGMGEATCHELGRRGYRVAVLDVDDQAAQRVTDD
LRGRGVTALGVGVDVTDRVAVDDGLAKVRSQLGPVAALVTSAGVFGYSAF
ADITPPEWARIIDVNLTGTFHCCQAALPDMVEAGWGRIVMISSSSAQRGT
PFAAHYAASKGAVITLTKSLAREYAGHGITVNNIPPSGIETPMQHQSQAA
GHLPPNEQIAANIPLGRLGTGADIAAAVGFLCSEEAGFITGQVLGVNGGS
VM
333992195YP_004524809.1 hypothetical protein JDM601_3555 [Mycobacterium sp. JDM601]MTAKKLPSAFAELERFAETWCLPTETERFSQRLASTIPELRVFYDAFFPR
LEEAIDYCDKFALDELPEDALNLLHLIYSLVMVAMAVEVMHQPAPVDAAD
AVMIRTGWPVP
333992193YP_004524807.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MTELSTESELFVATARAFLDKTAAISAQRELHAQGRSYDPAWWKRAAELG
WAGLLVPEELGGGSVSESGLHDLVAIAEAIGRTVGPGPLYPVSTVLAGLI
DADNADALAGSIAALVAGEQVATWAADEPGRGFRPQAPSATATPTAKAGG
TGYRLNGVKDRVEAGAQADLILVGARTDDGALRQFLICSDAPGVTVRPQN
CVDLVKQYARIEFDDVEAEAVVGTAAQTAALIDRQTQVGIALACAESVGI
LDAVLALTIEWCRDRYSFGRPLASYQALKHRLADMTMWLHAARAITAGAV
DKIAARAPDAGMWASAAKSYLGEHAGLLVQECIQLHGGIGVTWEHDLHVY
LRRITLYSNLLGTPDEHHRAIFTAANTTEPAA
333992191YP_004524805.1 5'-phosphoribosyl-5-aminoimidazole synthetase PurM [Mycobacterium sMTDPAAHSSAQGVTYASAGVDIEAGDRAVELFKPLAARATRPEVRGGLGG
FAGLFALRNDYREPLLASSTDGVGTKLAIAQAMDKHDTVGIDLVAMVVDD
LVVCGAEPLFLQDYIAVGRTVPERVSAIVSGIAEGCVQAGCALLGGETAE
HPGLMEPDHYDISATGVGVVEADDVLGPDRVRPGDVLIAMGSSGLHSNGY
SLARAVLLDIDRMNLAGHVEEFGRTLGEELLEPTRIYAKDCLALAAETQV
RTFCHVTGGGLAGNLARVIPDGLIAEVDRGTWTPAPVFGMIAQRGRVSRA
EMEKTFNLGVGMVAIVAPEDTDRALAILTARHVDCWPLGTVAKAGKSARA
GAGAKLVGQHPRF
333992189YP_004524803.1 hypothetical protein JDM601_3549 [Mycobacterium sp. JDM601]MPAVPAPDSGPDAGAIWHYGDPFGEQRCAQTEAVLVDRSHRAALTVSGSE
RQTWLHTLCTQHVAELADGATTENLTLDGKGRITNHWVQTELGGRTYLDT
EPWLGDPLTEHLRKMVFWADVTIQPADLAVLSLLGPRLADPAVLDALGVA
APPGEAAVAIGDADGFVRRGPGEHALELLVPRAEKGDWQRRLARAGVKPA
GIWAYEAERVAARRPRLGLDTDERSIPHELNWIGGPGVGAVHLDKGCYSG
QETVARVHNLGKPPRMLVLLHLDGSVDRPSTGDPISSGGRPVGRLGTVVD
HFELGPIALALLKRGLSAETPLSTGPDGQVSAVIDAESMPPPDAPGAGRV
AVDRLRGRA
333992187YP_004524801.1 hypothetical protein JDM601_3547 [Mycobacterium sp. JDM601]MSAPDGDAQGGGDRPAIPGSGDRAIAAAAERAARTAARNIPVFEDLPVSD
TANLREGADLHDALLALLPLVGVWRGEGVGHHAHGDYRFGQQIVVSHDGG
DYLNWEARSWPLDDAAELTGPALRETGFWRFNSDPGDPEESQAIELLLAH
SSGYVELFYGRPHGPASWELVTDALARSKSGALIGGAKRLYGIVADGDLA
YVEERVDADGELVPHLSARLARFVG
333992185YP_004524799.1 thiosulfate sulfurtransferase [Mycobacterium sp. JDM601]MARSDVLVSTDWAESNLDAPGTVFVEVDEDTSVYNTNHIPGAIRLDWRTD
LQDPVRRDVVDAAGFSKLLSERGVGNDDTVILYGGNNNWFAAFAYWYFKL
YGHESVKLLDGGRKKWELEGRPLSGEQVTRPATSYTAKPLDESLRARRDE
VIAAINTKNLIDVRSPEEFSGKILAPAHLPQEQSQQRGHIPSAINVPWSR
TANEDGTFKSDEELAKLYAAAGLDGEKETIAYCRIGERSSHTWFVLHELL
GHRNVKNYDGSWMEYGSLVGASIELGS
333992183YP_004524797.1 thioredoxin [Mycobacterium sp. JDM601]MSVVAMLTGLLLAGVIGWWMSRRAGALKAVAATAPEIGADDGGAAFLGLQ
PGRPTVVHFSAPWCGPCAGVRRVVQTVCDDLGGPGEIAHREVDIDTNPAA
ARRFSVLSLPTTLIFDAAGRQRYRAAGVPTAAALRSALEPLLA
333992181YP_004524795.1 transcriptional regulator [Mycobacterium sp. JDM601]MELLLLTADLHPEVVLPSLSLLAHTVRTAPPEVSALLEAGSAEVVIVDAR
TDLAGARGLCRLLSTTAGSVPVIAVVTEGGLVAVNAEWGIDEILLPGTGP
AEVDARLRLLTGRRAAPAADQASGQTKLGELVIDEATYTARLRGRPLDLT
YKEFELLKYLTQHVGRVFTRAQLLQEVWGYDFFGGTRTVDVHVRRLRAKL
GPEYESLIGTVRNVGYKAVRPVRGNPAGASGDEDEAGEDLAADDGADSAG
DGAPESLASQ
333992179YP_004524793.1 phosphate ABC transporter substrate-binding protein [Mycobacterium MKPTTAGVALLAATLGLALSGCGSDDNSGGAAGAGASGSAECAGKSTLTA
EGSTAQQNAIAVFNQVWGKECAGKNLSYNPTGSGAGREQFIAGHVDFAGS
DSPLSEAQVEQAAARCDGNPAWHLPLVFGPISMAYHLDGVEHLVLNADVL
ARIFSGSITSWDDPALVALNPGVELPAIAITPIYRSDSSGTTDNFQKYLS
AAAPQAWTRGDGSEFQGGVGEGAQKSAGVVQAVQSTPGAIGYVEKGFADQ
ANLRSAMIDSGAGVVAATDEAAGAAIQSAAFVTEDSNDMRLDLRSLYGTK
QAAAYPLVLVTYEIVCSKGYDADTAAGVKSFLKAASTTGQEGLADVGYVR
LPDQLKRRLSSAIDAIQ
333992177YP_004524791.1 phosphate ABC transporter permease [Mycobacterium sp. JDM601]MLIIVLITAVGGFLLLRAVPALQRNKENFFTYGGNWVTTDTSAMHFGVAE
LLQVTVFVSVFALLLAMPVALGVAIYLTEYAPRRLVGPLAYMVELLAAVP
SIIYGAWGLYVLAPQLRSTAQWLNDNLGGFFLFATGNASVAGGGTVFTGG
IVLAVMILPIITAVTREVLAQTPRGQVEAALALGATRWEVVKVVMLPFGR
SGYISAAMLGLGRALGETVALLIILRATQTSFNWSLFDGGYTFATKIAAT
ASEFNDQYKAGAYIAAGLVLFVLTLVVNALARAAITKKVH
333992175YP_004524789.1 phosphate-transport ABC transporter ATP-binding protein PhoT [MycobMDLTDLNIYYGAFHAVADVTLSVAPRSVTAFIGPSGCGKSTVLRTLNRMH
EVISGARVDGSVLLDGEDIYGPSIDPVGVRKAIGMVFQRPNPFPTMSIRD
NVVAGLKLQGVRNRKLLDETAEHSLRGANLWNEVKDRLDRPGGGLSGGQQ
QRLCIARAIAVQPDVLLMDEPCSALDPISTMAIEELIAQLKQDYTIVIVT
HNMQQAARVSDQTAFFNLEAVGKPGRLIEIDGTEKVFSNPSCKETEDYIS
GRFG
333992173YP_004524787.1 serine/threonine-protein kinase [Mycobacterium sp. JDM601]MDSREASSLVGTQFGPYLLLRLLGRGGMGEVYEAEDVRKHRSVALKLISP
PLSGDPMFRARMQREADAAGQLREPHVVPIHDYGEIDGQMFVAMQLVDGD
DLAAVLRRSGPMNPARAVAIIDQVAAALDAAHGNGVTHRDVKPENILITR
RDFAYLVDFGIARAATDPGLTQTGTAVGTYKYMAPERFGADEVTYRSDIY
SLACVLNECLTGVPPFRVDSVERLITAHLMEPPPRPSQLRPGVVPIALDQ
VVARGMAKNPWDRYSSAGDLANAAHDALTVAEQHRAAMIVRRGEEADRPV
SVAGIAVGGTTERPNGHPGQPGQTGGFDATMARPAAAESWRERPAPPQRS
TPERFESRSFAAAPRGHRRKWLLPAAVAAVVLAIAGVAGGYALSRESGST
TGVSADGQSVVPLEGLSFRLSPGGLALDGDDNLYITNQSMYGRVLKLVPG
SSNPEVLPFTGLYEPQGVAVAADGSVYVSDFNNRVVKLAPDTGEQTELPF
AGLNYPEGVEVDAQGSVYVADRGNNRVLKLPAGAGAQVVLPFTGLHHPDD
VAVDSNGNVYVTDTDNDRVVRLSAGSNTQTDLPFTGLSSPWGVSVDRADN
VYVTNHENHKVMKLDPVTNNQTKLPFSGLNTPLQVVVDADGAVYVADRGN
NRVVKLAAGS
333992171YP_004524785.1 phosphate ABC transporter permease [Mycobacterium sp. JDM601]MADNTSESSAPVSLPRKHGSGGERIFRALALSAGSTVVVAIALIAVFLLI
RAVPSLQANTANFFTTATFSTGGADGLAFGIRDLLVVTVLTSLLALVVAV
PISISIAIFLTRYAPRQLSRPCGIVIDLLAAVPSIIFGLWGIFVLAPMLY
PVTRFLNHHLGWLFLFAKGNVSLAGGGTIFTAGIVLAVMILPIITSVSRE
VFRQTPTAHIEAAQALGATRWEVVRIVVLPYGRSGVIAASMLGLGRALGE
TIAMLIILRAAPRPGNWSLFDGGYTFASKIASAASEFSAPLPTGAYIAAG
FALFVLTFVVNAAARAVAGGKVNG
333992169YP_004524783.1 phosphate-transport system regulatory protein PhoY2 [Mycobacterium MRTAYHEQLSDLAEQLGKMCGLAGIAMERATQALLQADLVVAEQVITDHE
KIAAMSARAEESAFVLLALQAPVAGDLRAIVSSIQMVADIDRMGALALHV
AKIARRRHPQHALPEEVNGYFAEMGRVAVDLGNSAQEVLLSRDPEKAARI
REEDDAMDDLHRHLFSVMMDKEWRHGVAAAVDVTLLGRFYERFADHAVEV
ARRVIFQATGKFPDENTLPPPD
333992167YP_004524781.1 transcriptional regulator [Mycobacterium sp. JDM601]MLTAQRRGLRIGSLTLASPVVLAPMAGVTNVAFRTLCRELEQSRAGTVSG
LYVCEMVTARALVERHPATLHMTTFSAAESPRSLQLYTVDPDTTYAAAKM
IADEGLADHIDMNFGCPVPKVTRHGGGSALPYKRRLFGNIVAAAVRGTAG
TDIPVTVKFRIGIDEATHTHLDAGRIAEAEGAAAVALHARTAAQRYSGKA
DWEQIAALKAQVRSIPVLGNGDIFEAGDALAMMAATGCDGVVIGRGCLGR
PWLFGELSAAFAGRPIPTPPTLGEVADIVRRHGELLASHFGEDKGMREIR
KHVAWYLHGFPAGSELRRGLAMVATLAELDALLKQLDGSIPFPTAATGPR
GRQGSPAKVTLPEGWLADPDDCTVPSGADIMHSGG
333992165YP_004524779.1 hypothetical protein JDM601_3525 [Mycobacterium sp. JDM601]MPSGQRRGRWSGVPLAERPALRRDEFIEAGVGLLGDENGPTLTIRSLCRA
AALTERYFYESFTDRDEFVRAVYDDVCTRAMTTLLSAQTPRAAVEAFVTL
MVDDPVRGRVLLLAPATEPVLTHSGAQWMPNFIGMLQRKLTRIGDPPLQH
MVATGLIGALTALFSAYLEGRLAATRSQFIDFCVDMLLNTGRPHDGGDNT
PPRT
333992163YP_004524777.1 dioxygenase [Mycobacterium sp. JDM601]MTDPVHNADSAEELSQPMTIGVEAYTSESYARAERDKLWRKVWQQAGRVE
DLPEVGSYLTYDILDDSIIVVRTGSTSGSDSFRAHHNVCQHRGRRLVDTP
AGEKNACARTRKSFVCGFHGWSYGLDGACTHIREQDDWQGTLTPENTHLR
PVRVDTWGGWVWINMDPDCESLADYLFPAAKILEPFGLENMRYKWRKWLE
FDCNWKVAMEAFNETYHVYTTHPEFNRFGEFKGWAKVQGRHSNIGYDAPE
DLETTKSKIRLGTGADPRVSTAEMQIYTMEETNATTTATLVNAAKRLVDE
LPEGTPAEKVLEHWLASARRDDEARGVIWPTIPADVLGQAGTAWQIFPNF
QIGQGLTSALCYSARPHPSYNPDKCIFEVSVFELFPKGEEPQTRWEYTPV
GDPRWRSVLPQDFSNMAAVQQGMKSLGYQGARPNPYRERAIVNLHHQLAK
YMAAGAPEQIPTGNDR
333992161YP_004524775.1 taurine catabolism dioxygenase TauD [Mycobacterium sp. JDM601]MTLQTTSTLPTRDLTERIATEVHADKAALLSGDHAGAIRELLERRGVLVF
PQIGFTDAEQIAFTETLGTLAPERDGEAVYDVTLDTNVNKQADYLKGSFY
WHLDGTMNQVPILASLLSSRVLPADGGGDTEFCNTYAAYDDLSEDDKDQI
ASLRAMHSAWNSLLYYDPEPDFATLRQMMAIGERELPVVWTHRSGRKSLI
LGCTASNIVGMDYAQSTKTLVRLRDWATQPQFVYRHRWSVGDLVMWDNTG
TMHRALPYDPNSGRMLRRTKLAGEEPFA
333992159YP_004524773.1 aldehyde dehydrogenase [Mycobacterium sp. JDM601]MREYLKFYIDGQWVDPVELTTLDVENPATEQVAGKIALGSAADVDRAVAA
ARRAFAGWSQSSRTERLDLLQSILAEYQRRSSDLADAVHEEIGAPPALAG
GTQVQLGLGHMLTAIDALKNFAFEEQRGDTLVVREPIGVCGLITPWNWPL
NQIAVKVYPALATGCTMVLKPSEVAPFSAYIFTEIMAAAGVPAGVYNMVN
GDGPGVGVALAQHRDVDMVSFTGSTRAGVAVAENAAPTVKRVTQELGGKS
PNIVLDDDAFAASVTAGVSVMMVNSGQSCNAPSRMLVPNSRMDEAIAIAK
AVAEQVKVGDPADAKAIGPVASAAQFAKVQGLIEQGIAEGATVAAGGAGR
PDGLDSGYFVRPTVFAHVNNQMTIAREEIFGPVLCILGYDDLDEAVEIAN
DTDYGLAGYVSGADLDAARGIARRIRAGSVAINHAFDMNAPFGGYKRSGN
GREWSDAGFHEYVEIKSTLGYGAAAG
333992157YP_004524771.1 acyl-CoA synthetase [Mycobacterium sp. JDM601]MSSGLRASSTAVLTFEDRQLPLPELDARAGALAAALAADGVTAGDRVALM
ASNRPEFVVAVQAIWRLGAVAALISPAWKRDEVAHALALTQPRYALGDQS
VLAELMPMRHLDDEIAPVTAVAPADDPPEPGADALLVFSSGTTGLPKAVR
HTHASLAAGVRHWRDALGLTADDRIQVVTPPSHILGLLNILTALSVGAQV
RLHRRFDIDVMLATIGQDRITVEMAVAPIALAIAAHPELESFDLSSLRYI
MWGATPITAAVAEQVTRRTGVSWVPAYGTSELPVLACSPTDGARGDEAVL
DTVGRPVPGVALQVVDMATGEPLPPGVPGEILARSESLMAGYLPDEATSE
VLRDGWFHTGDVGYLDAGGWLRITDRCKEMIKVRGFQVAPAEIEAVLHEH
PAVADCGVFGVPDERDGEAVVAAVALRAPVSEAELTELVADRLATYKHPR
RVVVVPEIPRLPSGKLLRRLLKERLWMSG
333992155YP_004524769.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MDFRDSPAEADFRNRLRSWLTERAGTFPAAGDDEYWARQGEWHQALYGAG
FFGVSWPREYGGQELPPVYDVIVDEELAAAGAPPRPSLGYLVVGLGRHAS
KELQQRFLPGMIDGTQRWCQGFSEPGAGSDLASLTTTATRDGDDYVIHGH
KIWTSYSDVADWCLLLARTDKDAPRHRGISAFIISMHQPGIEQRPLRMIN
GVTTEFGQVLFDGATVPASQLVGEPGEGWKLAMTVVGHEREPSTLGYSAR
YGKLVRQMAARVDRAGAEVPEELAWAAVETEMLRLHVRRRLSEQLDGLSH
GPEGSLDKLLMTWVEQSVGHAALAVGGVDDPDLLSAYLYSRAQSVMGGTS
QIQKNIIAGRILGLTE
333992153YP_004524767.1 transport system kinase [Mycobacterium sp. JDM601]MQIAELLVAARAGSVRATGRLLSLVESGRRTEVLSAVGPATTRVIGVTGP
PGAGKSTTIAALVGAYRERDLRVAVLAVDPSSPFSGGALLGDRIRMAAHI
NDPAVLIRSVASRGHLGGLAEAVPAAIQLLAGLGYDVLLLESVGVGQSEI
EIAAIAAPTIVVLNPGAGDAVQAAKAGLLEVADIVVVNKADREGAQQTVR
DLRVELKHTGAPILTLIASRGEGLGELVDTIEAHHRTDSRERRLARARSQ
ILSLAQTRLRSHPALGRLAESVVDGSDDPYSAAERLLSPEDE
333992151YP_004524765.1 aldehyde dehydrogenase [Mycobacterium sp. JDM601]MSVQTVLDDIRKVPGTGDVIPIIDPATEEQLTEFTDCGPEAVNDAVARAK
ATAESGVWSQMADYDRARVLWRIADLIDENAEILAELESVNAGIPAAQAA
IITKVGSEWFRYYAGWCTKIDGIARDVNTGGLTGIESHQHVYTLREPYDV
VGLIFPWNGPVFNFCAKLAPSLAAGCSSVVKPAEETPLSALVLDRILSEA
GVPDGVVNMVLGYGHTAGAAITAHPDVDKVAFTGSTEVGREIVRASAASN
LNKVTLELGGKSPVLIYDDADLDMAITMASFGTFVHSGQACVCGSRIFAQ
RGVYERVVEGVANMANSMQLGGPKDDGVMIGPLISQKQLTRVLGYLEQGR
SDGAELVTGGHRLDRKGYFVHPTVVTDVDPDSSRLFQEEIFGPVVTILPF
DDDDEAIALANNSTYGLAATAWTSNLGRAHRLAKRLKAGTVGLNCQMQFD
HSMPFGGYKQSGWGYESGKAGIETYLQTKVVWAQM
333992149YP_004524763.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MQLAFDSDVENFRAEFSAFLDEHLPTDAEALERSRSCSHVPEWARRWQRL
LFDNGWLLPGNPPEYGGRNATILQQYVHSEELSRRRIYPSFNPQGVGIIA
ASLLSFGTDEQKRRWAVPILRAEITASLGMSEPGAGSDLAGLQTRAVLDG
DHFVVNGQKVWTSGAHDADVLLTFVRTDPDAPKHKGISVLLIPTDTPGVV
RRPFASACDHDDVDFNEVFFTDVVVPAENLVGPLNGGWGVANGSLGHERT
LLWMSFADRLRDLIHDFRPAGALNRDRFATLLMDHQALQLLGSVALAQAA
RGEQDVPALSVLKLLGSEAVQTAAEHALDAAGSGGLSHPGSSGTYMPMNE
DYATAGWFDRYLRSFSGTIAGGTSEIQRNIIAQRVLGLPR
333992147YP_004524761.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MSALHDPAEFRTQLRAWLDANDLAPSEDDSLEAHMRQFARVQRALYEAGW
GRYGWPERAGGLGGPDVLRAIVGEEVVGRRLAEPGPYSMLEVLTPTMIDY
ARPELAAEMVPRLLRGDEQWCQGFSEPGSGSDLASLTTRAAPRGDQWVIN
GQKVWTSFAQHSQRCILLTRTGDADTPNHQAITAFFVDVDSPGIEVRPLQ
TMHGVDEFCEVYFDDVVVDGSRMLGKPGDGWQLAMDLLPYERSTCFWQRI
AYLYSRFDALIAAVKRQGAEIDSDLGAVYLALHTLRCRSRATQHRLADGH
RLGAETSIDKVLLAAAEQLLYDTARELLPGTIELAEGEWRTEYLYSRAAT
IYGGTAEVQRNIIARRLLELGKE
333992145YP_004524759.1 imidazolonepropionase [Mycobacterium sp. JDM601]MLTLKAAGLLDVDSGEIIRPGVIRVEGDRIVGIGDAAASDDEVLDLGDLI
LLPGLMDMEVNLLMGGRGENPGLSQVQDDPPTRVLRAVGNARRTLRAGFT
TVRNLGLFVKTGGYLLDVALGKAIDAGWIEGPRVVPAGHAITPTGGHLDP
TMFAAFMPGVLELTVEEGIANGVDEIRKAVRYQIKHGAQLIKVCCSGGVM
SLTGEAGAQHYSDEELRVIVDEAHRRGLRVAAHTHGAEAVKHAVACGIDC
IEHGFLMDDEAIAMLVEHDRFLVTTRRLAEAMDVSKAPPVLQAKAAEMFP
KARTSIKAAYEAGVKIAVGTDAPAIPHGRNADELVTLVDWGMPPAAVLKA
ATVTAAELINAADRGRLAEGLLADIIGVPGDPLSDITVTRNVQFVMKGGQ
VYVNKN
333992143YP_004524757.1 dioxygenase [Mycobacterium sp. JDM601]MAHFPKPAAGSWTQAYPELGTEPVDYTDSFDPAHFADEQEAIFKRTWLHV
GRVERLPKTGSYFTRELPSVCKGTSIIIVKGKDGVVRAFHNICRHRGNKL
VWNDFPNEETEGTCRQFTCKYHAWRYSLDGDLTFIQQEGEFFDVDKSQYG
LVPVRCEVWEGFIFVNFDDNAGPLNEYLGSLAKGLEGYPFAEMTEVYSYK
SEIGSNWKLFLDAFVEFYHAPILHQGQYTKEEAAKIQKYGYEALHYELAG
PHSLQSTWGGQSPPADLNMVKPLDRALRSGLFGPWDKPDLIADLKELPPS
VNIKRVPQWGIDSFVFFPNFMILIWEPGWYLTYQYWPTAADKHTFEASLY
FVPPRNARERLAQELAAVTFKEYALQDANTLEATQTMIGTKVVDDFLLCD
QEVLIRHLHKTARDYVSEYKKEHANGATV
333992141YP_004524755.1 metal-dependent amidohydrolase [Mycobacterium sp. JDM601]MNKDDMILVSVDDHTVEPPDMFANHLPRKYLDDAPRLVHNADGSDTWQFR
DVVIPNVALNAVAGRPKEEYGLEPQGLDEIRPGCYNVDERIKDMNAGGIL
GSICFPSFPGFAGRLFATDDPDFSVALVQAYNDWHIDEWCGAYPGRFIPM
GLPVIWDAEKCAAEVRRVSKKGVHALTFSENPAAMGYPSFHDPYWDPLWK
ALCDTDTVLNVHIGSSGKLAITAPDAPMDVMITLQPMNIVQAAADLLWSK
PVKDYPDLKIALSEGGTGWIPYFLERVDRTYEMHSVWTGQDFGGKLPSEV
FREHFLTCFISDPVGVKLRHDIGIDNIAWEADYPHSDSMWPGAPEELWDV
LSANNVPDDDINKMTHLNAMRWYSFDPFAHIPRDQATVGGLRKAAAGHDV
SIRALSQHKHGERQVNALMDAARSNS
333992139YP_004524753.1 ferredoxin [Mycobacterium sp. JDM601]MKAWVDPDRCAGHGICTTICPEVFAINDDGYSEVTVDEVPAHLEDAVRDA
IKQCPEHAIDDVTDSQEES
333992137YP_004524751.1 ferredoxin FdxD [Mycobacterium sp. JDM601]MTNRKVVVDYGLCEANAICMGINPDVFHLDDDDTLHILRPDITPETENDV
LEAVRRCPRQALSIVEDGD
333992135YP_004524749.1 3-hydroxyisobutyrate dehydrogenase [Mycobacterium sp. JDM601]MRVGFIGLGSQGAPMARRIIEGGYSTTLWARRAATLEAFADTEARVADSP
ADLGHASDLVCLCVVGDADVEQVVQGENGVLAGMQRGGVIAIHSTVHPDT
CRRLAEHCARQGVSLIDAPVSGGGPAAEAGTLLVMAGGDEEVVQRCRPVF
DTYADPVVHLGGLGSGQVTKLLNNLLFTANLGTAATALALGEQLGVSRER
LAEVVSRGSSNSFALNSIRGSGGTLDRLAAMAGTLLQKDVRLVADLAQQA
AATPGAVLDAADAALALMDHPR
333992133YP_004524747.1 3-ketoacyl-CoA thiolase [Mycobacterium sp. JDM601]MSAPGRPLPTVTLDNEFFWTAGADGVLRMQECRDCAGLVHPPQPVCRHCR
SQNLAVRDLSGRATLAGFTVNHRFSLPGMPAPYVVAQVAINEDPRVRLTT
NIIDCDPDGLELGQQVEVAFENIDDVWLPLFRPVPAGADGPAGAAPKPLP
EDEIAPEDFARHVRPMVTTEKFEDKVALTGIGMSTLGRRQLVPPLSLTVA
ACNAAIADAGLSIDDIDGLSTYPGGGLPGPFGEGGVTALEAALGVRPTWH
NGGMETFGPGGSVIAAMLAVATGLARHVLCFRTLWEATYNELMKQGKVAP
LGGARTASWQMPFGAISAAHTLAQNAQRHFHRYGTTRETLGWIALNQRAN
AALNPTAIYRDPLTMDDYLSARMITTPFGLYDCDVPCDGAVAVIVSAADA
ARDLAKPPVLVEAVGTQILEPIDWDQSTLTHEPQVLGQAAHLWSRTTLRP
ADVDVAELYDGFSFNCLSWIEALGFCGIGEAKSFLDGGANIARDGVLPLN
THGGQLSHGRTHGMGLIHEAVTQLRGEAGARQVSGARVAVTSSGGLTPSG
VMLLRADS
333992131YP_004524745.1 NADH dehydrogenase I subunit F [Mycobacterium sp. JDM601]MTTTAASPDITVAAWPGSEPRLLRDGVEDGAAYAAAGGYRTLADADAFLD
EVDRSGLLGRGGAGFPLGVKLRSVRAAAARRGLDAVVVANGEEGEPASIK
DRWLLRNRPHLVLDGLRLAAAAVAATRTYVYVSDPAAARSIEAALGEIST
ETIAGPPVSVFTVDGGYVAGEETAAVRAINGGPAKPTDKPPRPYQRGVAQ
RPTLVSNVETLANLPFLQRHGAAAFRSAGTTSSPGTFLATVTGGGLAPVL
YELPHGVEIGELLEFHGIPLDQVRGLLMGGYFAGLLNRDGLAATLDHETL
RAGGSGLGCGAVAVLTDDCPVAVAASVLAYFGRENAGQCGSCFNGTVAMA
AVAEALRDGVATAQDVERLQRWAGVLPGRGACGTLDGATTVAASLLTRFP
ELVAEHLADSCDTCRGGAYRADRPYAIEEVTA
333992129YP_004524743.1 hydrolase [Mycobacterium sp. JDM601]MASVEINGGNVVYEILGDTGDLIVLTPGGRFSKEIPGLRPLADELVAGGY
RVLLWDRPNCGASDVQFYGQSESHMRADTLHGLLTALDTGPVILAGGSGG
ARDSMLTTMLYPELVTKLVLWNIVGGIYGTFVLGSYYVVPSILAVRGGGT
QALPAMREWQERIEENPANKQRLLDMDSDAFLKVMLRWLNAFVSKPGQTI
PGVDDEMFDRITVPTLIIRGGENDWDHPKRTSLEVNCLIKGSELIDPPWP
EDAWERAAEERAAGKVSHFNMFDTWVLAAPAILEFLGR
333992127YP_004524741.1 metal-dependent hydrolase [Mycobacterium sp. JDM601]MTVTATERKPAAERIAVRCVDSDVHPVPRRGELTQYIPEPWRSKYFLTRR
IGEQIYYDAPDYAHAFAMRVDAFPADGEFPGSDPELAFKQLIMEAGSDFA
ILEPAAYPARFPEAQHAMSCALNDWQANHWLDSHNNWHQRWRGSICIAIE
DPAGSVAEIERWAGHPYMAQILIKAEPRPSWGDPKYDPIWAAATKHDITV
SCHLSRSHHEELPMPPVGMPSYNHDFMVTYSLLAANQVMSLVFDGVFDRH
PNLRIVLVEHAFTWILPLMWRMDAIYEARKSWLDIKRKPSEYVKDHIKFT
TQPLDYPEDKTELTRAFEWMECEKILLYSSDYPHWTFDDPRWLVKHLPKA
AREAVMFKNGLKTYHLPDTVPALEGQVRVF
333992125YP_004524739.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MLLEFDEDQRLWQGTVRDVVGKQCSPSLVRGVIEGTAGGDDGAVDSLWKV
YVDLGWTELHEPETAVELAIVLEELGRATDPTPFLATMTQFAPLVGEHHR
PDGSTGAAVLGGVSAHRNAAGWVLDGTALHVLDGDRADRLAVVADAGVFM
VDAAAVTTRRSAVFDPTLHVADVSFAGVEVPDSARMRVDIDRARHVALTG
MAMTMVGACQRILDLALEHVRGRQQFGVPIGSFQAVQHKAADMHVAIERA
RALAYFAALTIAADDPRRRMASAMAKAAAGECQSVVFRHGLQLFGAMGFT
WENDLQFALKRAKAGELMLGGAAQHRATIAEEYLATHI
333992123YP_004524737.1 cytochrome P450 [Mycobacterium sp. JDM601]MNEQKKQRYYYFDRHAPEYRDRFLDITDEMQAKCPMAWTDTYDGHWVAAG
AAEVFELARCPHVSNDHDINNERRGYKGISIPPAKRAQARGGVLEMDGDE
QQFYRELLNPYMSPAAIKRWIPFIDEVTRAAINEKIEEGRIDFVDDLANV
VPAVFTLAILGIPLKNWTIYCEPVHAAVYTPEHDPDSVRVAEMHRQMGLD
LATNYFEVKQNPRPGIVNALTQAVRNGEPIPDIDGLSMVGVVIGGGFDTT
TALTAHSLEWLGEHPEERERLSREREKLFNHATEEFLRYFTPAPGDGRTF
SDDVEVAGVQVKEGERLWLSWAMANRDPSVFEDPNRLIMDRKGNRHFSFG
LGVHRCIGSHVARAVFKSMMLAVLDRMPDYRCDPAGAVHYDTIGVIQGMR
HLPATFTPGKRIGPGLDETLEKLQRICDEQECARPITERKESVVID
333992121YP_004524735.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MGRVAGKVAFITGAARGQGRSHALRLAEEGADIIAVDLCQDIETIGYPMA
RPEDLEETAKLVEKTGRGIVTAQADVRDAAALKTALDAGLAEFGKLDIVV
AQAGVAGMKGNPPLQAWIDVINTNLVGTINGIQVALPHLGEGASIIATSS
AAALMDAHQKANPGNDPGGMAYMTSKRLMAQYVHDLATELAVRGIRANVI
HPTNCNTDMLQSEPMYRSFRPDLDHPTRADAEPVFYVQQAMKVPFIEPED
ISNAVLWLASEEARYVTGMQLRVDAGGYLKWYDYHV
333992119YP_004524733.1 hypothetical protein JDM601_3479 [Mycobacterium sp. JDM601]MCGESYISRGRTQAGNRSHPYRRTAPRQARDATSSLLRAVSPEPCQKQLY
ESTILTTWKGDSLWPRRTS
333992117YP_004524731.1 dehydratase [Mycobacterium sp. JDM601]MYGFVPSAGAVLAEWGAEVIKVEHAVTGDPQRGLRQTGMLRVEGDPNPNI
EHANRGKRSIGLDVSTPEGREVLLELAKRADVFLTSFLPGHRRKFAMDVD
DIRAVNPTIVYARGSALGPRGIESEKGGYDMTAFWCRAGTAATITPPGIE
GMIAPPGPAYGDTISGTNLAGGIAAALFKRERTGEPSVVDVSLLGSGLWA
MGHTVALTSHLGERLVQQPPGVHGSPINPLVGVYATADERYISFVMMQPG
KFWADVCRHMELDDYVDDPRFATAQSFAEHTPAAVEILREAMSKRTLPEW
SERFATLAGPWAPVQDTLQAAQDAQIRANEYIVQAGELELVANPVQFDVA
APATGPAPGFAAQTDEILEELGLDWDRIIELKTAGAVT
333992115YP_004524729.1 lipid-transfer protein [Mycobacterium sp. JDM601]MGIVGAGMTPFREHFALGIKDLLPMAFAECAASVDKGLAKTDVQAAWFGA
LGTTDGFPSGILADTLGLPDLPVTRVENSCATGNDAVRNALFGVASGAVD
VALVIGADKLRETATKDMLWAWEETARDMAWDYPLGLVAPAGFALHVRRY
LHESPATREHLAMVAVKNHRHGVSNPRARLRFEITMQQALEAPMVASPFG
VYDCAPQSDGAAALVLAAEDVVDRFTDRPVWIRGVGLGLDAVMHQHKRDM
TTFPATLRAAKQAFAMAGLTPSDIDVAEVHDYFTGVEMISYEDLGFAERF
EAHKLLEAEVTSVGGALPVNPSGGLKSKGHPPGATGVAQCVELFEQLRGT
AVNQVDGARIGLAHNIGGPTAVAAVTIVEGGGDGV
333992113YP_004524727.1 MCE-family protein [Mycobacterium sp. JDM601]MIGLLTILTIAALVALPIALFRGSFTRTVPVTVLSQRAGLVMYPDAKVKL
RGVQVGKVGSIEPLADGTAVLRLEMQPDQLRLIPANVTARIASTTVFGAK
SVELVAPPDPEATRLHAGQVLAGEHVTVEINTVFQQLVRVLDKIDPKKLN
ETLSAVSTAFNGRGQKLGQALTDFDKLLAEIEPSLDTLEHEAATMPPVFR
SYADAAPDLTAALNATSTMSESIVQERNSLDTFLLSAIGLADTGNEVLGE
NRQGLTDLTRVLEPTAQLLDKYHDELGCSIGGLVPFAKSPPFNVPGIIIT
ASFTLAKERYRYPDHLPKVAARSDRSYCTELGLPDVPPEYRVPALIADVG
ANPYEYGNQGILLNSDGLKQALFGPIGGPPRNSAQVGMPG
333992111YP_004524725.1 MCE-family protein [Mycobacterium sp. JDM601]MLKYRGSQLSRMGLIGIVVVAFIVAIGLQPEQLIQWATSVRYQARFAEAG
GLSTGADVTLSGIKVGSVTDVALDDGDALVTFTLAGKYPLGSQTTAHIRT
GSLLGERVLTVEPAGGDKMRPLDVIPLTRTSSPYSLVDVVGELTSNTAGT
DTESLNRSLDTLSDTIDQIAPQLGPTFDGLSRLSRAVNNRNEGLADLLKS
AAELTGVLSERSQQINSLILDADSLVEVLNTRRQAIVNLLVSTSAVSRQL
SELVAQNNEQLKPTLDKVIELNKILEKNRDNLAKALPGLAKYELTQGETV
SNGAYYSAYVPNLFLPQLFQPFFDYIFGFRRGVDAGQPPDNAGPRAELPF
PINGIPQPGDLPPR
333992109YP_004524723.1 MCE family lipoprotein LprM [Mycobacterium sp. JDM601]MIGLRFLRRSAAVAVLVAATTTGCAFGGLNSVALPGVQGRGSGAQHFTVQ
LANVGTLESNSPVMLSDVVIGSVGKMTVTNWHANVDIAVNPGVEVPANAV
ATVGQTSLLGSMHLALNPPIGQQPTGRLAPGATIPLSDSSTYPSTEQTLS
SLAVLVNGGGLGQIGDIIHNFSASMAGREADIRDLIVRLDHFTGALDRQR
NNIVEAIGEMNRTATTFAGQRDTINRALDKIPPAIDVLIKERPKFVTALT
KLGQFGDLSAGLVNDSGRELVADLIHIEPALRSLANIGPELNSAVAYASA
FPYGPNAIERAVRGDFLNLFAVFDLTKPRLKRALFAGTQWGDEDAKLVPA
PGDPWYLNYSYDPLQEPILQSSSEGLPPGALGSGGGG
333992107YP_004524721.1 hypothetical protein JDM601_3467 [Mycobacterium sp. JDM601]MRALESAVAAVAVSLVLASSPAPPAHAALGFELNGPYRVTSSGDWAKTNE
VFMDEVTVSSVWTFSSSCENAHVCTGQVSSDQGWTAPLEFRTSRWIVDRF
HENWQTCPDGTTSPGRQRYQFQGSDLNGQYDKRNIDLLVGYDRTIGVSGA
CGRNQPTVIVMPLSVRRL
333992105YP_004524719.1 hypothetical protein JDM601_3465 [Mycobacterium sp. JDM601]MMRTTVGAALGALLVAAAATAVAPTAAADMRYGNYEVLSNRWTDATWVWA
AYPCETMGKFDDLPAGCVEVSAIDRPHFFGRGYYGGTAKLVDGQYSFTSD
YPNGLTCPFGPSMPTRDTYTWDANTLAGVVESHFEVGCMNGPGGVNTWTF
ALVRM
333992103YP_004524717.1 hypothetical protein JDM601_3463 [Mycobacterium sp. JDM601]MPSRDPAKPGGRGKHAAKRTSKDALTLAEAEAKAAEAAAELARARAELLK
AQQGSESEATQAVELETAPHVEPARIEADDPAPGAGEAAVDEPAEQPRKS
IGIRRQLGWVAATLAVLAIGGFLAVDVLMLSHHRDVALRQHQLGEYAAAA
RQGVVTLMSLNYETVDDDVKAILDNSTGEFKKDFEAHAGDFAKVARESKT
VTSVDTVVSGVESMSDNEAVVLVAATTKVTNTAGAKEEPRSWRLTVHLAR
EGDQVKMSKVDFAA
333992101YP_004524715.1 dehydrogenase [Mycobacterium sp. JDM601]MTVGDWDDEFDVVVLGTGGAGLTAALTAAVNGASVAVYEKSATVGGTTAV
SGGIAWIPAHTRAPDLTVEAALDYLRAQSFGAMDDELVSTFVRTGQEMVD
FVEKHSDVRFEVASGFPDYKPELPGGRPGGGRSLSPLPYDISRLGSWQDR
ITAFPADYSNVGFDAETRARLHADIDADTAAGDLCVAGTALIAGLLKGAL
DHGVTPATGCRGVELIAGSDGGIAGVRVDCGTAARRVRARRGVILANGGF
EWDTAMVEAFLRGPMRGAVSPPNNTGDALRMAMAHGADLANMGEAWWVPI
VRIPGDTIDGQQRSRSVRLERTRPRSIIVNRSGRRFVNEACDYNSMAGAF
HYLEPRGGYVNDPAWIVFDAEHLRRYGFLGVAPDDAAPEWFCESPDLAAL
GARTGIDPDGLAQTVASWNRGVAAGADPEFGRGASAYDGYWGDDQADTPA
GRTLGPLDTAPYYAVPLSVGAMGTKGGPRTDADGRVLHVTGRPIPGLFAA
GNAMAGVTGRAYGGAGGTIGPAMVFGFRAGRAAAAGDSSV
333992099YP_004524713.1 2-hydroxy-6-oxo-6-phenylhexa-2-4-dienoate hydrolase [Mycobacterium MPEFESIWSDLQGVVFEQGYLDAGGVRTRYLRAGDPSKPVLVLLHGSGGH
AEAYVRNLAAHAEHFWTWSIDMLGHGYTEKPGHPLEIPHYVAHLTAVLDA
IGAGQASISGESLGGWVAARAAIDHPDRVQRLVLNTAGGSQADPEVMKRI
ITLSMAAVENPDWETVQARIKWLMADKSKGYDDIVASRQRIYRLPGFIDA
MRDIMALQDPEIRPRNLLGPGDYGKITAPTLVVWTSDDPTADVEEGKRIA
SMIPGARFELMPGCGHWPQYEDPATFNRLHLEFLLGR
333992097YP_004524711.1 extradiol dioxygenase MhpB [Mycobacterium sp. JDM601]MADIEAAVDAAAAFVADFDPQLTVVFAPDHYNGFFLQLMPPFCIGTAAHG
VGDYGTYAGPLNVAADLAGETAAAVLEHGVDVAVSAHMDVDHATVQPLER
LLGDAGACPVIPIFINAVAAPLGPIHRARALGAAVGAYLRTLDLRVLILG
SGGLSHDPPMPTLATAPPVTRDRILHGTPMSAEQRQARQNAVTAAARDFA
AGASDLRPLNPEFDQRFLSILDSGRLDDLADWSNSYITEAGGGSAHEIRT
WAAAFGALAAQGPYRTANHYYRPAPELIAGFAVRTAQPVEVGS
333992095YP_004524709.1 monooxygenase [Mycobacterium sp. JDM601]MKISLFYEFALPRPWSDDDEHILFQDGLDEVEAADKAGFSTVWLTEHHFL
EEYCHATAPEMFLAAASQRTKNIRLGFGIMHLPPVVNHPARVAERIATLD
LLSGGRVEFGTGEGSSIAELGGFGIDPADKRAQWEEALEVSIRCMTEEPF
TGFEGQHVQMPARNVIPKPMQKPHPPVWVACTRPASVQMAAQKCIGALSF
AYTGPGPLAERVNGYYKELEENGVPVTPQVNPNILAIGGDLSMMVAPTDE
QALQRLGVGGGFFSFGIMHYYMTGEHTPGRTRVWERYLEEVEKDPTLAYG
PGRGAIGSPATTREFLRGYEESGVDELILLLNPRSHEATMEAIELMGKEV
LPEFIERDEKAVADKAKRLAPVLEKLEARRTESVAPKFDESYSFGGLPTG
RGGKFTATEIPEAMAEMNEGRVQAAQLAKDERAERGRGQK
333992093YP_004524707.1 hypothetical protein JDM601_3453 [Mycobacterium sp. JDM601]MAGLTEFRRVGDAVRNWGRWGDDDELGTLNLITPEKVAAAAALVRHGKVF
PLGVDFGSSGPQGAFAFRHNPIHVMTVDGGDVHTLAQYGPEWHRNIVAQQ
LSEFFTDNPFRFNDDMVVMPLQAATQWDALSHVYYDDQLYNGFPAGSVTS
LGAYHCGIDKVDGKGITSRGVLLDVVAHRGAETFLPLGTPITPDELDDVA
RSQQVTISPGDIVLVRTGWWQRFSETGDGAEPGAGLDWRCATWLHEHDIA
AVAADNLMVENPVSGVEGTFLPMHMLCLRDMGMMLGEYWDLGALAADCAA
DGVYEFQLVAPPLRVTGGVGSPVNPIAIK
333992091YP_004524705.1 2-hydroxy-6-oxo-6-phenylhexa-2-4-dienoate hydrolase [Mycobacterium MPIERKTVTVDGLSTSYLEAGDPAAPAVVLLHGGEFGAGAEIGWERNITT
LAQRHRVLAPDLLGFGESAKVIDFNDGRGMRIRHVARFCAQLGVESADFV
GNSMGAIMLLVDTTSDAPLLPVRRLVAICGGGEIQQNEHMAALYDYDATL
PAMRRIVAALFHDPAYPADEEYVRRRYESSTAPGAWEAIAAARFRRPGAE
PPPPASSSRAYERISVPALVVEGGSDKLLPSGWASQIADQIPAGRSVVVD
AAGHCPQIEQAEQVNRLLLDFCSGD
333992089YP_004524703.1 NAD-dependent aldehyde dehydrogenase AldA [Mycobacterium sp. JDM601MLAGEARMLVDGELVGTNSGATFDVVHPASEQVAGTATDGTVDDMERAVG
AARRAFDTSDWSRDLEFRHHCLMQLHAALEADKERLRRILITEVGCPVTV
TGSQIESPIAEVKHWADHGRAFEYLVDTGLHDTPLGPARRKLHYEPQGVV
GAITPWNVPLYLNIAETVPALMAGNTVVLKPAQLTPWSGSELGRIVAEKT
DIPAGVFNVVTSNANEVGAALSADPRVDMITFTGSTATGRAILAAAAPTV
KKTLLELGGKSAHIVLDDADFNSALPLAAMMACVMSGQSCVLPSRILLPR
SRYDEGLAVLQASMENFPMGDPWTPGNMQGPQISETQRRKVLGLIASGLD
SGARLVTGGGVPEHLATGYYVQPTLLADVDPDSQIAQEEIFGPVLTVTPY
DTDDDAVAIANNSIYGLSGEVSSADMDRAMAVATRMRTGNVSINGKSHFG
IDSPFGGTRQSGLGYRNGAQGFTEYLHIKTIGMPE
333992087YP_004524701.1 hypothetical protein JDM601_3447 [Mycobacterium sp. JDM601]MLRLKAMMQPWEADVTGADQTRMAKCADEWGYDMIAVPEHFVIPTEHVEL
SGPHYFQSTAAQAYLAGATNRIMLNSCVTVLPLHQPIVLAKALATADWLS
GGRMMVTFGVGWLQREFELLGVPFAERGRIADEYLAAIIELWTSESPRFE
GRYVFFDEVAFEPKPVRKPHLPVWIGGDADAALRRAAKYASGWWSFLTPP
EQIAQRVDFIKSQPEYDGRPFEVVHGMATTRVGEGHVARNDPNARSGMSG
QQIIDRLSWLAEQGVTVSAVPLPSVRDVDEYLDYAQWVIEEIKPKVP
333992085YP_004524699.1 dioxygenase [Mycobacterium sp. JDM601]MQTTLPGSWVDNATSLDDIGPDRYRMQIPTERYTSAEFAAVERESIWLKT
WQVAGRVEELAKTGDWKQYRISDQSFIVVRGKDDKIRGFVNACRHRGNLL
CPEARGNTKRNFLCNYHLWSYDLQGKLTGMLREDLAGPIDKDTHGLIEVP
VDTFAGFIFLNPDPQAAPLSEFIGDEIATMLAPYHLDEMVTVMDVTERID
CNWKVVMDAFQEGYHINGIHPQLLRVINIDPATTRYRFFDRHSVAVAPFD
VVGATPADQVEGTMALPDTFPSTAAVLPRFKELVAQYESPDGALTFPEGV
TARTLLQQATRDTLTGMGLDVSGLTDAQMSDSHGWVLFPNFFMTIRAGEC
HIIMALPDPDGDPHRCVWHVASYMYLPEEYKASFVAEPVVVDEPGSYKYF
EALQQDYDQMPRQQAGLRNSMLTYMALVKEEVVIAHFHSVVDNCIAAMCG
NSNHRSEG
333992083YP_004524697.1 hypothetical protein JDM601_3443 [Mycobacterium sp. JDM601]MKDVDEVIDGHSGRAHTVLLYTQTVKRLADAAKAPGFTADDWSPLAALVD
TAAFERVGNFKEVMNWTEYLGFLSNWAPSSSWEASFKRVSEVDGVVFLEL
EERSEIGEFTSVVNSLSVYEFADDGKISRIDLYLQMALPNMEMLDSYQAV
EISE
333992081YP_004524695.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MVNELAGKTAIVTGGASGLGRGIAERFLAEGARVVLADLDPERGAALAGE
LGADTVFRVADVADPQQVSDLVDAAVETFGGLDIMVNNAGVSGTMHNRFL
DDDLADFHRIMAINVLGVMAGTRDAARRMSKAGGGSIINLTSIGGIQAGG
GVMTYRASKAAVIQFTKSAAIELAYYDIRVNAIAPGNIPTPFVASSAAAG
LDREAIERYEAGIRETMRADRPLKREGTAADVAEAALYLAGERSRYVTGI
VLPVDGGTVAGKAIRRRSDQKR
333992079YP_004524693.1 ferredoxin [Mycobacterium sp. JDM601]MKVTADQNICASSGQCAALAPRVFDQRDEDGVVVLLDENPPDELADAVRQ
AVAVCPSRAIKIVEE
333992077YP_004524691.1 hypothetical protein JDM601_3437 [Mycobacterium sp. JDM601]MSSTTTRDATFYPPGGYGAPKDRRGQAGRDVGLPAGTEVFSADNHISIAD
DIFYQRFPEDLRDKAPRIWYEDGAYMVGRKGQTFLPGDFSAVLMQYDDLA
GAASSNIEARIQELASDGVDKELAFPNAVLALFHFPDKELRERVFRIYNE
HMAELQERSGGRFYGVGLINWWDPVGTRRNLEELKSLGLKTFLLPLNPGK
DDDGNVIDYSSATMRPVWDEIEAAGLPVTHHIGETPPKTPCEVNSVVVGM
MINVDSFREMFSKYIFGGILDQNPGLRVGWFEGGIAWVPSALQDAEHLLA
SYQHMFNHQLEHPIRHYWNTNMSASFMVDPLGLRLIDEIGVDKVMWSSDY
PHNESTFGYSEKSLTSVVNALGPEDAAKVVSTNIKKFLGV
333992075YP_004524689.1 aminopeptidase [Mycobacterium sp. JDM601]MSTDVLPDVAGLRCGRRERALAQMAAHDLDVLVLGRQANVRYVTGAPQRW
MAGTRPFSPNCVLVRATGAIHLLSSWDDGVPDDIPHDNLYEISCNPTNII
AALAHIEGALTARRVGTDAISPLFAQLLPLAFPKAELVDGEPAMRAARAI
KTPDELTALRSAIAVAESALAATVDALQPGVGEAALAGAMMQAMAGAGGT
PANQDVAWVTSRDQPWRRAVGDGRVGPGDLVGISAAVVAGGYLGEVGRTH
VAGGPPDGHAAALYRRWDALWQRLSGACRPGAAGSELLNAYAAAGEALPP
VPVAHGLGMGFDPPVVSARLPQTAGAERLEPGMVLAVTGYVFEPGVGAVF
GREAVLITEDGHKVLTTSPFS
333992073YP_004524687.1 acyl-CoA transferase [Mycobacterium sp. JDM601]MTPLDGFTVIDLSTGIAGAYCTKMLADGGAEVLKVEPPQGDPLRYWSASG
ADTAGEGALFSFLSGGKRSVVTDPESGTALVDRLLSGADAVIWSRGSALA
EHPAFAPHQITRDHPHLIVTAITPFGLDGPWSDRPATEFTLQAWSGGIFG
IGRGSQDRPPAFVGGQIGEYLAGAYASALTLASWFARRDRGDLLDLSMLE
TQIMGLTYYPVTYFEMLGKPWRDTRRLTVPGIASAKDGLVDVGCGTAQQW
FDLCAMTGHPEWIDEDSPLSITEQANEKAEEIYAWFKEQTVEEIRDLATA
FRIPNAPVGNGANVTELDHFQARQVFVTNPRGGFIQPDRPYRMPQLSWGP
PQPAPRLGEHTEHYRSTPPPARVAGGGEQHDAGPFSGLRVLDLTTFWAGP
SCTHLLAMLGADVIHIESTGKPDGTRLIAGIPASEPQWWERSPIFSALNT
NKRGLTTDLRREAGREILRKLVATADVIVENFTPRVLEQIGLDFDTVRRL
RSDAILLRMPGFGLDGPWRDNPAFAYAIEAAAGVSWLTGFPDRNPYEPYS
VGDPNAGVHALNALLLALEHRRRTGEGILVEAAMVDAALNVAAEQVIEYS
AYGALLQRDGNRGPTAAPQNLYRTSDIDEFGRLDSWVAVAISTDEEWIAL
CEALGRPAWAADPSLATAAGRREHHDLIDSRLGAWCAERSGDEIVELLWP
AGIPVAKAVQPHRQAESPQLAHRGFFEDVAHPVNPTVRHSTLPVRSTHGP
SRCHRRPAPLLGEHNHELLRELGFTEAEVAALEADGVIGNALG
333992071YP_004524685.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MTGRVEGKVAFITGAAHGQGRSHAVRLAQEGADIIAIDVCKPIVENSPIP
PATPEELAETADMVKALNRRIYTAEVDVRDYDALKSAVDAGVEELGRLDI
IVANAGIGNGGDTLDQCSEHDWQEMIDINLSGVWKTVKAGVPHLIAGGNG
GSIVLTSSVGGLKAYPHCGNYVAAKHGVVGIMRSFAVELGQHNIRVNTVH
PTHVSTGMIMNEGTWKMFRPDLENPGPDDMAPICQLFHTLPIPWVDAVDI
SNAVLFLTSDEARYITGVTLPVDAGSCLK
333992069YP_004524683.1 cytochrome P450 [Mycobacterium sp. JDM601]MTDFDTIDFFTDQSLIPDPHPYFDYLRAQHPVTPLNVYGVVAVTGHEEAN
EVYRDSDTYSNLVAVGGPFPPLPFEPEGDDISEQIEAHRHLMPMTEHMVT
MDPPMHTKARSLLNRLLTPKRLKENQDFMWQLADRQLDYFADSGKCEFLS
EYARPFALLVIADLLGVPEEDRPAFQEVLGAPQPGARIGSLDHEELAHDP
LAWLDDKFSGYLSDRRENPRGDVLTDLATATYEDGSIPEISDVVKSSTFL
FGAGQETTTKLLSAALRFLAEDPSLVAQLREDRSRIPNFLEETLRMESPV
KTDPRLVRKTTTLGGVELKAGTVVVMFPGAINRDPRKFENPHEFRIDRPN
VREHLAFARGTHTCPGSPLARAESRISLERILDRMTDIRLDESQHGPAGD
RRFSFEPTFILRGLTELHLEFTPVAAPVPAGL
333992067YP_004524681.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MVDVELDEGLAVITIDRPQARNAIAPETMDQLDRALDAVAAARALVITGG
GDRAFVSGGDLKQLAAIRTEEDAQAMAWRMRLLCDRIAAFPAPVIAALNG
HALGGGAEVAVAADIRIAAADIKIAFNQVSLAIMPAWGGAERLAALVGHS
QALLLAGTGTMLDAPAAERIGLVNQVVPRESFEAEWRGLARSLANRSAGE
IKRVLAGASADEAVAAFARLWVSDEHWAAADALQQQRNNR
333992065YP_004524679.1 amidohydrolase [Mycobacterium sp. JDM601]MGQLSHRVEIPFPLFDADNHLYEPPEALTKYLPKEYKDIVQYVEINGRTK
IAIDGHISNYIPNPTFSHVAKPGAWEEYFKFGNPDGKSKRELFGEPMKSI
PAFFEPAPRLALMDELGVDRSLMFPTLASLIEERLRDNPVAIHVIIHSLN
QWLDEVWGFNYKNRIFTTPVITLPIVEKAIEELEWCVKRGARAILIRPAP
VPGFRGPRSFALPEFDPFWERCVHHDVFVGMHSSDSGYARYTSEWDGTVQ
EMLPFQTNAMNILNEWRPIQDAVGSWVIHGALFRHPKLKVGIVEAGSKWM
FPLLDSMAEVYKKAPEAFLGNPMEEIKNRIYVSPFYEEGIDDLINLIGVE
QVLYGSDWPHPEGLAEPTHYVTALSHLSVEDQAKIMGGNLGRLVTV
333992063YP_004524677.1 hypothetical protein JDM601_3423 [Mycobacterium sp. JDM601]MYVCLCAGVTSQQVIDAVAAGASNTKQVGELTGAGTVCGRCKNNIRALIA
AAPTGTQSLT
333992061YP_004524675.1 hypothetical protein JDM601_3421 [Mycobacterium sp. JDM601]MSVRPMLVTLLGYLVIVDAAINTVGWALDLIGSHTLLARVLLSGWGYMFD
AGYFWHFNELWVGGAAGPGEKAMEAGMILTVFTMRIAAGIGFLQMKRWGH
QWMVVTCWMGVVIWVLYVFNMTMFADVRFAGVIFPVVGWWLYDIFYITPF
LAIPYLHTVNREIFTD
333992059YP_004524673.1 MorD protein [Mycobacterium sp. JDM601]MTDLDQTAAMALERSCSVTAVALSEENRAGVRLVTGDHRGFGLSVSRSHV
HVPYPVLRTDWTRRSLTCGIALQCASSKDRLGQYRINELSARELRALTVV
EAGVALGWIAARWPGLMSEFDRLLPELAPADPQLEAQDMIGRAIETARGS
DQAELDPLLGRLPAIYTAPTGLTDRLRRQFGRMPWTTTQQRMPRPYSVPV
GGDGGVRNPNLPPPSRPQDNDTDVTPEHRPGIPYPEWNSWTERLMPDHVA
VVELARDRRVGAPTTTSADLRKWFQEDTHRAMVSRLEDGSDLDIDQYVRH
YVDLRTGEAGEPRLFRDLLPCDRDVNTALLLDGSSSLGVHGGRVFRLELA
CADALSRAMTHARERHGIFVFTGNTRHRVEVRCLKDFPEARFVPPSGMGL
SAGGYTRLGAPIRHLTSRLLDQPSERRLLIIIGDGMISDEGYEGRYAWSD
AAHAVEEANEAGVSVYYVGVGATRVDPLPEVFGPKRSQRISRVEELPRVL
ARVHRELIST
333992057YP_004524671.1 hypothetical protein JDM601_3417 [Mycobacterium sp. JDM601]MADQQEQKRKRALIVFQIVIYGYLLTMFLIQLYMSFDRGWWYL
333992055YP_004524669.1 hypothetical protein JDM601_3415 [Mycobacterium sp. JDM601]METTAAEDLPPGTTPYYARMHTWIKRATLVCLVALVIEGAFTLPFMAVYY
GYPTLSLTQICSELLKVRYSDDTLECKYPYPPLGPPEGAEGKDTAKDIWG
IQPVPQYDRLGFRELVDRYEARLAKQEAAQQQGG
333992053YP_004524667.1 long-chain fatty-acid CoA ligase [Mycobacterium sp. JDM601]MDRFRTTLSAGLNSYGAAPCIEFERTWYSGNDITGYIASVDDQLARAGVA
PGDPVGVVVRNRVPHAAVILGFIAAGRPVAMIYSYQSPDSIARDIGALRL
PAILADRQDWTGPVRDAVTHVGSAGIGLVPEPIGVETIAARRQVGVAAPG
GRLAPGLHILTSGTTGAPKRVPVSTSALQHTVLTMTVGQHPAPDDPPELV
YWPFGSIGVCQLLVGPYTGKRMVLLEKFTVAEWVRAVKTYRIKRTGVQPA
ILRMLLDADVAKADLASLEYLPGGSGPLAPRLREEFESRYGIPLLWAYGA
TEFAGSVCAWTPELYERYGDIKSASSGKPLPGVEVRIVDAETGAALPTGE
RGLLEARVQVMGPEWIRTTDLASVDADGFVTIHGRADGAINRGGFKVLPE
TVRAVLVSHPAVRDACVIGLPDTRLGQVPVAAVELRHSGGKPSEDDLKTL
VRNVLPSHHVPVAIVVVEQLPRNAALKVRPADVAALFEARRS
333992051YP_004524665.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MSEVSDEDFAEILAQTRHFVRSSVVPREAEILAEDRVPDDLREQAKAMGL
FGYAIPQQWGGLGLNLAQDVELAMELGYTSLAVRSMFGTNNGIAGQVLVG
FGTQEQKSRWLAPIATGDVVASFALTEPGAGSNPAGLLTKAVRDGSDWLI
TGQKRFITNAPTAELFIVFARTRPADEQGAGIAVFLVPAGADGVEVGVKD
AKMGQEGAWTADVSFTGVRVSDAALVGGSEDLGYRAALTSLARGRVHIAA
LAVGAAQRALDESVGYAATATQGGTPIGNFQLVQAMLADQQTGVLAGRAM
VRDAARKWVTDEDRRIAPSAAKLFCTEMAGKVADLAVQVHGGTGYMRGVP
VERIYRDVRLLRLYEGTSEIQRLIIGSGLVKAAQRQS
333992049YP_004524663.1 beta-ketoacyl CoA thiolase [Mycobacterium sp. JDM601]MSVREAVICEPVRTPIGRYGGMFKSLTAVELGVAALKGLMDRTGLPADVI
DDVVLGHCYPNSEAPAIGRVVALDSGLPVTVPGMQVDRRCGSGLQAVLQA
CLQVSSGDCDVVIAGGAESMSNVAFYSTDMRWGGARGGVRIHDGLARGRT
TAGGRHYPVPGGMLETAENLRREYGISRVDQDELAVTSHRRAVAAQQSGV
LAEEIIGVSVSSRAGEQFIDTDEHPRADTSVESLAKLKPVLGKTDPDATV
TAGNSSGQNDAASMCVVTTREKAEQLGLTPLVRLVSWGVAGVAPNVMGIG
PVPATDVALGKAGLRLADIDLIELNEAFAAQALAVMAAWEFGAADRERTN
VHGSGISLGHPVGATGGRMLATLARELNRRGARYGLETMCIGGGQGLAAV
FERVGP
333992047YP_004524661.1 GntR family transcriptional regulator [Mycobacterium sp. JDM601]MGAPDFPVRSQLSEDVARFVRKRIFNGDYAAGQYVRLDQLAAELGVSVTP
VREALFGLRAEGLLDQQPHRGFVVLPVTRRDITDVSDVQAHIGGELAARA
AANITDDQVRELDEIQHQLEAAYTADDEERAVRLNHEFHRAINVAADSPK
LAQLMYQITRYAPESVFPTVSGWPAESTKHHRAVLAALAKRDEDLARTAM
AEHLAAGAAPLIDHLVEHGVVDQDGRVS
333992045YP_004524659.1 hypothetical protein JDM601_3405 [Mycobacterium sp. JDM601]MSAADQYLLPADAARAQLLADLDVIDHAQQRMRDTTTDLVGTAFRIEVAE
RLETQHRVNRGLSYRMFGEIADPIDDLGSPDVPPGVRARDLLRRRLRLTR
GEVTRRFRLAARILPRRRLTGPALPPALPELAAAVEAGHLGEDHIATVTR
ALDQLPSKATPADQEQAEHLLVANAREQDAPFVAAVGRAIADTIAERTGQ
YCDTDRARRRSLTLGPQQLDGMSRLTGYIDPAARAYLEPIIAAVRPGHHQ
PDEAEGGTPQPDLRDEGQRAHDALKVALRHAIESEKLGTHRGIPVTVIVT
TTLDQINQAAHAIVDPTVAMPAPARTGGGSRLPMRDLIQMAAGSIHYLAV
FDDHSKRPLYLGRSKRIATTDHRIICHARDRGCTRPGCTQPGYRCEVHHC
PGWAMGGRSNPDQLWFACPFDHSAETRGHYTTAAVDGRLGWTDGTTSLQV
NRAHHPEELLADPDPPPT
333992043YP_004524657.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MSTDALPGILRAQAHARGSHPLLICDTERITYRDAERRSAQLAARLLALG
AGRGSHVGLLYPNGVAFLLGTLAAARIGAVVVPLPTFATAPELRRQLAHS
DVQILLAGQSYRSHDYRQRLTEALDVELDCGEPVFSGHAPQLRRVVFDAD
ADGETPEFLEALEADVDGSDPLCIIYTSGSSGAPKGVIHTHAGLLGHQRN
LNDIRRLTAADILFCNSPFFWIGGFAFALLASLLAGSTLLCSNATDPGAT
LDLIEAEKPTMTNGFVSGITALARHPSLARRDLSTLRRGNLYPLMAPDAR
PADPQLRHQMLGMTETGGPVLLSDDATDQPEHRRGSFGRPAPGFECRIRD
GELLVRGRHLMQRYHKRSREECFDADGWFATGDLVRTDADGFYYYQGRRD
ALIKTAGANVSPAEVERAIAKVTGGAVAHVVGLPDADRGQLVAAVVVAQD
ADLDLASLPELLKPELSAYKIPRRFAAIPAAELPLLTSGKVDRRRLVEVF
DA
333992041YP_004524655.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MPMTPDSFETILLDVDRDDRVATITLNRPDRLNAFNRTMCEEMAAAWRIV
KLDEDVNAVVLRAAGDRAFSAGLDIKASYGQPDNVWNHEDPGEALSPKWQ
KMFKPVICAVQGMCTAGAFYFVNEADVVICSADATFFDSHVSAGLVCALE
PIGLMRRIGLGETLRIALMGNDERVGADTALRIGLVSEIVAPEQLWGRAH
EIAAAIAAKPPSATQGTVKAIWESLDKPYRAALEQGLIYTRLGNPLGKAE
LDAQPPHPAAPPRIR
333992039YP_004524653.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MTVLRDGALLRLTLVRPDRRNALSPAMTEALISALTEAASDDTLRAVHIR
GSGDDFCAGADWVATNAADRRPRTGDLVRRIPHAAHRIIELVHTIQLPVV
CSAQGWAVGLGCNLALAADFTIAAADAVFWEPFLARGFSPDSGATWLLPR
LVGLARARRMLLLGEQVSGTAAEQWGLIHQSVAPTDVDATADELLARLAD
GPTVAIGLTKQALHYGQHATLPQSMTQELFNLELACRTMDFKEGLAAFSQ
RRPPGFTGR
333992037YP_004524651.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MSDGSDDRVLFDVDPDGRIATITLNNPGRRNSYDAAMRDAIARFLDRVAD
DDDVVVVLLRGADGVFSTGADMNNAYGWYGERGEQPPAKSRPSQRRRLAV
DRRSFGFYHNLMGFPKVTVGEISGYALGGGFEMALMTDISVIARDTKIGM
PATRFLGPALGSLHMFFHRLGPVLARRLLLTGDIIEAGAVEHLGVFTETC
DPSAVSARARYWASKAAKMPADGVVIAKEAFRLVEQSQAYQGEEVASYLF
HAYGTNLQFAPGEFNFVKTRAQHGTKEAFRLRDEHFHVPEP
333992035YP_004524649.1 transcriptional regulator [Mycobacterium sp. JDM601]MAKQPVAEKRQRRERGSINPDDIIDGAFELAEQIGVDNLSMPLLGKHLGV
GVTSIYWYFRKKDDLLNAMTSRALRQYVFATPYVQAKDWRQTLRNHAHTM
RTTFLGNPILCDLILIRAALSPRAAQLGVQEVERAIAGLVEAGLSPQDAF
DIYSAISLHIRGSVVLRRLYEKNRASDAEGPSDFEEAMVIDPEATPLLAQ
TTRQGHRIGAADDANFDYGLDCILDQAERLIEQNSKPARRRTAPASAKAR
333992033YP_004524647.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MDLGLRDARAVVVGGGRGMGLATARCLADDGARVAVVARTAADLDRATDD
LARRGSPDALGLVADACDEQRIEQVFAELGERWGGELNILINTAGPDVQG
SFDELTDEQWRRAIDQGAMGMVHAVRAALPLLRNAQWARIVNFSAQSTQR
QSTVLAAYTAAKAMVNSVSKNLSLLLAPDEILVNVVSPGSVASEALTGWA
RSIGVDGDDPYRLMGAITEHFGHPAHLPRAGLPDEVGAVAAFLASRRNSY
MTGANVNVDGGSDFL
333992031YP_004524645.1 metal-dependent hydrolase [Mycobacterium sp. JDM601]MTATPERLPYLAVDVDNHYYEPLDAFTRHLPKEFRSRGVQMVQDGNRTLA
VFGGVVNHFIPNPSFDPIIEPGCLDLLFRGEIPEGVDPASLMKLDRLSEH
PEYQNRDARVQVLDRQRLETVFMLPTFACGVEEGLKHDIPATMASVHAFN
LWLDEDWGFDRPDGRLISAPIISLADPEKAVDEVEFVISRGAKLVCVRPA
PVPGEVRARSLGDPVHDPVWARLAEAGVAVVFHLSDSGYMAIPALWGGSG
VFKGFGKRDPLDMVIMDDRAIHDTIASMIVHQVFTRHPKLKVASIENGSY
FVYRLIKRLKKSANNAPYHYKEDPIEQLRNNVWIAPYYEDDVKLLADTIG
VDKILFGSDWPHGEGLADPTTFTADIPQFPEFSVEDTRMVMRDNALALLG
DPNRTAPGAAHLAASV
333992029YP_004524643.1 metal-dependent hydrolase [Mycobacterium sp. JDM601]MRAIDCLVNVHFGESEQPAWMRKTRDEYFKGPASMFDPVDMSALLDEMDA
NGVAKAVLMDNLAKPSVTARKFVADRPDRFALAMGGANLLRPVPSLRELS
AVVKDLPVAYAVVGPSFWGDGQYPPSDAVYYPLYAKCAELDLPLCVNTGI
PGPPIPGEVQHPIHLDRVCVRFPELRLCMIHGADPWWDVAIRMLIKYRNL
RLMTSAWSPKRLPEALLHYLRTRGADKIIFASDWPVLRMNRVVPEALALD
LPPEVMDKYLYRNAADFFFADLRAPEQES
333992027YP_004524641.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MDFSRPQLTDDDLAFLEEARAFLATHVTEDVKRRDRETGDNFDEGVHLAL
GAAGYLEKEWKTEADGGFSRVRRRIWELEKRRAHVPWVTWGTTAMVARSV
ASFGSPELCDEILPGVFSGHIRLCLGYTEPEGGSDVATCKTRAVRDGSSW
VVNGSKMFTTGAHNCQYVFLITNTDPEARKHKSLTMFLVPLDSPGIEIQG
LRTVDGDRTNIVYYSDVRVDDKYRLGEVNGGWTVLREPLNVEHGAVDADP
DGLQDVSIMMHQAGFMAEAVDKAGAVVGRSGRIDDRSVAYRLGRAAARVE
ASLSAPSIFGRVALAQTMRDVSPDLMDLLGSASALPIGTDGAIDDGASDY
VYRFAPLVGIYGGTLEVFRNMIAQYVLGLGKPNYSPPLVK
333992025YP_004524639.1 transcriptional regulator [Mycobacterium sp. JDM601]MTVSARSAIDFAEPANIDLRRGGRARAGSYLYEGQHLVTGWHSHEMHQIE
YAVGGVVEVETAAAHYLLPPQQAAWIPAGLEHQAVMRPEVRTVAVMFDPE
LVAHAGDRARILTVSPLIREMMLYSLRWPIERSDGDTVSDDFFRTLGHLV
SAALDHEAPLSLPVSDHPIVGPAMVYTKAHLSSVTAADVGRAVAVSERTL
RRQFEAVTGMSWRTYLLHARMLQAMALLAAPDQGVQQTATAVGFDSLSAF
TRAFTRFAGEAPSRYHRRITTA
333992023YP_004524637.1 hypothetical protein JDM601_3383 [Mycobacterium sp. JDM601]MAAKTKVSATLTPERLRQAQAVTGTSNVSQLLEDALGALIERELEKRWLE
ANRDDELPGEVPVDLSAVPWEE
333992021YP_004524635.1 hypothetical protein JDM601_3381 [Mycobacterium sp. JDM601]MRRIVDVSFDNVTVDVGARVAGAAQLLASLGRNESVAFMAQAINATMGK
333992019YP_004524633.1 IclR family transcriptional regulator [Mycobacterium sp. JDM601]MTAHSAADDPARPVSSPPTERVIRILELLASDPERGFSLSEIARMLCISH
GTCHAIVTTLAARQWIVRNRRSGSYSWGPALAALARPVNKQAFRPELQRL
SDDVGMQVVLGTRQGPTVVVTDAVGESLAALQVSVGFRMPIVAPFCREFV
AEAGPQVRREWVGGLGSPSPRLRRRLGAVLDEVRNRGYAIERMSREYVRV
YSALQALAAEGEPDEITARLASAFADLTVVDYLPGELDSTEHRVANVAAP
IHDTDGTVTMSVGASPFATMTPAEVSDLGAAVRETAARIESLWVARADPT
TEGVTP
333992017YP_004524631.1 oxidoreductase [Mycobacterium sp. JDM601]MVKKKLVIGSSGFLGSHVTRQLVDAGEDVRVLIRATSSTRAIDGLDVDVR
RGDIFDQDAVRSAMNGCDVVYYCVVDARAWLTDPEPLYRTNVEALRHVLD
VAAGAALDRFVFTSSIGTIGRVDHGLADERTAHNWLDSGGDYIRSRVEAE
NLVLGYHRDKGLPAVAMCVANTYGSGDWQPTPHGGLVAAAVRGKLPFYIS
GAQAEVVGVDDAARALILAGQRGRPGQRYIVSERFMSARDIYRTACAAVD
VEPPRWGVPVAVMSALGHLAQFAARLRRRDTALTPLSIRLMHIMSPMSHD
KAVRELGWEPRPATEALAEAAGFFRSRRRTKNQESS
333992015YP_004524629.1 lipid-transfer protein [Mycobacterium sp. JDM601]MGLRGEAAIVGYVELPPERMNKGTPAPFTLEQWAELSADALADAGLSGEL
VNGIVTSHLGESEIFVPSTIAEYLGVPARFAEIVDLGGASAAAMVWRAAA
AIELGICDVVLCALPARYITPMSERKPKPLVDAMFFGSSSNQYGSPQAEF
EIPYGNLGQNGPYGQVATRYGAVYGYDERAMAKLVVDQRVNANHTDGAIW
RDTPLTVEDVLASPIIADPLHMLEIVMPCVGGAAVVIANAEVARRARNRP
VWVKGFGEHVPFKTPTYAADLLATPIAEAADTAFAMTDLTRADMDMVSIY
DCYTITVLLSLEDAGFCEKGKGMQFITDHDLTFRGDFPLNTAGGQLGFGQ
AGLAGGMHHVCDATRQIMGRAGAAQVADCNRAFVSGNGGILSEQTALILE
GE
333992013YP_004524627.1 hypothetical protein JDM601_3373 [Mycobacterium sp. JDM601]MTDDAAEIEAIKRLKSRYCRYLDTKDWAAWRALFTDDFVSDTSRAGGKLI
SGADEFVAFTRKSLRDQPTVHQVHAPDIELTSPTTAGGVWALEDVVRFGP
GVNLRGYGHYTETYEKTDGQWRIASSTLTRLREDVFNGLFAVYLSPRVRA
VLAAVAGRLMK
333992011YP_004524625.1 metal-dependent hydrolase [Mycobacterium sp. JDM601]MTQFRDAPIFDADQHMYETPEALTKYLPEKYSRAVQFAQIGRQTRIIINN
RVSDFIPNPTFERVAAPGAHEKFFAGENTEGLTLREMQGPAIEAPAATRN
PADRVAELDRQGVVEALNYPTLASLVEHSSADDPELTLAIIHALNQWMAE
HWTYNYDGRVFSTPIINLSEVDGAQRELEYILDHGAAVALIKPGPVNGVH
GWRSPALPEFDPFWRDVEAAGLPIVLHASFPPLDDYVGRWEPPYTQNFMA
QSAFRWMALGHREIADMITALICHGTLTRFPKLRIASVENGSSWIAPLFH
DFADLYKKMPQNFPEHPHEVFRRNIWVSPFWEGCISDVVDTVGWDKVLFG
SDYPHPEGLAEPKGFWRYAEGMDVRRSYDFMGDNARRFMALPIANPDPAA
TKPPVLAGP
333992009YP_004524623.1 hypothetical protein JDM601_3369 [Mycobacterium sp. JDM601]MQKALAPDISTWPDASPQLIGSRCADCQATVFPAQPRCPSCSGDQMTQQL
LPRNGTLVAWTTQGFPPGPPYLGPTGKDFVPFGVGLVQLGDAVRVEGRLT
ENDPEKLEFDMPVELTMVPFATDADGTEIITFAFRPMEQGA
333992007YP_004524621.1 hypothetical protein JDM601_3366 [Mycobacterium sp. JDM601]MIPFVVRRDDGFVPNAIAHGGWGPTLGGQVVGGLLARAVEQHVSDDDLQP
ARLTVEILRRVACEPLRVTASVVRAGSRMRAVDAAMTQDGELVARASALY
LRRGTQPGGEFYTTEVTMPSVPEEPARFDESVPMFIQTYGNNDGGRFPWQ
HSGPRYAWIREIRDLVDGEELTPFVRAAMAVDVTASLTNFSTTGLAFINA
DYTLTLSRLPVGPYIGLAALTHYSDAGVATGSAALLDSCGPIGNGVSTAV
ANFNFDPSRESPAAG
333992005YP_004524619.1 NAD dependent aldehyde dehydrogenase [Mycobacterium sp. JDM601]MVRATSVEIGKRAATAAESRMLIDGELAGAASGAEFDNISPATGRVLGTT
AAADAADMDRAVGAARRAFDGTDWSTNRELRKRCLQQLQSALESEQEELR
TELIAEVGCPVMTTQLAQLDWPLADALRYPARLIDEFEWERPLQGGGLFG
ERNMRTVVKEPVGVVAAITPSNFPIEVILNKLGPALAAGNTVVLKPDPNT
PWNATRLGRLVAEHTDIPAGVLNVVPTGSNEVAGLLGTDPRVDMISFTGS
TAVGKLLARQSADTMKRTFLELGGKSALIVLDDADPAKVIPGAVGVCVHA
GQACAATTRMLVHTSLYDEVVAAVTAAFAAVTVGDPALPQTLVGPLISAA
QQQRVLDAIAQARRDGAEITTGGGDVTDLPGELGGGYYVRPTVIVGVDNS
AAIAQQEVFGPVLVILPFGDDHEAVRIANDSAYGLAGAVVSASSERAMAV
ARRVRTGAIGVNGGMYYGADAPFGGYKSSGWGRQCGIEGFSQYLETKTIG
YRRPRGA
333992003YP_004524617.1 cytochrome P450 [Mycobacterium sp. JDM601]MLRGEPGLSWHRPIPAVFPHEETGYWAATRHADVKFVSQHEELFCSSEGV
SVDPMPAEIQRNMTFFLAMDPPEHTRYRKLISSGFTPRQVRRIEEQIKTN
ARRIVDDLLEQLHTGNQIDFVASCSGQLPMRTVSDMIGIDPADQQKVAYA
AECLFSGSDDEYASLEERAVHVMTQLGVLAGSGVELAQRRRAEPHDDLMT
ELVNAEVDGHRLTDEELGSFMVLLGSAGNDTTKQTTTHAFKALIDHPEQR
AWLLADFDNRIGGAVEEFVRWSTPVLAFARHAVVDTEVAGTEIKAGEKIA
LFYCSANRDEAVFDRPHEFDITRDSNPHLGFGGGGAHYCLGTHVARMQLR
HLFYELLTRLPEVTLGEPEYLQSTFVHGIKRMPVSLA
333992001YP_004524615.1 dehydrogenase/reductase [Mycobacterium sp. JDM601]MTDTIGFIGAGKMGEPMVLRLLDAGHRVQVYARRPDVRERLAAAGAVPVE
SVAAVGRESDLVISCLFSDAQLLEVAAGPDGLLANVKPGTVVVSHTTGTV
STLTGLLEQFPAGPVLVDAPVSGGAHDIAAGKLTVLLGGPGDAVARAQSV
LAAYADPVITTGALGTALNLKLINNVLFASNAQLVAAAVELAKNLGVPET
SLFAALEHCSGGSRAAGYVQSAGGVESFGKVVAPFMRKDVAACIEAAADR
GVELGQLRTVAETGPLDLS
333991999YP_004524613.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MAPLTQFTVPEVIDAVAAAIPDRDLVVQGDRRFSYAQILERSNRLAAYLH
AQGLGCHTARSDLLGHQTGQDLLGIYAYNGNEFIETLLGSFRARVAPFNV
NYRYVRNELAYLLADSGATALVYHARFAPTLAEVLPELPQLRVLIQIADD
SGNALLDGAVAYETVLADSSPQPPPVQPDPDDLYVLYTGGTTGMPKGVLW
RQHDIFMGSFGGRNLMTGDEVGSIDDIVGPAGENPGVKLMILPPLIHGAA
QWAVMTAINTGQTLVFPSVVDHFDADDVVRTIEREKVLSVTVVGDAMARP
LIAAIQRGEADVSSLMVVANGGALLTPHVKQQIVEALPGAMVIDGVGSSE
TGAQMRHMSTSGAVSTGTFGAGPDTCVVAEDLGSVLTPGHDGLGWLGQRG
YVPLGYKGDAAKTAATFPVIDGVRYAVPGDRARHLGDGSVELLGRDSVTI
NSGGEKIFAEEVETAIASHPAVVDVVVAGRPSERWGQEVVAVVALADQAS
ATSAEIIEHAGGSLARYKLPKAIVFRPQIVRSPAGKADYRWAREQAEQG
333991997YP_004524611.1 oxidoreductase [Mycobacterium sp. JDM601]MKVPFTWKVTGWFMIGWSPEFEVGKTRALHYFGEDLVAYRDESGELHVME
AHCKHLGAHLGHGGKVVEDRVECPFHGWQWGPDGCNKFIPYQPDRPNKAL
RLRVYPVLEQYGCVFLWHHPDGAEPGWQMPDIFGKFPQFATGPEGYYRAY
PEFSRRLSGEPVHPQIVAENAADSAHFQYVHHATVTPRLLEWKMTDREWH
FVAGFPDVNSDDPDQMALRFHSHLFGLGGAISIFEGVQQHRLIFTCTPVD
EGRSDLFYSIWWPRVPGDESEAPPEDVRARVEEQFLSTVEDDLGIWRYQR
YVEHPALSKVDAKPFMTLRKWATQFYDTPPAEPALSSR
333991995YP_004524609.1 hypothetical protein JDM601_3355 [Mycobacterium sp. JDM601]MTTMGSPQRLPQIIRGLGGVLPRSVRSLRGAPDWAPGSRRGMRQLGEVLL
DELTLTGMTLLAPTPVLARPLSACGPAAQELAGLGIDAAHTAPNPLRLSG
SRRRRLAGLTFEQLSFRHDPRLPPSLAEFDGPATAAVVVCRHRGAPRPWL
VWVHGAGQGNWSDLLVARVARLHRLGFNIALPVQPGHGVRRRAWPAYPGH
DPLANIAGMMRAISEVRAVVRWVTPQATAVTVAGVSLGSPVAGLVSHLES
GVDAVAVYTPIAGLNSMIAHHLWRWGPAGLSVADALRSETAAALMSVVDL
LATNPRPAADRRLIVAARHDQMAYPEPAVALHDRWGGRLFWHDGGHAGHI
LSRRVQAETERFLSQIGGGR
333991993YP_004524607.1 hypothetical protein JDM601_3353 [Mycobacterium sp. JDM601]MSSRVRSAREVVELYNLVVWNERDFALADELIGDVVVRHEVGEAHTLTHD
QAVARVVDHWKLFDKLRFELNLVVAGDDGEHVAIVYQSPMTLTDGTELTV
SSMEVFRVVDGKITEVWNCGYKQGVWA
333991991YP_004524605.1 transcriptional regulator [Mycobacterium sp. JDM601]MAGTESQAQARVGRRRSTTREHITHVAIDLFATRGFSEVSVDDVAQAAGI
ARRTLFRYYPSKNAIPWGDFDAHLHQLRELLDGIEPDAPLGDALRAALLA
FNTFDEGETARHRRRMRVILQTDELQAYSMTMYAGWRSVIAEFVARRAGV
APADLRPQTVAWTMLGVALSAYEHWLGDEQLALPQALGEAFDTIRGGLD
333991989YP_004524603.1 hypothetical protein JDM601_3349 [Mycobacterium sp. JDM601]MAAAAGAARATDTFDPDRGWRLHPQVSVRPETFGALLYHFGTRKLSFLKN
LTMVTLVTSLAEHPDARSACRAAGIDPGAESAYLRALGVLAASDILIPAD
PKETP
333991987YP_004524601.1 L-lactate dehydrogenase (cytochrome) LldD1 [Mycobacterium sp. JDM60MARDIWFETVAIAQERARKRLPKSAYSSLISASEKGVTVSDNVEAFSELG
FAPHVVGACEKRDLSTTVMGQELSFPVMISPTGVQAVDPDGEVAVARAAA
ARGTAMGLSSFASKPMEEVIAANPKTFFQIYWLGGRDAIAERVERARAAG
AVGLIATTDWSFSHGRDWGSPKIPEQMDLKTMIKMMPEALGRPRWFLQWA
KTLRPPSLRVPNQGRRGEPGPPFFQAYGEWMGTPPPTWEDIAWLRELWGG
PFMLKGVMRVDDAKKAVDAGVSAISVSNHGGNNLDGTPAAIRALPAVAEA
VGGQIDVLLDGGIRRGSDVVKAVALGARAVMIGRAYLWGLAAAGQPGVEN
VLDILRGGIDSALMGLGRASVHDLSPDDILIPPGFARALGVPSDGGR
333991985YP_004524599.1 membrane glycosyl transferase [Mycobacterium sp. JDM601]MRVLGRGSTLLGGSPTRLLRLAPAAQGMLSDGRLEVRDAVSAQLARTLLD
ATVAHPRPAGGPSHRDVTVVIPVRDNVIGLKRLIASLRGLRVVVVDDGSQ
APVCRDDLAAAHCCEVEVLRHPEARGPAAARNTGLGACTTDFVAFLDSDV
VPRRGWLEALLGHFCDPTVALVAPRIVGMAAHDHLVARYEAIRSSLDLGG
CEAPVVPYGKVAYVPSAAIICRCSALRELGGFDEELRSGEDVDLCWRLVD
AGSRLRYEPIALVAHDHRVALRDWVARKAFYGGSAAPLSARHPDKTAPMV
ISGWALAGWAVMALGSALGYLVSAAITALTGHRVARSMRGADTAPADVLA
VTLRGLAAAGLQIASALCRHYWPIALLAACVSQRCRRVVLLAAVSDGIVD
WLRHARCDGDDSRPLGLPAYLLLKRVDDLAYGAGLWGGVLRERNFAALKP
QIRS
333991983YP_004524597.1 cytochrome P450 [Mycobacterium sp. JDM601]MSAPIIDQAARVFTDPSAYADEPRLHAALTHLRANAPVSLVDHRPYRPFW
AITRHADIMDIERDNELWINEPRPVLAPADADDLQRSLLDSGMGLRTLIH
MDDPHHHKMRAIVSDWFRPKAMRAMKARIDELAKRYVDEMLRIGPECDFV
QDIALNYPLYVIMSLLGLPESDFPRMLRLTQELFGGDDDEYRRGITPEEQ
LPVLLDFFAYFNALTADRRENPTEDLASTIANARIDGEPLSDLDTVSYYV
IIATAGHDTTSAAIGGGLRALIEHPDQRERLRADLQLMPTAVEEIIRWVT
PVKEFMRTATADTEVRGVPIAKGESVYLSYVSANHDEEVFDNPFAFDVGR
DPNKHLSFGYGVHFCVASALARMEIDSFFRELIPRLDAIELTGEPQLIST
TFVGGVKHLPIRYRLRA
333991981YP_004524595.1 carboxylesterase [Mycobacterium sp. JDM601]MSTGSCRRRGPLAGAVVLALLAGLLAGCGRSDGAALQPGFGPRAVALNAD
VVRTAAGLLRGTVGPDHRLFQGIPYAAAPVGPLRWQPPAPMPAWQGVRDA
VKRGPWCIQPDAAEVDPISEDCLTLNVWTPTGSAAEPLPVMVWIHGGSFM
RGAGDIYHAQRLAVRGRIVVVTVNYRLGALGFLADPALGEAGNYGLADQQ
AALRWVRDNVGAFGGDPAKVTIAGESAGGMSVCDHLAAPESAGLFRAAII
QSGPCQAQVEVPDARRISRDYTESVGCAERGKRAAAEDAAVAGCLRGLSA
DRLTKPLWYARFGTDQLSGPVVGTPLLPADPVRVFRDGGAARVPVLLGVN
RDEFTLFVALRYLRVGREIAATEYLDELKDTFGSGEGPAVAEHYPPARFG
DSTSLAYAAAATDDIFACLADRMARGLAAGAPVYGYEFADPHAPAPELFD
HLPFPIGATHSLEMRYLFDIGGAPPLDPVQRRLSDQMIEYWTGFVVTGAP
VGVGQPDWPAAAAGADRRWMSLRPDGSRMITDFGAAHRCDFWATVRS
333991979YP_004524593.1 30S ribosomal protein S10 [Mycobacterium sp. JDM601]MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
333991977YP_004524591.1 50S ribosomal protein L4 [Mycobacterium sp. JDM601]MAAKEQTALKIDVKSPDGKKSGSVELPAELFDAPANIALMHQVVIAQLAA
ARQGTHSTKTRGEVRGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPK
PRDYSQRTPKKMIAAALRGALSDRARNGRIHAVTELVSGQTPSTKSAKAF
LGTITDRKQVLVIIGRADETGARSVRNLPGVHILAPDQLNTHDVLRADDV
VFSVEALNAYISGSAAHTQEQEVSV
333991975YP_004524589.1 50S ribosomal protein L2 [Mycobacterium sp. JDM601]MGIRKYKPTTPGRRGASVSDFAELTRSHPEKSLVRPLHGRGGRNAHGRIT
TRHKGGGHKRAYRVIDFRRHDKDGVNAKVAHIEYDPNRTARIALLHYLDG
EKRYILAPQGLSQGDVVESGANADIKPGNSLPLRNIPAGTLVHAVELRPG
GGAKLARSAGSSIQLLGKEGSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRRPNKPSDKLIVRRRRTGKKR
333991973YP_004524587.1 50S ribosomal protein L22 [Mycobacterium sp. JDM601]MTVTTEFPSAVAKARFVRVSASKARRVIDLVRGKSVSEALDILRWAPQQA
SLPVAKVIASAAANAENNNGLDPSTLVVATVYADEGPTAKRIKPRAQGRA
YRIRRRTSHITVVVESRPSKGGPARSAGAARARRAQASKAASEKGSEKGS
VAAKAPATKASAAKAAEKTTEKAAAKKAPAKKAAAKKAPETSDAKEGSQ
333991971YP_004524585.1 50S ribosomal protein L16 [Mycobacterium sp. JDM601]MLIPRKVKHRKQHHPKQRGLASGGTAVTFGDYGIQALEHAYVTNRQIESA
RIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPG
RVLFELSYPNEAIARAALTRAIHKLPIKARIVTREEQF
333991969YP_004524583.1 30S ribosomal protein S17 [Mycobacterium sp. JDM601]MAQAAKANATEKGPKHTPRAEKPRGRRKTQIGYVVSDKMEKTIVVELEDR
VKHPLYGKIIRTTKKVKAHDENNTAGIGDRVSLMETRPLSATKRWRLVEI
LEKAK
333991967YP_004524581.1 hypothetical protein JDM601_3327 [Mycobacterium sp. JDM601]MAEGDQSFDITSGSGTDATDLGSVTASENVTNLFGGIHNTQFTITDVDPA
SDATASDLPTVGTVYDVMNFGNGFANIYTDIPGSEGAANSITDTLVTPFG
DFDIPTDFDAAGLLDPGDAFSGVSALGADAADAAGGAAADAAGGAADAAA
SGAADAAAGAADAAGATDIASMFDPLSFLGF
333991965YP_004524579.1 LuxR family transcriptional regulator [Mycobacterium sp. JDM601]MELRQLKHFVAVAEELHFTRAAAKVHVVQSTLSASISGLEAELGTALLVR
NNRRVDLTTAGQALLPDAQHALAAAERARAAVDAVRGLLSGQLRIGVIQG
LGTVDLPALLTRYHRSFPRIEITLRHDPIDTLVQATADGGLDLAFVSRPF
DGSRVKELSLGAEHLVLAVRHDDPLAGTGTVALTDLQQREFVERRAELRT
RMHIDSSCAELGFERNICAESNTPDDLVDLVAAGLGIALLPPALVAKSEH
IVAVATDPVIPRELALITPGERAPSPAAAAFLGELLSTGAGQPEMSGRRE
RSAV
333991963YP_004524577.1 hypothetical protein JDM601_3323 [Mycobacterium sp. JDM601]MLTELVGIPGGVFRMGSTSFYPEEAPIHTVAVAAFAIERHPVTNAQFAEF
VAATGYVTVAEQEPDPVYAAEPGALVFTPTAGPVDLRDWRQWWQWVPGAS
WRHPLGPHSTIEHKPDHPVVQVAYPDAAGYARWAGRRLPAEAEWEYAARA
GTSSTYPWGEEEKPGGELMANTWQGAFPYRNDGALGWSGTSSVGSFPPND
WGLLDMIGNVWEWTTTEFCGHHRLDAAPKSCCAPDGPADPGVSQTLKGGS
HLCAPAYCHRYRAAARSPQSQDTATSHIGFRCAAD
333991961YP_004524575.1 50S ribosomal protein L24 [Mycobacterium sp. JDM601]MKVHKGDTVLVIAGKDKGAKGKVLQAYPARNRVLVQGVNRIKKHVANSAN
QAGASSGGIVTQEAPIHVSNVMVVDSDGKPTRVGYRVDEESGKKVRVSKR
NGKDI
333991959YP_004524573.1 30S ribosomal protein S14 [Mycobacterium sp. JDM601]MAKKALINKAARKPKFAVRAYTRCNKCGRPRAVLRKFGLCRICLREMAHA
GELPGVQKSSW
333991957YP_004524571.1 50S ribosomal protein L6 [Mycobacterium sp. JDM601]MSRIGKQPVPVPAGVDVTIDGQNVSVKGPKGTLELTVAEPINVARNDDGA
IVVTRPDDDRRNRSLHGLSRTLVANLITGVSEGYVRKMEIFGVGYRVALK
GSDLEFALGYSHPVLIKAPEGITFAVETPTKFSISGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQVRRKVGKTGK
333991955YP_004524569.1 30S ribosomal protein S5 [Mycobacterium sp. JDM601]MMAEQPTGASSAGPDTGSAPRTDGRDNRDNRGGRGGRDGGRGGRDGRDGD
KSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVP
AAIAKGVEEARKSFFRVPLIRGTITHPVQGEAAAGVVLLRPASPGTGVIA
GGAVRAVLECAGVHDILSKSLGSDNAINVVHATVAALKMLQRPEEVAARR
GLPIEDVAPAAMLKARRESESLAASAAREGTA
333991953YP_004524567.1 50S ribosomal protein L15 [Mycobacterium sp. JDM601]MMTPIKLHDLRPAPGSKTKRTRVGRGEGSKGKTAGRGTKGTKARKNVPVR
FEGGQMPIHMRLPKLKGFRNRFRTEYEVVNVGDINRLFPDGGAIGVDELV
AKGAVRKNTLVKVLGDGKLTVKADVTAHKFSGSARDKITAAGGTATEL
333991951YP_004524565.1 hypothetical protein JDM601_3311 [Mycobacterium sp. JDM601]MGGNGGNGAAGGIGETGADGGVGTAGTSEAPDGGTGETGHTGGQGLAGGN
GGAGGQGGAAGTGSTDGAVGAGGIGGNGGIGGQGGTGGNGGTGGAGYDQP
GTTGLSGGNGGTGGAGGTGGQGGEGGTAGLGGLNGAGVDRADSGTDGTTG
LQGVGGNGGEGGAGGDGATGTTGGNGSTGNTGTTGTVGSPTGGTGGTGGD
GIDGGVGGNGGTGGQGGAAGTGSTNGNVGAGGKGGDAGDGGQGGDGGAGG
TGGTGYTSPTANGVDGGNGGTGGTGGNAGHGGTSGTAGAGGLDGAGNNPA
NAGSAGSTGADGHAGVGGDGGVGGNGAQGTAGTTTLAAGTGGKGGTGGNG
GQGGLETDGATHAQQGDGGDGGTGGKGGTGFAGANGQDSFVLTPATDGKA
GGAAGSGGTGGTGGSGYNAGNGGTGGVGGDGGTGGNGGNATLAIGGLVTP
GDGASGGTGGTGGVGGLAGTADGGAAGANGAGGDGGVGGTGGNAGSALVG
IGSTGTAGTGGTGGVAGVGGGSGADQGAAGVGGTGGQGGQGSVGAVANAL
GGVGGNGGTGGAAADQSGSIGGVGGQGGTGGGGLVAGVVGGAGGQGGAGG
AAADQTDSIGGAGGQGGQGATAVVGALGGTGGTGGTGGAAGDAAGSNGGA
GGQGGTGGSAVVGALGAGDGGDGGTGGAAGNIAGSTGGTGGQGGDGGAGL
ANVLAGGDGGDGGTGGSGTAPGTIGGDGGLGGTAGPGVLNLIGGAGGDGG
DGGNGGAIGGTGGDGGTNSNGAAGEPGEGPSGQTGGAGGAGAPGGLL
333991949YP_004524563.1 endopeptidase IV [Mycobacterium sp. JDM601]MGQVETETDLFYNDFVVRVAQGRNLSTEAVDAVARGRVWTGADAAERGLV
DELGGLRTAVRRAKVLAGLDPDAQVRTVSYPGSSLWEFIRPRQSSQPAAA
FSDAVGALLVRSLTGIAEQAGRSISGAQVLWLGESRWM
333991947YP_004524561.1 PPE family protein [Mycobacterium sp. JDM601]MDFGLVPPEIQSALMYAGPGPGPISATAAAWDGLAAELDAASASYASLVT
DLTSTGWLGSTAALMAAAVSPYLAWMHTTAVQCAETAAQVRAGVAAYEEA
FAATVPPPVIATNRAELLTLLATNIFGQNTAAIAANQAEYAEMWAQDAAA
MFGYASAASTATQLTPFTAPPKTANSDGSDNTTAAAAQAAGSATATQTQN
ALAGVPQTLQQLALPMAAPAAADPVVGQATAAGVSGISASSAYHTIIGSA
NFFQRIYSQFQSSFAASNEPSTTDIMERLNRIGLVTGAVDSDEVGRAADG
GPLGTLGLGGFGDWHNWARFFKGFPLLKLSAAGSMGESGLVGGLSVPPTW
AEALPDVRLAAAETTGTGVNAAPSAAGGGFGMLGAQAALTGMAGRALAGA
VLPARENTRSTAPAQERPSSTAAKEIAEALREYASLRDSGIITEVEFNKH
KERLMSLDPLSGR
333991945YP_004524559.1 hypothetical protein JDM601_3305 [Mycobacterium sp. JDM601]MKRLLLLAGLSAMVGLAAPAHAAPSGVDGQFLATLSGAGLSHRASDQATV
SAGRAVCQLMDAGLSPMDTVVAVQATNPGFTIQTAGQFAAISTAHYCPEH
M
333991943YP_004524557.1 O-methyltransferase [Mycobacterium sp. JDM601]MARTENDSWDLASSVGTTATMVAVARALATAEADPLISDPFAAPLVRAVG
IDFFTGMLDGTLEPAVAAEARAAAEPMTAVMAVRTRFFDDFFLQATEAGT
RQAVILAAGLDSRAYRLAWPPGSAVYEIDQPDVIEFKTSTLAELGAQPTA
DRRTVAVDLRDDWPAALRRNGFDETKPTAWSAEGLLIYLPPQAQDRLFDN
ITALSAPGSRLATEYHPDGAAALGDSNQSLGQRFADQGLDLDMANLVYAG
ERHPVGPYLNERGWQVNERTRDEVFGCYGRSFPDGDIVARLRSSVAIEAL
RS
333991941YP_004524555.1 preprotein translocase SecY [Mycobacterium sp. JDM601]MFSAFISSLRTVDLRRKILFALGIIIIYRLGAAIPSPGVDYQNVQQCIKE
VSGGDAAQVYSLINLFSGGALLQLTVFAIGVMPYITASIIVQLLTVVIPR
FEELRKEGQSGQNKMTQYTRYLTVALAVLQATSIVALAANGGLLQTCSLR
HDIIADHSIFTLVVIVMVMTAGAVLVMWLGELITERGIGNGMSLLIFVGI
AARIPIEGKTILDSRGGLVFTMVCLAALVIVVGVVFVEQGQRRIPVQYAK
RMVGRRMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPQLVTQLVRSGSGG
VGNSWWDKAVSTYLSDPSNLVYIAVYFGLIIFFTYFYVSITFNPDERADE
MKKFGGFIPGIRPGRPTADYLRFVLNRITLPGSIYLGVISVLPNLFLQMG
NSGTVQNLPFGGTAVLIMIGVGLDTVKQIESQLMQRNYEGFLK
333991939YP_004524553.1 methionine aminopeptidase [Mycobacterium sp. JDM601]MIGLPKRRVPHRSPGELDAMAAAGAVVAAALAAVREAAVAGTSTLQLDDI
AESVIRDAGATPSFLGYHGFPASICSSVNDRVVHGIPSSTEVLELGDLVS
IDCGAILDGWHGDAAITLGVGKLAQADEDLSAATRQALGAGIAAMVPGNR
LSDVSHAIETGARAASAEFRRSFGIVAGYGGHGIGRQMHMDPFLPNEGSP
GRGPLLVAGSVLAIEPMLTLGTDQTVVLDDEWTVVTADSSRAAHWEHTVA
VTDDGPRILTVA
333991937YP_004524551.1 signal transduction histidine kinase [Mycobacterium sp. JDM601]MSTSGNNRSRARKRGAVRDFGDFVDPNHELALLRELIQAASSGPGVEPLA
AAAARMITAATGTDVCFVHVLDDTERSLTLTGATPPFDTEVGKIRLPLES
GVSGWVARHREPVVISDDKEADPRYVPIESLRGRDFTSMVSVPMETDPGG
LVGVLNVHTVERRDFAPGDIELLRVIGRLIAGAMHQARLHRQLVARERAH
ELFVEQVIEAQEIERRRLAGDIHDGISQRLVTLSYRLDAAARAVGNDPDE
ASQQLEAARELAGLTLQETRVAISGLRPPVLDDLGLSGGLASLAQSIPQL
KIELDLAEIRLPEHIELALYRIAQEGLQNVVKHAAATTVRLGFTVTADPD
VARLEIVDDGVGFDTFEHPVGGDDMGGYGVLSMAERAELVGGRLNIRSRP
GAGTAVTATIPVPSPSARACASPADTPD
333991935YP_004524549.1 haloacid dehalogenase [Mycobacterium sp. JDM601]MQITTELATWTSAGRPFWWDQVQPDAEVYPLQAVIFDIDALSDADGEPRS
GLVDLVLSLFATGLWVAVVGAGPRDVVQARVRELIGDGMTETIVTAEDLT
GPAGDAELYRLALWELGIVAGESLVIAGSEAGARTAAAIGLPAIFADRDG
YDGLSANGCRELQAQRVVARFSCREAG
333991933YP_004524547.1 3-hydroxyisobutyrate dehydrogenase [Mycobacterium sp. JDM601]MQTVAFLGLGHMGGPMSANLVAAGHTVRGFDPVPAAATAAEQRGVSVQPS
ASEAVAGADVVITMLPHGDAVKRCYADILPAAQPGALFIDSSTISVADAR
EVHALAGSHGFAQLDAPVSGGVTGAVAGRLAFMVGGEQDAVQRATPVLEP
MAAKVTHCGAAGAGQAAKICNNMVLAVQQVAVAEAFVLADKLGLADQALF
DVMTGATGNCWALHTNCPVPGPVPTSPANRNFEPGFAAALMNKDLHLAMD
AVGSTGANAPLGSHAAAIYAEFAAEHGGKDFSAVIEMLRGS
333991931YP_004524545.1 methylmalonate semialdehyde dehydrogenase MmsA [Mycobacterium sp. JMSTQIPHFIDGRRTAGGSQRSTDVFDPNTGEVQATLPLANTADVDGAVAS
AAAAQRGWAAQNPQRRARVMMRFIDLVNANADELAELLSREHGKTLDDAR
GDIQRGIEVIEFCVGIPHLLKGEHTEGAGPGIDVFSLRQPLGVVAGITPF
NFPAMIPLWQAGPALACGNAFILKPSERDPSVPVRLAELFVEAGLPPGVL
QVVHGDKEAVDALLHHRDVAAIGFVGSSDIAQYIYSTATANGKRAQCFGG
AKNHMIVMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGEQTAERLR
GRLVERINNLRVGHSLDPKADYGPLVTRAALERVNDYIGQGVAAGAELVI
DGRERASDDTQFGDADLSGGFFAGPTLFDHVTTEMSIYTDEIFGPVLCMV
RAADYEEALRLPSEHEYGNGVAIFTRDGDTARDFTSRVQVGMVGVNVPIP
VPVAYHTFGGWKRSGFGDLNQHGTASITFYTKVKTVTQRWPSGIKDGAEF
HIPTMQ
333991929YP_004524543.1 hypothetical protein JDM601_3289 [Mycobacterium sp. JDM601]MQPAVREGEHRQHAVAVEEVAELLAPGIELPGSVAVQRAMQIGGSSPS
333991927YP_004524541.1 dTDP-glucose-46-dehydratase RmlB [Mycobacterium sp. JDM601]MRLLVTGGAGFIGANFVHSTLAQRPGAEITVLDALTYAGSRESLGDITAD
IRLVEGDITDATLVSQLVAESDAVVHFAAETHVDNALADPEPFLRSNVVG
TFTVLEAVRAHRVRLHHVSTDEVYGELALDDPRRFTETTPYHPSSPYSST
KAAADLLVRSWVRSYGTHATISNCSNNYGPYQHVEKFIPRQITNLLTGRR
AKLYGSGANVRDWIHVDDHNSAVWAIMTGGHPGRTYLIGADGERDNRSVL
QAILRLMDHDPDDFDHVADRPGHDLRYAIDPSALRDELGWKPEHTDFEAG
LRATIEWYRANESWWAPLKDAAEARYAELGR
333991925YP_004524539.1 translation initiation factor IF-1 InfA [Mycobacterium sp. JDM601]MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
333991923YP_004524537.1 30S ribosomal protein S13 [Mycobacterium sp. JDM601]MGVDLPRDKRMEIALTYIYGIGRTRAGEILAATGIDKDQRSKDLTDEQLT
ALRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTK
TNARTRKGPKRTIAGKKKAR
333991921YP_004524535.1 30S ribosomal protein S4 [Mycobacterium sp. JDM601]MARYTGPATRKSRRLGVDLVGGDQAFEKRPYPPGQHGRARIKESEYRLQL
QEKQKARFTYGVMEKQFRRYYEEAVRRGGKTGEELLRILESRLDNVVYRA
GLARTRRMARQLVSHGHFTVNGVKVDVPSYQVSQYDIIDVKDKSINTVPF
QISRETAGDRPIPGWLQVVGERQRILVHQLPERAQIDVPLAEQLIVEFYS
K
333991919YP_004524533.1 50S ribosomal protein L17 [Mycobacterium sp. JDM601]MPKPTKGRRLGGSSSHQKALLANLATSLFTHGRIKTTESKARALRPYAEK
LITHAKKGTLHNRREVLKKIRDKDVVHSLFAEIAPHFADRNGGYTRIIKV
EARQGDNAPMAVIELVREKTVTSEADKARRAGAKKAAAKAEKPAEEPAEK
PAATETVEEPAAEAAEATEAADAAETTEGTDES
333991917YP_004524531.1 cutinase [Mycobacterium sp. JDM601]MKAFRILAACAVAAALLISPVPSSPAFADGCPDAEVIFARGTGEPPGLGR
VGNALVGALRNQTSRSIGSYAVNYPASYDFGRAADGANDASGHIMWMMEN
CPGTRLVLGGYSQGAAVIDIIAAAPVPGFGFTAPLPPEAADHVAAIAVFG
NPSNKIGQPLTNSPVYGFKTIDLCTDGDPVCSPGRMFSAHSGYTPGMTNQ
AASFVAGLL
333991915YP_004524529.1 membrane-anchored serine protease (mycosin) MycP4 [Mycobacterium spMMRGAKVVRIARLSAAALIAGTTQYAPPASAVAPPPIDSALLPAAGPAAP
ARATVQREVCGVPTLQPDAPVTQLDGLDLPAVWALTRGAGQRVAVIDTGV
APHRRLPGLVGGGDYVSSGDGAQDCDGHGTLVAGIIGAAADPATDRFAGL
APLATVIGIRQSSAKFAAAADAPGVGDVDTLAKAVRTAADLGSSVINISA
VACLPAGSGLDDRALGAALAYAVEVRNAVVVAAAGNTDDGCGAGGPMIVT
PAWYDDYVLTVGSVDAHGAPSAFTLAGPWVDVAAPGEGVLSLSTIADAMA
NTVAGSPVHGTSFAAPVVSGLAALIRARFPDWTPRQVMDRIKATAHHPPG
GRDDVVGAGVIDPLAAVSADTTRPAAGRPVPRPAPPGTPVAPDDEPATEP
DGLRAAGTGTGVLLALLLAVVIARAAAARRRGPAAPGPG
333991913YP_004524527.1 hypothetical protein JDM601_3273 [Mycobacterium sp. JDM601]MTELGRDASPPPAPPSGEITVAAPPPVQRQNSPVTLTRLLPLVMSVGMLA
MTAVLYRSGSPIARSPVFALLPLLMLASAAAAVLAGRNRDDLDGNREDYL
GYLAALRESATATAAAQRSFLVWEHPDPEALWTLAGSDRMWQRRPGDDDG
GRVRVGLGPVVLATRLVPPPDEQAGRADPVTATALRRFLHTHATVPEVPI
TTPLLGAAPLQLHGDRDRARGLLRAMICQLAIMYGPDALLIAAVAADPPG
HWDWLKWLPHHQHPSAVDTTGPLRLTYPDLPAAQAALTGRPAVVVIDDPV
TGLMLTEAAAWDAGRARRLRVSTTALGDCDGARPDFLDTADALACAQRLA
GHRAVRPGGPRSWAQLVGIGAVDGFDPSAAWPGAPAQRLCVPIGTDPQGD
PVRLDIKEAAERGSGPHGLCIGATGSGKSEFLRTLVLGMTVRHSPADLNL
VLIDFKGGATFLGFEETGHVAAVITNLADEAPLVERMREALTGEMQRRQE
LLRAAGVAGVSDYRQARRAAAAALPALPALLVIVDEFSELLDQQPDFIDM
FVGIARLGRSLGIHLLLASQRLEEGRLRGLESHLSYRVCLKTVSAAESRL
VLGTADAYELPNTPGSGFLRTADGELRRFQTAYVSGACPAPLPVPSEVRL
FTAAPIGPAGPEPRAGGRTVLQAVLQRLSGHGPAARQVWLPPLADSPALG
ELLDDGYPDLSVPIGIVDRPFEQRRTPLVIRLDGAAGHVAVVGAPQSGKS
TTLSTLIAALSAAHDARRVALYCLDFGGGGLAALGSLPQVGTVAGRGQPE
LVRRTVAELAAILERREARREAAGGGPAGDVFLVIDGWAALCREFDVEAT
ITAVAARGLSHGVHLVLSASRWAEIRPALRDLIGTRIELRLGDPAESELD
RRQARRVPGDRPGRGLTAEGLHLLVARPQDWEPLRCDDYTVAPIPLLPTV
VDRAALTAGVDHPVLGVDERGAVTVDFGRQPHLLIFGDNECGKSTVLRTL
CRELARTRGPRQAQLLVVDYRRGLFGVVENEYRAGYAMTAAACASLVAAL
IDRLARRMPGPDVDAQQLRDRSWWSGPELYVLVDDYDLVATAGGNPLAPL
LEYLPHAGDLGLHLVIARRSGGAARSMYEPVLAALHDLGAMGLMMSGDAT
DTPLIGSVRPRRLPPGRGTLITRGGGERLIQVAWQP
333991911YP_004524525.1 hypothetical protein JDM601_3271 [Mycobacterium sp. JDM601]MLQSFVGRMRAVPPSVWSGMAAARFQDVLDRWNTESLRLHQALARIAETI
RQNERALREVAESHSHHIAAVGDGI
333991909YP_004524523.1 50S ribosomal protein L13 [Mycobacterium sp. JDM601]MPTYTPKAGDTTRSWYVIDATDVVLGRLAVAAATLLRGKHKPTFTPNVDG
GDFVIVINADKVAISGDKLQKKMAYRHSGYPGGLRKRSLGELMERNPDRV
VEKAIIGMLPKTKLGRQIKTKLRVYAGPEHPHTAQQPVPYEIKQVTQ
333991907YP_004524521.1 phosphomannomutase MrsA [Mycobacterium sp. JDM601]MGRLFGTDGVRGVANRELTAELAVALGSAAAQRLSTGTERRVAVVGRDPR
ASGEMLEAAVIAGLTSQGVDALRAGVLPTPAVAYLTSAYEADFGVMISAS
HNPMPDNGIKFFGPGGHKLDDATEDQIEDLVAAGPGLRPVGAGLGRVVDA
KDALDCYLRHLGESNRARLDGLTVVVDCAHGAAFQAGPRAYRAAGATVVA
INADPDGLNINEGCGSTHLEPLRAAVLAHGADLGLAHDGDADRCLAVDAA
GNVVDGDAIMVVLALAMRDAGELAGDTLVATVMSNLGLHLAMREAGIDVQ
TTDVGDRYVLEQLRAGGFTLGGEQSGHIVLPQLATTGDGIITGLRLMARM
AQTGTPLAGLASAMRTLPQVLINVEVADKADAVSRLAVRTAVQRAEQELG
VTGRILLRPSGTEQLVRVMVEAADEDTAHQIAVSVAETVRAGH
333991905YP_004524519.1 hypothetical protein JDM601_3265 [Mycobacterium sp. JDM601]MAPRYDVAARLAEGREAVAHTQAYVSACHRRGYGHPDLTGYDGQLADRYD
SEAGLDLRCLDADCAALAALAGAAEDALRLQRGQLDALAAAWRGPGADAA
AGFVRRHCEAGAQLTARLRAAATGCEVLRDELWRLVDTKVAAVTAVDDRA
GAHRPAWLAAAHAVTSGSGDEHAAEVIEKQVIPYVDNDVRGEWVTAVLSV
RDGVAGAYRAAVGSADPAPGTVFAVPGDLGPVVLPDHPTGAAPVAAASTA
PVAAEVAPAADVAPAGVPAAPGARQDAVVPEPAAALDDLPADPGLPAGLG
LPGDLGLPTGGLPTAGGGGLGGLGGLGGLIPRLADAFGDPGSADGFGDPF
EDPAATDDRDPDDHDDPEPDDPEGEAPDEPGDEAAVEEAAAEDAVAPTES
ESAPSDLEGQAGAQAEPAAETTEADDSGQAPGPSADGAPKTPCEVAAEEL
PQVGQ
333991903YP_004524517.1 PIN domain-containing protein family protein [Mycobacterium sp. JDMMLLDANLLLYAVDADSKHNPVAAAWLEETLNGDNRIGLPWQTIGAFLRII
THPRVTENPLPPSEAWSYVADWLAVPVVWIPPATEATARVYAGICAQADV
AGNLVPDAQLAALAIEHGVELASADSDFQRFPGLRWFNPLTSQ
333991901YP_004524515.1 hypothetical protein JDM601_3261 [Mycobacterium sp. JDM601]MQQALRPYVTAGIALVGSGLISVTPAVAPMPGISTIRDVALTGAFDDFLQ
PWIDQYNTAAANAQLLINNFALAPFVGYQQQIANQGDLWSQAINDPSTIP
DVTNQLQEDAKSAADAYSLWNAGPLGFLTPGDPVTEMVTDHTLSGEADLD
LTGETISTLGHKLLMGFLPAMLPADLDPETVTPILNFLASPLSGLIMGAL
GPSLSPWVALMNSISDGDGLNEIMANMVGAFFNGATLNLDFLIPIVEQTG
LLPEGTNIYHIDLALGGLFTPGVVASAPNLVPGTGVELAAPGGSIFNSIG
LDLDANVLGASLPAVVPAHAVGPIGAWEGWMQAMGAVLGSGWSGKSNPQD
AVAPLTGFQLPQIPDDLFDDGGAAAGASDAASPDMLQDLLDLFIGAGG
333991899YP_004524513.1 coenzyme F420-dependent oxidoreductase [Mycobacterium sp. JDM601]MRIGVQLSYAGGFKEAAEQVVELERVGIDVVAVAEAYSFDAVSQLGYLAA
KTSRVELVSGVVPIYTRTPALLAMTAAGLDFVSDGRFRLGIGTSGPQVVE
GFHGVPFDAPLGRTREVVEICRAVWRRERVRYDGKHYQLPLPADRGTGLG
KPLRLINHPVREAIPISIASLGPKNVELTAEIADGWQPVFFYPERAAEVW
GDALKAGAAKRNPTLGPLDIMAGASLAIGDDVEDRLAWAKPQLALYIGGM
GARTRNFYHNLATRYGFGEVADRIQELYLSGRKTEAINAVPDELVRHTSL
IGPRGLVAERIAAYAEAGVTTLLAGPLAKDPGEAVRFVAELRELAPA
333991897YP_004524511.1 hypothetical protein JDM601_3257 [Mycobacterium sp. JDM601]MSRRDSSQSGNTRARNRSRVVGATSAVGAFLAFGMAPLAAAPAANADVDF
DLGDIFGDLFSSWSTTDAGDAGTTWDLDALFGDPGSAAGDPFSWTGIMDQ
WFYGPIHTLTQLWITNPLGESINGMINDWSGMYLIGNGVDGTEDSPDGGD
GGLWLGDGGDGWSSDQAGVGGGDGGAALGWLGNGGDGGAGGAGAAGGDGG
AGGWWMGNGGNGGAGGAALVDGGVGGAGGDGGAAAAWFFGNGGAGGAGGA
GMDGANGGVGGALSGGAGGNGGAGGRSGYLFGDGGKGGAGGTAGDGGNAV
GDNGTNGLTGGAGGTGGSGGAGGARGSNYYAGSFYGSAGQAGDGADGGNG
GEGSDAATDGSGNYLGNGGAGGRGGDAGGGEHAGNGGNGGDAGDGNNGGQ
GGLGGRGGTALGTNVSGNGGDGGTGGLGATGTGGSGGAGGAGGNSDVGTA
GNGGNGGQGGNGATDDNTVSTRGGNGGQGGQGGSYNGTAITGTSGNGGNG
GAAGDGTLRGGNGGNGGGGGFSSGGNGGDGGDGGAAGEGLGWSDGTTTWS
IGGNGGSGGAGGSAGGPAVGGNGGAAANGADGATGTNVVSQGGNGGAGGR
GGDSSGGTTGVAADGGAGGNGTAIGGNGGSGGQGGSGYQGLSTNADGGVG
GNGGAGGNSGGVEIPAGATTPAGFGAASHAGNGGAGGSGGSSSSSAAGGD
GGDGGIGGSGAGSVDGGTGGAGGAGGNGVTAGTGGNGGAGGTAAAGDGGT
GGTGGRGGNGGPGADGLSGIPLLPGGANGDGGDGGNGNAGGLGGNGGVGG
GSTSGTGGNGGAGGAGGSGGAGGPGGPGGTNPDTGDGYDGGDGGNGAIGG
TGGNGGAHGAGGAGNGTGGAAGSGGTGGSAGAAGPGGAATGDGTPGTDGT
AGNAGADGANGTPGA
333991895YP_004524509.1 hypothetical protein JDM601_3255 [Mycobacterium sp. JDM601]MGAGMIAVTPVAAPLSALSDIQSPSVQLTAGGFADVMSEATANFTQLYNN
FALAPFVGVQQFIVNIQGFLQELQDGSDPGTVLAEFQANLASIGSAFALT
NSGLDDDAFSELVGQVTPHTLDDFNDLGGLTDGTGDLTIGHNLLGSVLPS
FLPEDIDPDMVSEVLNFLSSPLSGMIMGSLGPMLSPMVALLASITDGDSF
EQILASPLDGLLNGATLDLDALIPTIESAGLLPDGTVINHLDFALGGLLS
PGLVGAGPYADAAGNEVIPVGGSIFSSLGLNITVPEALGIPGPFNIDVPS
YAVGPIAAMVGWQQAMGAVLGNGWDGKDAVQTPPIFGLDPLVADDAGAGV
ASLFGDLLSDI
333991893YP_004524507.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MPHNSPATAHSLVDMLRRQADHRRDTVAFVFAPDGIEEHSRLTYAELDRS
ARAIAVGLQQQGAAGRRVLVVCRPGLDSVAAYFGCLYAGAVAVPVQDRLA
RLTLIAPDARAGFALADSATQDKLRARVDGLTKRPLRWLDPASPGADPDS
WVPPDIDTGTTAALQYTSGSTRAPKGVVLTHGNLLANLAAIHEAWGGDER
AVTVYWLPQHHDMGLIGGILEMVYVGCTTVLMSPAAFITRPMRWLEAMSR
YRATGTTAPNFAYQLCVERSTAQERAALDLSHWSTAMNGAEPVQASTLRS
FADAFAPAGFRPEAFLPVYGLAEATLLVSGGSDATAPVIRHIDRGALGQD
RVVEINDADDAGTVELVGCGRVRGGLQIVIVDPETRRRREADQVGEIWIS
GPSVAHGYRGKPEDTEQTFGAYLAETGEGPYLRTGDLGFLREGEVFITGR
CKDLIILRGNNYYPNDIEKSVQGCHPTLLSGRGAAFSVAPKPGAGEELVM
LQEVSPTGDHTAYTGLLEAIRAVIARRHGIGAHAVVLVEPGSIPTTSSGK
IQRQAARQRYLDGDITALAEWRAPPGTGAAAAEPAAAALKAAAAQRAVAL
QYWKTRQS
333991891YP_004524505.1 glucosamine-fructose-6-phosphate aminotransferase GlmS [MycobacteriMCGIVGYVGQRPAREVVVEALRRMEYRGYDSAGIAVVDGVGQLTIRRRAG
RLANLEAELADTDPALLVGGTGLGHTRWATHGRPTDRNAHPHRDAASKFA
VVHNGIIENFTALRDELEREGVEFTSETDTEATVHLLARAYRHGDTAGDF
VASVLAVVRRLEGHFTVVFAHADEPGTIVAARRSTPLVVGIGDGEMFLGS
DVAAFIPYTRNAIELGQDQAVVITADSYRITDFAGQDMTGTARPFHIDWD
LSAAEKGGYEYFMLKEIAEQPTAVAETLLGHFEDGRIVLDEQRLSDQELR
EIDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLDRS
TLVVAISQSGETADTLEAVRHAKEQKAKVLAVCNTNGSQIPRECDAVIYT
RAGPEIGVASTKTFLAQITANYLVGLALAQARGTKYPDEVEREYLQLEAM
PELVSRVLEGIDSVAELARQFAKSSAVLFLGRHVGYPVALEGALKLKELA
YMHAEGFAAGELKHGPIALIEDDLPVIVVMPSPKNAAMLHSKLLSNIREI
QARGAVTIVIAEEGDETVRPYADHLIEIPGVPTLYQPLLSTIPLQVFAAG
VAQARGYDVDKPRNLAKSVTVE
333991889YP_004524503.1 3-oxoacyl-ACP reductase [Mycobacterium sp. JDM601]MSGVVITGAASGIGRACAEALIADGRRVALWDIAPGVLEVADGMAMPGAV
VDVCDDAALPAAVAAAADALDGIDGLVHAAGRVLPEPVGAYTGESWDAVM
DVNLRAQAMLVQLMLPHLEAVARAGGSPAVVGISSIEGLTANPFIPAYCA
SKAGLLGLTRSMAAQLGPAGIRVNAICPGFIETPMLQIALDVEEVAAGFV
AAAPLGRIGQPAEVAAAVAFLMSPRASFITGTQLVVDGGVTARHP
333991887YP_004524501.1 hypothetical protein JDM601_3247 [Mycobacterium sp. JDM601]MPHGPFLALPRPSWSVLVLARLVARAGRGGSMGNRPPVPTLDQQRWLKYR
PNQFRDAQ
333991885YP_004524499.1 glutamate decarboxylase GadB [Mycobacterium sp. JDM601]MTHSHPSVPAHTIAPAYTGRLFTSPVPALRMPDESMEPQAAYRFIHDELM
LDGSSRLNLATFVTTWMDPEASALMAESFDKNMIDKDEYPATAAIEQRCV
SMVADLFHAENLRDDDPASAIGVSTVGSSEAVMLGGLALKWRWRAKVGDW
QGRTPNLVMGSNVQVVWEKFCRYFDVEPRYLPMAQGRYVITPEQVVDAVD
ENTIGVVAILGTTYTGELEPVEAICAALDKLAAGGGPDVPVHVDAASGGF
VVPFLHPDLKWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRGADYLPEEL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRSGYTEVMRTLSDT
ARWLSHQLADSEHFEVISDGSAIPVVSCRLAGKRGYTEFDVSHELRTFGW
QVPAYTMPEGAEDVAVLRVVVREGLSADLARALFDDTMKAVTALDRLKPG
GHFDDQQHFSH
333991883YP_004524497.1 alanine racemase [Mycobacterium sp. JDM601]MTATSRTAGLLGEALVDLDAIAHNVRVLSDQAGAAEVMAVVKADGYGHGA
AQVARAALAAGAAELGVATVDEALALRAAGIAAPVLAWLHGPDTDFAPAL
TADVQIAVSSVRQLDELLDAVGRSGRTATVTVKADTGMNRNGIGAAGYPE
LLGALRRAVADDAIRVRGLMSHLACADEADNPVNNVQAQRFSDMLALARD
NGLTFEVAHLANSAGVMTRPDLAFDMVRPGIAVYGLSPLPERGDMGLVPA
MTLKSIVVLVRSIKAGEAVSYGHTWIAEADTTLALVPMGYADGVFRPLSG
RFDVLINGRRRPSVGRVCMDQFVVDLGPGPVDVTEGDEVILFGPGTNGEP
IAQDWADALGTIHYEVVNSPRGRVARTYRGDGSDGR
333991881YP_004524495.1 hypothetical protein JDM601_3241 [Mycobacterium sp. JDM601]MADTQHLATAEDTVALGTRLGGQLRAGDVVVLSGPLGAGKTVLAKGIAAA
MDVEGPVTSPTYVLAREHRARRPGDPAMIHVDLYRLLDESGLDLLAELDS
LDLDTELDDAVVVVEWGEGLAERLSERHLDVRLDRAAESDTRTATWRWHT
P
333991879YP_004524493.1 O-sialoglycoprotein endopeptidase Gcp [Mycobacterium sp. JDM601]MTTVLAIESSCDETGVGITRLAADGTLTLLADEVASSVEEHTRFGGVVPE
IASRAHLEALGPTMRRALETAGVQRPDAVAATIGPGLAGALLVGVAAAKA
YAAAWGVPFYAVNHLGGHLAADVYAHGPLPECVALLVSGGHTHLLHVRSL
GEPIVELGSTVDDAAGEAYDKVARLLGLGYPGGRVLDELARTCGREAAEI
PVFPRGMTGARDAPYAFSFSGLKTAVARYVEANPDFVPADVAAGFQESVA
DVLTAKAVRAATELGVSTLLIAGGVAANSRLRELAEQRCAAAGLTLRIPP
LRLCTDNGAMIAAFAAQLIAAGVPPSPLDVATDPGLPVVCASVRVPGRHA
G
333991877YP_004524491.1 molecular chaperone GroEL [Mycobacterium sp. JDM601]MSKQIEFDEAARRALETGVDKLADAVRVTLGPRGRAVVLAKSFGGPTVTM
DGVTVAREVDLEDPFENLGAQLVKSVATKTNDVAGDGTTTATVLAQAIIS
GGLRNVAAGANPIALGAGIAKAADAVSEALLAAATPVAGKESIAQVANVS
SRDEEIGEMVGEAMTKVGSDGVVSVEESSTLSTELQITDGVGFDKGFLSA
YFVTDFDSQEAVLEDALILLHRDKVSSLPDLLPLLEKVVEAGKPLVIIAE
DVEGEPLSTLVVNAIRKTLKAVAVKAPYFGDRRNAFLEDLAIVTGAQVIN
PDVGLTLREAGLDVLGTARRVVVSKDDTVIVDGAGTAEAIAARVKQLRAE
IEATDSDWDREKLEERLAKLAGGVAVIKVGAATETALKERKHRVEDAVAA
AKAAVEEGIITGGGTALIQARGALSKLASSLSGDEKLGVEVFAAALSAPL
YWIASNAGVDGAVVASKVAELPAGQGFNAATLTYGDLAADGIVDPVKVTR
SAVLNAASVARMVLTTETAVVDKPVEEAADAHGHHGHAH
333991875YP_004524489.1 transmembrane protein [Mycobacterium sp. JDM601]MDPVAATEFLARSTTLTSVGWIGYIIIGAIAGWIAGIVMKSKYGLLTDIV
VGVVGALIGGFLLSFVVDTASGGWWFTLFTAILGAIILLWLLRLFGREA
333991873YP_004524487.1 PPE family protein [Mycobacterium sp. JDM601]MIVAASGAVLSQPVGSLLLEAALLAVDGPLAGSQTALILGGTGQPTPSPE
YARSAENLYLNPLGFNGGSTDSTVCYMDGTDPCSAPLQVLTTPELFQQGP
SSLTGASLITLAVQNQFDANPGAFDADNPLTIFAYSQSATAASIAMSRLA
EAGIPADSLHFVFIGDPSAPDGVWQYLEAAMYATLGKDLSDYLLKLLGMT
EVLGNLTPNDLYSATIYGLPDDPVSNFADAYDNYGLWGALLGIFGPHVEY
LGLTPDQIADATTTVDGMLTYIEIDNSEINAFDAWLSALLEHGVANSDPF
QAVFDSLNLLFSNFF
333991871YP_004524485.1 3-hydroxyisobutyrate dehydrogenase [Mycobacterium sp. JDM601]MIGFIGLGNMGLPMAGRLAAAGRELVVYDTRGEVINRASKFGAHAASSPQ
QVADRAEIVLASLPSLQASSAVVEAVAEAVAGGANTKLFIDLSTVGSAVA
QRNHTTLQARGVAALDAPVSGGVGGASQGSLAIMVSGPRAAFDAAEALLD
ELGRPVFVSEKPGAAQTMKLVNNLMAATTLAATAEVMVMGVKAGLDPQVM
IDVLNAGSGGTHASRDKFPKAVLPRTFDYGFATGLMVKDVRLYLDEAGAL
GLPSQLADAVAALWESTLRDQGPESDFTSIVKVLESAAGVTVGASEEVVE
Q
333991869YP_004524483.1 hypothetical protein JDM601_3229 [Mycobacterium sp. JDM601]MRNQLLFGTLAAACALGLLGAPVANADEEGFLNELRADGFPGLTVGDAQL
PDGVVVANGWMACNRLHLGEKPEQTLAQVSPNDVEKGRMLINAAQHNLCP
DTL
333991867YP_004524481.1 transcriptional regulator [Mycobacterium sp. JDM601]MFFPPDGERGRARAQREQNAKRWCRSCPVLEQCRAHALAVGEPYGIWGGM
SESERHAALRCLRPSG
333991865YP_004524479.1 hypothetical protein JDM601_3225 [Mycobacterium sp. JDM601]MGVRDHLPPGLPPDPFADDPYDPSAALDAVEPGQPLDPQERTAVEADLAD
LAVYEALLAHRGIRGLVVCCDDCQQDHYHDWDMLRANLLQLLIDGTVRPH
EPAYDPEPDSYVTWDYCRGYADASLNGATSEADGYR
333991863YP_004524477.1 inosine-5'-monophosphate (imp) dehydrogenase GuaB2 [Mycobacterium sMLGLTFDDVLLLPAASDVVPATADTSSRLTRNIALKVPLVSSAMDTVTEA
RMAIAMARAGGMGVLHRNLPVTEQAGQVETVKRSEAGMVTDPVTCTPENT
LAEVDALCARFRISGLPVVDSLGQLVGIITNRDMRFEVDQNKPVAEVMTK
TPLITAQEGVSADAALGLLRRHKIEKLPIVDGHGKLTGLITVKDFVKTEQ
HPLATKDSDGRLLVGAAVGVGADAWVRAMTLADAGVDVLIVDTAHAHNRG
VLDMVGKLKAEVGERVDVVGGNVATRSGAAALVEAGADAVKVGVGPGSIC
TTRVVAGVGAPQITAIMEAVAVCAPAGVPVIADGGLQYSGDIAKALAAGA
STAMLGSLLAGTAESPGELIFVNGKQFKSYRGMGSLGAMQGRGGAKSYSK
DRYFQDDALSEDKLVPEGIEGRVPFRGPLTTVIHQLTGGLRAAMGYTGSA
TIEALQQAQFVRITAAGLKESHPHDITMTVEAPNYYVR
333991861YP_004524475.1 cholesterol oxidase ChoD [Mycobacterium sp. JDM601]MSALRLTEKGYRVGVLEAGRRYADPDFAKNSWHLRDFLWAPKLGCYGIQR
IHLLNNVMVLAGAGVGGGSLNYANTLYVPPEPFFADKQWAHITDWRAELM
PHYDQAQRMLGVVQNPTFTDADRIVKQVADDMGVGDTFVATPVGVFFGEG
GEKTPGKTVPDPYFGGAGPQRTGCLECGECMTGCRWGAKNTLVKNYLYLA
ESAGAQVHPMTTVTGFEQGGDGLWQVRTVRTGLRVRRHRKTFTARYLILA
AGTYNTQKLLFKMRDRGKLPRLSDKLGVLTRTNSESIVGAATLDVNPDLD
LTHGVAITSSIHPTADTHVEPVRYGKGSNAMGLLQTLMTDGAGPQGTDVP
RWRQLLDQAREDPAHILRLLNPKQWSERTVIALVMQHLDNSITTFTKRGR
LGIRRYTSKQGHGEPNPSWIPVGNEVTRRIAAKIDGVAGGTWGELFNIPL
TAHFLGGAAIGDSPEHGVIDPYQRVYGYPTLAVADGAAVSANLGVNPSLS
ITAQAERAASLWPNKGEADQRPAQGEPYRRLEPIAPKNPAVPDQAVGALR
WSAGTR
333991859YP_004524473.1 hydrolase [Mycobacterium sp. JDM601]MVLGLPETVRACLFDLDGVLTDTASVHTKAWKAMFDAYLAQRAERTGAPF
VPFDPIDDYRRFVDGRKRDDGVRTFLASRDIVLPDGGDDDPPDAETVHGL
GNRKNAAFLTALQADGVDVFEGSRRYLAAVTAAGLATAVVSASANAGEVL
AITGLEKFIALRVDGVTLRTEHIAGKPAPDSFLAAAQLLDVAPGAAAVFE
DALSGVAAGRAGGFGFVVGVDRVGQAEDLLRHGADVVVTDLEELLGEQAE
333991857YP_004524471.1 hypothetical protein JDM601_3217 [Mycobacterium sp. JDM601]MLPVPPLLAGVLPAGLPRGTVAVLSGARSLTLGMVAAVTAAGGNAAIVGQ
PDTGLLAAAEMGADLSRLAVIPDPGNDPVEVATVLMDGMDLVVLGLGGRC
VPPARTRVVLARARHRGCALLISGGDWQGAALRLDARVSGYELAGSAGRR
ARSGFGRIGAVRLEVRARQGAVGRTRAG
333991855YP_004524469.1 inosine-uridine nucleoside hydrolase IunH [Mycobacterium sp. JDM601MTLPVFADVDTGVDDAVALVYLLADSRARLVGLAATGGNVAVQQVCRNNL
ALLELCGASGIPVSRGAEAPLNGPVRTAEAIHGPQGLGYAELPPGSGRLT
GYDAAAAWAAAAREHPGQLVGLVTGPLTNLALALRAEPALPTLLRRLVIM
GGVFSGERADRAEFNIGFDPEAAAEVFSAWAAVAPQRLPLVCGLDLTQRI
AITPAILALLPAPTDSPVVRLLHDALRFYFEAHDARGHGYLAYLHDPLAA
AVALEPGLVTTRPAAIRVVLTPEAERGRTIPDWNARQPNALIGVGVDPAA
FFDRLVQRIGTLARRTPPSV
333991853YP_004524467.1 hypothetical protein JDM601_3213 [Mycobacterium sp. JDM601]MGKRIWNRTGTVFAMLAAALAAVLVLGGCSGTPHTRTITLTLIRHGESEA
NAAGIIDTTVPGPGLTEKGRAQAQEIVDQLSRNHYDGVYASSMARSQQTA
APLARELGRQVQILPGLREIDAGWFADKQNTVVNATYLLAPQAWIHGDRT
AAIPGSIDGNQFNDEFSAAVQRIYDSGDANPVAFSHSASIMAWTLMNVRN
PRDELMTDHPLPNIGRVVIKGSPSTGWKLVDWDGIRAF
333991851YP_004524465.1 hypothetical protein JDM601_3211 [Mycobacterium sp. JDM601]MDAYTAAENAQPGSEYLEFPELDDRDFQKLAHARVGKLTKMFMPSNHPPV
LELMVSIWVDGLATGLRMAGEDA
333991849YP_004524463.1 trehalose-6-phosphate phosphatase OtsB2 [Mycobacterium sp. JDM601]MPITIDPRRHDAVLFCLDADTEALTKALIRRLQQAGLRTQPVASSAQLVA
AAAGLGVRPGRSVVLTDSDADVTAARSAGFALVVGVGTDGGDAVVAEPGQ
IEVRTGDRPMSALADAMTAPELSELTDPAVFFDFDGTLSDIVEDPDAARP
VAGAVQALAALAARCPVAVLSGRDLDDVRARMGLAGIWYAGSHGFELTGP
DGAHHQNDAAADAVPVLAGAAASLREQIGPIPGVVVEHKRFAVAVHYRNA
ARDRVGEVMAAVRDAGRRLGLRVTTGREVIELRPEIDWDKGRTLHWILER
LGTVTPLFLGDDITDEDAFDAVADLAGAGILVRHSDDGDRATAARFALDS
PARVVEFTARLAGRLGAG
333991847YP_004524461.1 transporter [Mycobacterium sp. JDM601]MSKHISDDTPTETLPAAQPPHRGAIATWIRRLAVPVILIWVAITVVVNVI
VPQLDEVGAMRAVSMAPKDAPSMISMMRIGKTFDEFKSDSSAMVVLEGDQ
PLGDEAHKYYDELVAKMAADTEHVEHIQDFWSDPLTAAGSQSPDGKAAYV
QVYLAGNMGETLANDSVKAVQKIIADTPAPPGVHAYVTGGAALNADQHIA
GDKSLKVITALTFAVIIVMLLNFYRSIGTVLLVLGMVVFELSAARGIVAV
LGFYNIIGLSTFAVNLLVTLAIAASTDYAIFLLGRYQEARALGEDKESAF
HTMYHGTAHVILGSGLTIAGATFCLSFTRLPYFKSLGVPLAIGMVVVTFA
ALTFGAAVVAVASRFGMLEPKRAMRIRAWRRLGAMIVRWPGPVLVATTGV
CLVGLLTLPGYETNYNDREYMPDYVPANIGYAAADRHFSQARMNPELLMI
EADHDLRNPADFLVINRIAKRVFEVPGVGRVQTITRPLGTPIEHTTIPFA
ISMQGTTQQLNMKYQLDSMRNMLKMGEDMQVSVDSMKAMLEVTREMSVTT
DAMAQKMHIMLGDIQKLRDEMADFDDMWRPMRSYFYWEPHCFDIPICWSI
RSIFDMMDGIDAMTEDFELVLPDIDNLARLMPKMLEIMPPMIETMENMRT
TQLKMQSTMEGLQLQMEKMMEGQNAMGKAFDDSKNDDSFYLPPEAFDNPD
FKRGMKMFLSPDGHAVRFIISHEGDPMSPEGVSHIVPIKNAVHEALKGTP
LEGSRVYLGGTAAMFKDMKDGSAWDLMIAGIASLCLIFIIMLLITRAIVA
SAVIVGTVLLSLGTSFGISVLVWQHIIGLHLHWMVLAMSVIILLAVGSDY
NLLLVSRMKEEMHGGLKTGIIRAMGGSGSVVTSAGLVFAFTMMSMLVSDL
RVIGQVGSTIGLGLIIDTLVIRSFMTPSIAALLGRWFWWPQRVWTRPSPI
AQQVAPTPVSVGRD
333991845YP_004524459.1 DNA polymerase III subunit alpha [Mycobacterium sp. JDM601]MGWGSGPPSWAEMERVLDGKPRHTRGVSADREPTEPRPERPPPRGPTVPY
AELHAHSAYSFLDGASTPQELVVEAARLGLRAIALTDHNGLYGVVRFAEA
AAELAAAGQEIATVYGAELSLGPGARTDDPDPPGPHLLVLARGPEGYRRL
SRQIAAAHLAGEKDRPRFDLDVLTEAADGHWHILTGCRKGHVRQALAAGG
PDAAATALADLVDRFGAARVSVELTRHGDPYDDEHNAALAALAPRFGVSV
VATTAAHFAGPSRARLAMAMGAIRARQSLDAAAGRLAPLGGSHLRSGAEM
ARLFAAHPSAVPAAAELGERCAFPLALIAPRLPPFAVPDGHTEDSWLRRL
ALAGAEQRYGPPSGAPRAYAQIERELEVIAQLGFPGYFLVVHDITRFCRD
SDILCQGRGSAANSAVCYALGVTAVDPVANELLFERFLSPARDGPPDIDI
DIESDRREEVIQYVYDKYGRDHAAQVANVITYRGRSAVRDMARALGYSPG
QQDAWSKQLGRWGSLHRAEDADIQGIPGPVIDLATQIADLPRHLGIHSGG
MVICDRPIADVCPVEWARMPGRSVLQWDKDDCAAIGLVKFDLLGLGMLSA
LHYAIDLVAEHKGIEVDLAAIDLSEPAVYEMLARADSVGVFQVESRAQMA
TLPRLRPRVFYDLVVQVALIRPGPIQGGSVHPYIRRRNGVDPVTYEHPCM
ERALRKTLGIPLFQEQLMTLAVDCAGFTAGEADQLRRAMGSKRSPERMRR
LRDRFYDGMAQCHGITGAVAMRIYEKLEAFANYGFPESHAMSFASLVFYS
SWFKLHHPAAFCAALLRAQPMGFYSPQSLVADARRHGVVVHGPDVNASLA
HATLEEAGLQVRLGLGAVRGIGVDLAERLVADRAAHGPFASMLDLTARVQ
LSTPQAEALATAGAFGGFGMSRREALWAAGSAAGQRPDRLPGVGVSGCDG
HTPELPGMSEIELSAADVWATGVSPDSFPTQFLRADLDAIGVIPATRLAG
VPDGTRVLVAGAVTHRQRPSTARGVTFVNLEDETGMVNVLCTPGVWTRHR
RLAQTATALLIRGRVQNASGAITVLAERLGALELAVGSRSRDFR
333991843YP_004524457.1 nitroreductase [Mycobacterium sp. JDM601]MNLNLSADEVLTTTRSVRKRLDLDKPVPREVLMECLEIALQAPTGSNAQG
WQWMFVTDPVRKQAIADIYRANALPYLDRMKPDYGEGDVRGERMEFVSDS
ARYLMENMQDVPVLMIPCLEGRVENAPLGLSASFWASLFPAAWSYCLALR
NRGLGSCWTTLHLLEDGEKQAADVLGIPHDKYSQGGLFPIAYTKGTDFKP
AKRLPAEQVAHWDTW
333991841YP_004524455.1 hypothetical protein JDM601_3201 [Mycobacterium sp. JDM601]MDNRGMTRLSRIVLAVVAAAGAGLLGLTAPARAEPGYGQDCILPGVNECR
LMPEGNRPHDVQRWCPGGQGWVNVFTPCRDYYGPYS
333991839YP_004524453.1 hypothetical protein JDM601_3199 [Mycobacterium sp. JDM601]MTFPSDHSDQRRAPEGSLDWLVTNFARDVPGVSHAVLVSVDGLTVAASEH
LPKERADQLAAVASGLASLATGAAQLFEGGRVLQSVVEMEHGYLLLMRVG
DGSHLATLASASCDIGQVGYEMAVLVERVGAVVQSARRSAAPSPGGRS
333991837YP_004524451.1 GTP/ATP-binding protein [Mycobacterium sp. JDM601]MAYERSASPIRPRESASTKIVIAGGFGVGKTTFVGTVSEIMPLRTEALVT
DASAAVDTLDATPEKRTTTVAMDFGRITLADDLVLYLFGTPGQRRFWFMW
DDLVRGAIGAIILADCRRLQDSFAAVDFFEHRNLPFLIAINEFDGAPRYP
VAAVRKALALPDHIPVITVDARDQRSARDALIAISEYALSALAPAQG
333991835YP_004524449.1 oxidoreductase [Mycobacterium sp. JDM601]MPAAPDVFSPAKLGPITLRNRVIKAATFENRTPDALVSDDLITYHRLPAA
GGVGMTTVAYCAVSRGGRTSDDGLWMRPEALPGLRRLTEAVHAEGAAVSA
QIGHAGPVADARSNKARALAPVRFFNPIGMRFAKKATRDDIDAVIAQHAD
AARCAVDAGFDAVEIHLGHNYLASSFLSPLINRRSDEFGGSLGNRAKVAR
GIVQAVRQAVEKDGAGQIAVTAKLNMSDGVRGGISLDESLTTAKWLQDDG
GLDALELTAGSSLVNPMYLFRGHAPVKEFANVFPPPLRWGMRMTGNKFLR
EYPYHDAYLLDDARLFRAELSLPLILLGGITNRETMDQAMAEGFEFVAMA
RALLAEPDLVNRIAAEPATVSECIHCNQCMPTIYERTHCVVTGAPDVLR
333991833YP_004524447.1 hypothetical protein JDM601_3192 [Mycobacterium sp. JDM601]MTRADVRRLVAAQWPIMLVGLIFVAAFVLAGANFWRRGALLIGIGTAVAA
ALRLVLSEERAGLLVLRDRGLDFATMTTAATAMVYIAATVDPLGTS
333991831YP_004524445.1 methyltransferase [Mycobacterium sp. JDM601]MNRSRQPRHDRSLSFGSQAAAYERGRPSYPPEAIDWLLPPDAADVLDLGA
GTGKLTTRLVERGLNVVAVDPIAEMLEVLQTSLPQTPALLGTAEQIPLPD
DSVDAVLVAQAWHWFDPARAIPELIRVLRPGGRLGLVWNTRDERLGWVKE
LGEIIGREDARDAVDGGVTLPAPFGAIEHHQLEWTNYLTPQALIDLVASR
SYCITSPDAVRTKTLDQVRHLLATHPALVGSTGLALPYITVCVRATLDPS
333991829YP_004524443.1 O-acetylhomoserine sulfhydrylase MetC [Mycobacterium sp. JDM601]MTAGNNWSFETKQIHVGHAGDPETGSRALPIYQTTSYLFSDTDEAAARFA
LAEPGNIYTRLTNPTNAVIEERIAALEGGVGATLLSAGQAASTFAIFNLA
GTGDHIVASPRLYGGTYNLFRYSLPKLGIEVSFVEDPDNLESWTAAVQPN
TKAFYAESISNPKIDILDTPGVSAVAHEHGVPLIVDNTIATPYLIQPISQ
GADIVVHSATKYLGGHGTAIAGVIVDGGNFDWTQGRHPGFTTPDPSYNGL
VYADLGPPAYAIKIRAQLMRDYGSVASPFNAFLIAQGLETLSLRVERHVA
NAQRVAEFLAARDDVLSVNYAGLPSSPWYERAQQLAPKGVGGVLSFEVAG
GVEAGKAFVNALQLHSHVANIGDVRSLVIHPASTTHSQLSGDELLSTGVT
PGLVRLAVGIEGIEDILADLELGFAAVAAQLGESSALAAR
333991827YP_004524441.1 isocitrate dehydrogenase [Mycobacterium sp. JDM601]MCADQPTIIYTLTDEAPLLATYSFLPIVQAFTEPAGIDVKSSDISLAARI
LAEFPDVLTEEQRVPNNLAELGRLTELPDTTIIKLPNISASVPQLVAAIK
ELQGKGFALPDYPADPKTDAERQTHDRYAKCLGSAVNPVLRQGNSDRRAP
KAVKEYARKHPHSMGEWSQASRTHVATMRHGDFYHGEKSMTLDRARDVKM
ELKTKGGKTIVLKEKVALSDGMIIDSMFMSVRALREFYEQEMEDARKTGV
MFSLHVKATMMKVSHPIVFGHAIKVFYKDAFAKHQKLFDDLGVNVNNGLV
DLYDKIETLPASQREEIIEDMHACHEQGPELAMVDSANGITNFHSPSDVI
VDASMPAMIRAGGKMYGADGRTKDTKAVNPESTFARIYQELINFCKTHGQ
FDPATMGTVPNVGLMAQKAEEYGSHDKTFEVPEAGIADIVDLDTGEVLLT
QNVEAGDIWRLCTVTDAAIRDWVKLAVERARISGMTVVFWLDTERPHEAE
LRKKVKAYLADHDTEGLEIQIMPQVWAMRYTLERLIRGQDTIAATGNILR
DYLTDLFPILELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALGASFDDMGAKTGNRGAKILGQTLDTAIGRLLADNKSP
SRKTGELDNRGSQFFLAKYWAQELAAQTEDAALAEHFAAVANGLEKNQDV
ILDELTVVQGKAVDIGGYYAPDHDLTAAVMRPSPTLNAVIAGKD
333991825YP_004524439.1 PPE family protein [Mycobacterium sp. JDM601]MAVEYAEIADELTALLGAVQAGAWQGPAAEAFVAANAPYLAWLVRAGADA
TAAAAQQQTAAAAYSGALAAMPTMAELVANHVTHAVLVGTNFFGVNTIPI
ALNEADYARMWLQAATVMTAYEATATAAVAASPQTEPAPPVLKAAGSADA
TAPEPPQWFLDFAKWLEGLVPSPPYPDSSQYPLYAQLTEFFDKIGFTGIS
GPLADFFTSLQSGSSLLPPWGVPGSWLGWTGNPLSYFNPANLAYIFSVPL
DPGSYFAFTTIVIVDDLLAIMYTALFNPQGLGLVVPLAMVEIVGATIGNT
IQALNYLITQTALIPALLPALAATSVLAPAGVLGGLGIGGLAHHFAAAAA
VPPPPAPPPGLAMAQPPAPAPAPAPAPAPTPAPAPAPAAAPTPPPGAPPP
TPAGPPSVTMPAYMYMVGGLDMGARRASGTSARKKPVPKPDSVDVPAAEA
AEQTAPRRRRRKSTADMLGRGHEYMDLEPEPALVAASDRGAAQGFAGGLH
RVAGARPAGLTALADDGFGGGAVSPMMPNTWPADET
333991823YP_004524437.1 ABC transporter [Mycobacterium sp. JDM601]MSPAVQLDDLAIGYRSRRRSTTVANGLSAQARRGELTVLIGPNGAGKSTL
IRTLAGLQPALGGRVLLDGADLTGLPRDELARRVAVVLTERIDPGLLSAR
ALVGLGRIPHLGLGSRLRPADEEIVDWALAATGAQHLASRPAVELSDGEC
QRVLTARALAQQPGLLILDEPTAFLDVSSRAGLFGLLRKLARDQQLAVVL
STHDLELALRVADRVWLLDPAGTLVDTVGEELMLSGRIGAMFDTDTLRFD
PGSGMFAFGTEGGERRSARIDAGEPLRTALLRVLSREGWDSAEPGENCEL
LVTATDPGAVTLRCATSTTHTAMRDLPQRLRTLPTGPHRCAPADRVVSAL
AELADVSPYFAVSTGPVEGGGWRPVTQLYTDEDLLADAVGTVRDRIGASD
FRVAASTFFLGFAARLWSIGLGAIAEHGLLLDLDPGELWYSESGGTVRLH
LANPVAWQGPDPASRLADIVLSRHLTPLAAAVRRLGSISEKLLYGNAASA
ALGAARALHRHHGAQLAAEPCWELARTVCDDERLTDTIRFNDSGTDYRRA
TCCLFYRTPGGGLCIDCALTHKPEIRTPDKKGFT
333991821YP_004524435.1 periplasmic binding protein [Mycobacterium sp. JDM601]MLATALALALAGCSAEHAPRTADGRQDCITDFDPHTDYFPDKSTLSDAAN
FAIEYHRSYQILTVHRPYLGGKPVSYVLVRCGAPAPALSGELAAAQRITV
PVRRLYSGSTTHLAMITELGEADVVAGVASPAAVADPQIRERIDAGETVG
YAPGGLVNIESVLHAGPDVLVTQGMDDAGYPKLREAGLPVVADAEWLEPT
PLGRAEWIKMFAALTGAERRAGQVYQGIRDRYRALAAQASGAAPTKVLVG
TMYSGHWSMPTGASYSGRLVADAGGSYPWLADDGAESRQLNFESVYTRAA
DAPLWLVTDDWATVDDAVARDSRYGELAAVRTGQVWSATKAIGPGGGNLY
WERGTARPDLLLGDLVAILHPELGSGHDFEFYRQVPR
333991819YP_004524433.1 precorrin 6A synthase [Mycobacterium sp. JDM601]MALQVWILGVGMGPQHVTAEAAEVLRSVDYVLAAAKGSEDGLLALRRAIV
DAYAPAVPIVTVADPPRDRSPELTGPGYTRAVADWHAARAARYAEVLRER
GGTAAFLVWGDPSLYDSTIRIMERMKSLGVELDFQVLPGISAPQLLAARH
RIVLHEVGRPVHITTGRRLSEAVGAGQDNIVAMLNPDGLDLSALADWTIW
WGANLGAAGERLMHGRVGDVAGQIADARRAARAEAGWVMDIFLVRRP
333991817YP_004524431.1 precorrin-6x reductase [Mycobacterium sp. JDM601]MTHVLLLGGTAEARALADRLVAAGVDVTTSLAGRVANPRLPAGAVRIGGF
GGIDGLRAALADYDAVVDATHPFATTMSRNAAAACSAAGRPLLRLERPGW
AERARPSWRWVDSHEQAAAVAARLSRRPVLTIGRQQLASYLPALADAAVL
ARVVDPPSITLPPSWTVVTDRGPYALPGELALLCDHRADSVVTKDSGGEY
TWPKMLAAEELGLPVVIVRRPDRPAGVRCVYDVEQALAWVLTGH
333991815YP_004524429.1 hypothetical protein JDM601_3175 [Mycobacterium sp. JDM601]MEHGVLPIRPGREAEFEAAFATARPLIAAQPGFQGISMSRSIESPNLYLL
LVQWDSVEAHTEGFRKSPEFAQWRALLHEFYESPPEIEHFAAIG
333991813YP_004524427.1 hypothetical protein JDM601_3173 [Mycobacterium sp. JDM601]MLRPGGSPNAAGAAITLALCGSWDHPPPCPLAPHHTANHVAGEDVTLRIL
FAADTADEPRVRRLIGEALAAEELTGPDGRVTRWRLKSAAAGRLRTSEHD
HAADLIAHH
333991811YP_004524425.1 GNAT family acetyltransferase [Mycobacterium sp. JDM601]MSIPVEFSTASARVDRDWLWHELTEHTYWAKYRTRAMFDHQLDQAWRLVG
AYRADDGAMVGFCRAFSDGAAMAYLADVYVAAAERGRGIGRGLLRVMIDD
GPGRDFRWMLHTNDAHSLYATFDFAAPDATFMERRPRLPHVRD
333991809YP_004524423.1 cobyrinic acid aC-diamide synthase CobB [Mycobacterium sp. JDM601]MAAPASGHGKTTVAVGVMAALAARGLHVSGHKVGPDYIDPGYHALATGRP
ARNLDPVLVGAERIVPLLLHGAAGADIAVIEGVMGLFDGRLGGDGEASTA
HVAALTTAPVLLVVDISHASRTHAAVVAGLAGFDPQVRVAGVILNRAGSA
RHADEVVAALRPSGIPVLGVLPRDAGVATPSRHLGLVPASERDESAAMPA
RLAGLIEQHVDLDAVAQIARLAPDLTGTAWNPAAEVRAGSAGRPVVAVAG
GRAFTFGYTETFELLRAAGCEVVCFDPLTDSCLPARTAGIYLGGGFPEVY
AGPLAANTALLAALRAAMAAGVPTVAECGGLAYLCRSVDEVAGVGAVPGA
AAMTPRLSLGYRIATAPADNLLARAGETINGHEFHRTGVVFSRPVEPAWQ
LPDGPDGIAGQSLHASYLHTHWAGHPRLAQRFADAVHGFGGTDPKDLHHH
GDTETGSGLLDFAVNVYAGPRPDWLDDALHAALDDAVAYPEASAARAALA
ARHGRRTDEVLPTAGASEAFDLVARLRRWRHPVMVHPQYTGPHAALIAAG
HTVHTVLCRAEDDFALHPEEVPTEADLVVVGNPTNPTGVLHPASALRRLL
RPGRVVLVDEAFLDALPGEPESLAGEELPGLLVSRSLTKHWSIPGIRAGY
LVGDALLIADAARLQIPWSVSAPALAAMLSCSDERALTESSCRARQLELW
REVLTAGLTARAVAFVAGVAPYVLARVGRGVHAALRDNGIAVRRADTFPG
LDDSWVRIAVRPPELTERLLTALDQVLG
333991807YP_004524421.1 magnesium chelatase [Mycobacterium sp. JDM601]MQQLYPFPAVLGGDPDAPGGLDDMALALVLSAISPGIGGVLIRGEKGTAK
STLVRALAQVLPAIDVVAGDRFSSDPAEPNPLSPDGPFPADAAVQTRPVR
LVELPVGATEDRVVGSIHLERALGSGAVEFEPGLLARANRGILYVDEVNL
LADHLVDLLLDAAAMGRLTVERDGVSVSHAARFVIVGTMNPEEGELRPQL
LDRFGLTVEVSAPRDPALRAEAVRRRLAFDADPEAFARDYADAEERLRAR
IRNAQELLPRVELTDAALVRIGEICAAFDVDGLRGDIVCARTAVAHAAWQ
GRDAVNIEDLRVAARLALPHRRRRKPFDAPGLDETELDELLPPQDSGPEP
DPDPDGPEPDGPPDGGNAAQPEQRGPAPAKTGATSTVGADSPYRARLFTV
DGVGSGRAGRRSRARTSSGRRVGATAVGAAGGLHLFETLRAAAPHQGARG
RVDGPMLLQAADLRRAVREGREANLVLFVVDTSGSMAAAERMRHVKTAIL
SLLLDAYRRRDRVAVVTFRDTGAQVALPATGSVEIAAVRLDELPAGGRTP
LAEGLLEAGEVIRRERLRDPASRPLLVVLTDGRATAGADPVERSRQAALQ
LAEHGFSAVVVDCESGRMRLGLARTLAEQLRADYVPLPQVSAEALSGIVR
DVTGKGAA
333991805YP_004524419.1 precorrin-4 C11-methyltransferase [Mycobacterium sp. JDM601]MGALAVQFVGAGPGAADLLTVRAARLLADADVVLYPGSYLDPKVLGHCCA
TAELVDTAGLDLDEIVGRLATAHRAGRRVVRLVSGDPSLYSAVFEQTRRL
DAAGVPWQVTPGVPAYAAAAAVLGRELTVPLVTQSVVLTRVQAASTAMPP
RESLAAFAATGATLVLHLAITRIRELMGRLASDYGADCPVAVVYRASQPE
EVVLRGTVADIADAVEAAGLRSAAVILVGRAVADRPDPCGGESHLYDPAR
DRGL
333991803YP_004524417.1 precorrin-8x methylmutase CobH [Mycobacterium sp. JDM601]MTRPASRPTKRYSYLEDGPAIYVESFATIRRESDLSHIPASAERLAVRMI
HGAGQTDVAADLLIHPDAVPAGRAALDAGAPIFCDARMVAVGVTAGRLPA
RNEVRCHLHDERVPALAAEWGTTRSAAAVSLWEPELAGAVVAIGNAPTAL
FHLLELILDGGPRPAVIVGCPVGFIGAAESKAALAALHAEHGIDIPFVTL
RGRRGGSAITSSALNALASDDE
333991801YP_004524415.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MKLTYDDKIAVLDLGDDENRFSPDFLDEVERMLDDAVSSGAHGLVTTAGG
KFYSNGLDLDWLAAHSDRGDWYVGRVQALLAKVLTLPIPTAAAVVGHAFG
AGAMLAIAHDFRVMRADRGFFCFPEVDIRIPFTPGMAALIQAKLTPQAQV
ASMTTGRRFGGVDAAAVGIVDGTAGEGAVTPAAVELLRPLAGKDPGTLGA
IKAGMFGPAVAALTAE
333991799YP_004524413.1 tryptophanyl-tRNA synthetase [Mycobacterium sp. JDM601]MSTSATRPVVFSGVQPTSASLHLGNALGAITHWAELQDDHDALFCVVDMH
AITVPGWDPETLRRSTLVTAAQYLALGIDPARSAIFVQSHVPAHAELAWV
LGCFTGFGQASRMTQFKDKSAKQGSDSTTVGLFTYPVLMAADVLLYDTDV
VPVGEDQRQHLELARDLAQRFNARFPDTFVVPEPMIPKATAKIYDLADPT
AKMSKSAATDAGLISLLDDPAKSAKKIRSAVTDSEREIRYDPDAKPGVSN
LLTIQSAITGASVEKLVEGYAGRGYGDLKKETAEAVAEFVTPIKARVDEL
LADPAELHAVLAAGAERARTLAAGTIARVYDRVGFLPPPV
333991797YP_004524411.1 hypothetical protein JDM601_3157 [Mycobacterium sp. JDM601]MWTQIVGKVRLAHAPLVNHWWQVTLYVTARGLTTSAIPYGNDVFDIEFDF
IDHRLAIRSGNGAAGTIALREQSVARFHAEFLSALDELGLQTRIQSHPNE
VEPAVPFAEDVEHASYDAEAAQRFWRQLVQAHRVLNRFRSRFIGKSSPVH
FFWGAMDLACTRFSGRTAPTHPGGAPNCGDWVMVEGYSHELSSCGFWPGG
GEEGGFYAYAYPEPDGFADHPVRPADAYYSTQLGEFVLPYEVVRQAPDPD
AVLLDFLQDTYEAAAVRGDWDRGALEDDPDRWRSTRPPR
333991795YP_004524409.1 N-acetylglucosamine-6-phosphate deacetylase [Mycobacterium sp. JDM6MTLISAGAVVLDGRVCRPGWLSVADGRIAECGTGPVRADVEFADCVVVPG
FIDMHCHGGGGVGYPDGPDRAAALHAAHGTTGGLASLVSAAPAVLLDQVR
ALADATRRGVVDGIHLEGPWLSGHHCGAHDPAWLRAPDDAELAALLAAGD
GAIRMVTLAPELPGGAATIRRLVDAGIVVALGHTDADYDQAQAGIDAGAT
VGTHLFNAMRALHHREPGPVPALLADPRVTVELIADGVHLHPALIRHVVA
TAGPDRVALVTDAMAAAGAGDGVFTLGGLDVEVADGVARLHGTTTIAGST
ATMDRLFATAVNLLGGHDAALAAAVRMTATTPARALGLDGAGVLAVGSAA
NLVVMDADLQLVRVMRRGMWLR
333991793YP_004524407.1 hypothetical protein JDM601_3153 [Mycobacterium sp. JDM601]MKALRAFGWFSGLLLIAIGLSRMALSLDSIPDGQDVNATVDSESRAAGAL
LIGFGIGYIEAFRRARIPAGAVRLLALTMALLGVSRLISMADVGMPHPSF
TVACVVEFVAAGLTYWYATLADRGVR
333991791YP_004524405.1 strictosidine [Mycobacterium sp. JDM601]MSPKPRISPVRWRPPPSRPLPPPDPTPPLRVVEIPGTAAEDVVVDADGAI
WTGVEDGRIIAVGPGAAPPRVMTDTGGRPLGLAFTRDHRLLICDSHRGLL
RFDPKSGQLETLVSHVAGRPLTFCSNAVEASDGTIYFTESTDRFRYEYYK
ASVIEARASGSLLRRTPDGATTVLASGLHFANGVTLTADESAVVFAESTG
CRLSKYWLTGPRAGSITGLVSELPGHPDNISTGRDGRIWVAMVSDRNALS
EWLSPRAPVLRTLLWRLLPYRWLPDTKAGAWVIGFDADDGRVLSQFRSTD
PAFGLATGVVEAGDRLWLGRINGPGLAYFQL
333991789YP_004524403.1 RNA polymerase sigma factor SigJ [Mycobacterium sp. JDM601]MDDFEALRPHLLAVAYRLTGMFADAEDIVQDAWLRFDAAERDEIVDLRAW
LTTVVSRLGLDRLRSAPRRRETYVGEWLPEPVVTGVDEPLSAVVAGEDAR
FAAMVVLERLTPDQRVAFVLHDGFAVPFGEVAAVLHTSEAAARQLASRAR
RAVAADPPPEPDPRHAETVGTLMAAMAAGDLDAVVALLHPEVTFTGDANR
RAPTAVRTIHGPEKVARFLFGLARRYGPTLTTANQLALVNGELGAYTPGA
PAAEGFAELLPRVTAMTVRDGLVYAVWDIANPDKFSGSPLRGAASL
333991787YP_004524401.1 steroid dehydrogenase [Mycobacterium sp. JDM601]MHWYTGNSGYDTVLTFAFGFAAFVIIGGFFGQSSYGRFSSAKLGFNLNPK
FGWWLMEIPATVVFLVAYLCGPARFEPTSLVLAGIWALHYANRGWFFPLA
IRQVPGKRSTFNISVVVMGMLVTTMHGYLNGALFSHDYLGQYSRSWLTDP
RFVVGLVIYLCGFALLVSSESIVRNLRDKNNPGAAEYRIPFGGGFRFVTS
PAYLGEIIAWTGFAILTWALPGVVILLITAGNLIPRALQTHRWYREKFAD
YPTDRKALVPFLL
333991785YP_004524399.1 succinate dehydrogenase (flavoprotein subunit) SdhA [Mycobacterium MIVGAGGAGMRAAVEAAPRARTAVLTKLYPTRSHTGAAQGGMCAALANVE
DDNWEWHAFDTVKGGDYLADQDAVEIMAKEAIDAVLDLENMGMPFSRTPE
GRIDQRRFGGHTRDHGKAPVRRSCYAADRTGHMILQTLYQNCVKHNVEFF
NEFYVLDLTLTETPSGPVATGVVAYELATGAIHVFHAKAIVLATGGSGRM
YKTTSNAHTLTGDGMGVVFRKGLPLEDMEFHQFHPTGLAGLGILISEAVR
GEGGRLLNADGERFMERYAPTIVDLAPRDIVARSMVLEVLEGRGAGPNKD
YVYIDVRHLGEDVLEEKLPDITEFARTYLGVDPVKELVPVYPTCHYVMGG
IPTTVTGQVLRDNTAVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGR
RAGIAAAEYANTHEFTELPENPADMVVNWVADILSEHGNERVADIRGALQ
QSMDNNAAVFRTEKTLKQALSDIHALKERYARITVHDKGKRFNSDLLEAI
ELGFLLELAEVTVVGALNRRESRGGHAREDYPNRDDVNFMRHTMAYKEGT
DLIADIRLDYKPVVQTRYEPKERKY
333991783YP_004524397.1 succinate dehydrogenase (cytochrome B-556 subunit) SdhC [MycobacterMWAFALHRITGATIFFFLFVHVLDTALVRVSPQAYTEVIATYKTPLVGLM
ELGLVAAVLFHGLNGVRLILIDFWWQGCRWQRQMLVAVGAVWLVVMVPVV
VRIGMHMAERFL
333991781YP_004524395.1 thymidine phosphorylase DeoA [Mycobacterium sp. JDM601]MNRSFDAPTLIAAKRDGHRLPDAAIDWLIDSYTAAEIAEEQMAALLMAIF
LRGMDAEETARWTAAMIASGERMDFRELRRDGRRVPTVDKHSTGGVGDKI
TLPLVAVVAACGAAVPQASGRGLGHTGGTLDKLESIAGFDPVLPTARLRE
QLAEVGAAIFAAGALAPADAKLYALRDITATVESLPLIASSVMSKKLAEG
TGALVLDVKVGSGAFMKSAGPARQLAELMIELGAAHGVPTRALLTDMNSP
LGATVGNALEVAEALDVLAGGGPEDVVALTLALATEMLELAGLDDREPAA
TLADGTAMDAFAAMVAAQGGDLSVALPVAACSETVTAPRDGTMGEIDAMA
VGMTAWRLGAGRSRPGERVQAGAGVRIHRRPGEPVSAGEALFTLYTDAPE
RFGPAHAELDGGYRILSGPDAAPVPRPLIIGAAP
333991779YP_004524393.1 hypothetical protein JDM601_3139 [Mycobacterium sp. JDM601]MISSAVTTPAEESGAASSTEMTGADGKEYTVAGPILAKLDSLDAAAKQSL
GEPTGAEQKNPDGGVYQQFDGGVIVHTTRSYVVWGKIRDKWNELGGSQGK
LGYPTSDETTNADGTKQTTFEHGVVTWKDGDPEATVTEH
333991777YP_004524391.1 hypothetical protein JDM601_3137 [Mycobacterium sp. JDM601]MRSCSRHSGLPGRRVTPSVAVGPRLTTSHGSIRRNSA
333991775YP_004524389.1 PPE family protein [Mycobacterium sp. JDM601]MRHRRLLGAALLAAASVAAAGAGPQSRPDVLLLADEGWIMGPTSIPDPTV
GGYLEAVLDRFLQPVTPWFPGQPTFPGYRFEGLVTPEQFCPLVCLPPPNP
YLTFAESVARGVDILHDAVVPQLQAGDHVTVFGYSQSATIATQEMTNLLA
ASSGPPAGLDPDNLDFVLIGNPNNPLGGVLTRFPAYPLLSDQPVHLPFLG
IPLSIGPTPTSGFDIDSYTGEYDGLANFPQDPANLLAMLNALIGTATVHF
SYLEFDNLSDTIELGTIGDTDFYLIPQQLPILWPIYALGDVGKVIGDALA
PWLKLVIDWGYGNPGDPFVGVNGTDAVGPWAVTAGGQLAEGSGVAGFLLR
MDPLQMLAGVQYAAVRSVVDPVNGLLGFTGHDPLPDSLVDALLTGYRLTN
ELDAALLGAWQQLAVELDVADWLGPEAVFNGEPLLSLEPLLDMGAVVFEI
LNLLGA
333991773YP_004524387.1 phosphomannomutase PmmB [Mycobacterium sp. JDM601]MTPDEWIAHDPDPMTAAEVAGWDADETAARFAAPLRFGTAGLRGPVRGGP
DAMNLAVVLRASWAVATVLQAHRHAGATVVVGRDARHGSEAFATATAEVL
AAAGFSVVRLPDPLPTPVVAFAVRHTGAAAGIQITASHNPAGDNGYKVYF
DGGVQIVAPVDTEIETAMAAAPPADTIPRRPVPAAGDELVTRYLGRAATV
RRHRGPVRVALTPLHGVGGALAVDVLCAAGFTDIHTVTSQFDPDPDFPTV
AFPNPEEPGAADELLELAADVDADIAIALDPDADRCAVGIPGPAGWRMLT
GNETGWLLGDYLLSRLPRQRVSDAVVASTVVSSQLLARIAEHHGARHVET
LTGFKWLARADDGLPGATLIYAYEEAIGYCVDPDAVRDKDGITAAVLACD
LVAALRDQGSSVPAALDELARRHGVHVTEAVSRRVADLAEATAVMARLRA
DPPTVLAGFAVTATDLMHRRGPVTDALEFGGAREGTSVRVVVRPSGTEPK
LKCYLEVSRPPSDDVAGERAEASRLCAAVAAEVRGW
333991771YP_004524385.1 purine nucleoside phosphorylase DeoD [Mycobacterium sp. JDM601]MTVPLATQAAAVVARRTGVDSHDVAIVLGSGWAPAVAALGTPTATLPMAD
LPGFSAPTAAGHLGELVSIRIGTHQVLVLVGRIHAYEGHPLADVVRPVRT
AVAAGANTVVLTNAAGGLREQFEVGQPVLISDHLNMTGRSPLEGAHFVDM
VDAYTPALRALARQVDPTLVEGVYAGMSGPQYETPAEIRMLRTLGADLVG
MSTVHEAIAARAAGAQVLGLSLVTNLAAGITGESLSHAEVLAAGRESAGR
MGALLADVIARL
333991769YP_004524383.1 hypothetical protein JDM601_3130 [Mycobacterium sp. JDM601]MSQFGFEPTAGEDRQCLSGSHHPALAVEQGAQSVVHAADRRCLTAPTVTS
VVQIRANCGQRQNCAHSSTPVSVHSCTKFPACRRADMHARATGS
333991767YP_004524381.1 hypothetical protein JDM601_3127 [Mycobacterium sp. JDM601]MPLYAAYGSNMHPEQMLQRAPHSPMTGTGWIHGWRLTFAGEDIGWEGALA
TVVEDPGSSVFVVLYDVTHEDEQNLDRWEGSDFGIHKKIRCRVDRVDGIT
SDPVDSKPEPVLAWLYVVDAWEGGLPSARYLGVVAEAAQIAGAPEEYVRN
LQTRPARNIGPGS
333991765YP_004524379.1 glycerol-3-phosphate dehydrogenase [Mycobacterium sp. JDM601]MVVGGGVVGTGCALDAATRGLKVALVEARDFAAGTSSRSSKMFHGGLRYL
EQLEFGLVREALHERELSLTTLAPHLVKPLPFLYPLTNRWWERPYVAAGI
FLYDQLGGAKSVPAQRHLTRAGALRLCPGLKRSALIGGIRYFDTVVDDAR
HTLTVGRTAAHYGAVIRTSTQVVALLREGDRVTGVTVRDSENGATTEVRG
HVVVNATGVWTDEIQALSRQRGRFHVRASKGVHIVVPRDRIVSEAAIILR
TEKSVLFVIPWGTHWIIGTTDTDWNLDLAHPAATKADIDYLLANVNTALA
TPLSHADIEGVYAGLRPLLAGENDDTSKLSREHAVAVPAPGLVAIAGGKY
TTYRVMAADAIDAAAEFIPTRVAPTITEKVPLLGADGYFALVNQAEHVGA
EQDVHPYRVRHLLDRYGSLIHDVLALAEERPELLDPIAEAPTYLKVEVAY
AAAAEGALHLEDVLARRTRISIEYAHRGVNCAREVAEVMAAVLGWDDAAV
DAEVANYSARVEAEILSQEQPDDASADALRARAPEARTEILEPIPLP
333991763YP_004524377.1 hypothetical protein JDM601_3123 [Mycobacterium sp. JDM601]MQHDYVLTADPAPVITDFVGSLQYLLDQLGFGNIGQVLGLFGTEASPVGA
GSELSVLLANLNPDNVSLDTVTMGLLSTDLTALLNDVNLPVGDGATAPLG
DVPLIGLIGSFIGGTDGINTSVGDLLTALGFGPYVGLLNLAFLGIDVTPD
TSVADLLNDMLGIDGSTTINTLLDDNGFGEATIASLMGISSEQLGAGWDD
FLDSIKLGTSIMDPTGDGTLGAQTLGDLLTSLLGPDATDVTDATTLTDFL
GDLGIWDMLGLT
333991761YP_004524375.1 integrase catalytic subunit [Mycobacterium sp. JDM601]MGLTLPKRKAVTETIAVRYILASKREKSRILDELCATTGWHRNHARKALK
SALQPKIVTARSPRPVKYGDDVIAALVLCWTVLGMPAGKRLAPMLGELVG
ILRHFRELTIDEGTAELLVSMSAATIDRRLAPERAKHRLRGRAGTKPGSL
LKSQIPVRTWAEWDDARPGFVEIDLVWHDGGIRGGGHAFTLTVTDIATGW
TENRSVPERTSKCVLAALNDIARAMPFPVLGVDSDNGSEFINDDLFRWCQ
RHKITFTRARPGNKNDGCHVEQKNWSVVRSMVGYHRYDTAAEVLLLNEIW
HLQSKLTNYFYPQQKLISKVRKGAKISKKHDKATTPFHRVIDHPTATVER
IVALTRAYSLINPAATQRQAQALTTRLFSLTTTKAGPAAEAQINKRARLR
EATNTPTRAS
333991759YP_004524373.1 hypothetical protein JDM601_3119 [Mycobacterium sp. JDM601]MAVAPGAAAVRFLAGPPAAVVPAVAAARFPAARPVAVVPAVAAVRFRAVR
PVAVVPAVAAARFRVARPAGAAPAVVAAACPVWGAAAGRDRPAL
333991757YP_004524371.1 hypothetical protein JDM601_3117 [Mycobacterium sp. JDM601]MLQATTHETAFRQMLEDVASMDDLNASWLSVATKLLTFVATIGTNEADWQ
ALPIGEPLDSIGTVQAQAGNALFPRERETLSAEDDYLLSFASRSQREALR
AFAIAQVAEVSIPSGSLRLAIIARGIADAIDAVAGETFISWYRNIGELHV
TTGSAYPVHRHDPRRWLGGHPPNTQPSRLPTRDLAATTYLRIASNAVRPY
NYVLDFDYWFRLNLLGEPNGLIAAVGQPNKDLDEFNIEIHPGPPRSYANH
GPKNGSEQVEILGALSSEAGQAGAHLLVMPEYALPESSLQRFIHTLNLLE
KRPTLVVSGISAGTDDVGLVVNEAIMVIHTSGMQDRIVTLPRKLAPAREG
ELYEHIATGSEVRVFWSDRWAVTVLICFDAMNDSVIDQLALFGTNLLLVP
ALSAKSATMLDATSAICHRTQGFVVTATGPLRWRSTNPELSINGDPALRC
HAAFAGPYGVSPTTVPLSADIGADTLTDLWIFAFADRSHRGSNVNI
333991755YP_004524369.1 ATP-dependent helicase Lhr [Mycobacterium sp. JDM601]MSRETPAALARFSALTRDWFTGTFAAPTEAQQQAWSAIADGHHTLVVAPT
GSGKTLAAFLWALDRLAAEPGPKAAGTRVLYVSPLKALAVDVERNLRTPL
AGIGRIAAHPDYAGLPAPAITVGVRSGDTSAARRRELVAHPPDILITTPE
SLFLMLTSAAREALTGVQTVIVDEVHAVAGTKRGSHLALSLERLDAMLAS
PAQRIGLSATVRPAEEVARFLSGQAPTTIVAPPAAKTFELTVQVPVPDMA
SPAEGTIWPQVEERIVDLIEAHRSSIVFANSRRLAERLTARLNEIHAERC
PDDAAPVGIASAAEPGAAGRHSLAPLARAHHGSVSKETRAAVEEDLKSGR
LRAVVATSSLELGIDMGAVDLVIQIEAPPSVASGLQRIGRAGHQVGEVSA
GVLIPKHRTDLIGCAVSVQRMLAGQIETLTVPANPLDILAQHTVAAAALE
PLDAEAWFDTVRRAAPFATLPRSVFEATLDLLSGKYPSTEFAELRPRLVY
DRDTGTLTGRPGAQRLAVTSGGAIPDRGLFAVYLAGADKPSRVGELDEEM
VYESRPGDVISLGATSWRITEISHDRVLVVPAPGQPGRLPFWHGDGVGRP
AELGAALGEFTGELAGLDRAALDKRCAGLGFDDYAADNLWRLLDDQRTAT
STVPTDTTLVVERFRDELGDWRVVLHSPYGLRVHGPLALAVGRRLHERYG
IDEKPTASDDGIVVRLPDTDAGATLDAPGADLFVFDADEIEPIVTAEVGG
SALFASRFRECAARALLLPRRHPGRRTPLWQQRQRAAQLLDVARRYPAFP
IVLETVRECLQDVYDVPALTELMARIAQRRVRVVQVETATPSPFAASLLF
GYVGAFMYEGDSPLAERRAAALSLDPTLLAQLLGRVELRELLDPDVVAAV
AAELQHLTPEKAARDAEGVADLLRLLGPLTGDEIAARAGGSDVGGWLEHL
LAARRVLTVAFAGRAWWVAIEDIGRLRDGIGVAVPPGVPAGFTEPVTDPL
GELLGRFARTHGPFTTGQAAERFGLGARVAADALGRLAADGRVVRGEFAD
FPDSPGEQWCDAQVLRILRRRSLAALRSAIEPVSPAAYARFLPAWQQIGV
RGAASGLDGLAGVIEQLAGVPLPASAVEPLVLAARVRDYSPAMLDELLAS
GEVLWAGAGAPAGNAPAADGWVTFHTADSAPLTLAPGAPFDFGAAHRQIL
DTLGGGGAFFFRQLAGDTSEAELKTALWELIWAGWVTGDTFAPMRTVLAG
TRRSTPAHRSKRPPRLSRYSVAHAATRAADPAVAGRWSMLPATEPDPGFS
TVRAHHTAELLLHRYGVLTRGAVAAEAVPGGFAGLYKVLTAFEEAGRCQR
GYFIESLGAAQFALASTVDRLRGYLDGVDPARPEYHAVALAAADPANPYG
AALSWPAHPGTARPGRKAGALVVLVDGELVWFVERGGRSLLNFATGADAA
EVQRAAAGALAGLIADRRVDGILVERVDGAAVLETRDSPTTTALAEAGFS
RTPRGLRLR
333991753YP_004524367.1 hypothetical protein JDM601_3113 [Mycobacterium sp. JDM601]MALRKGDKAQSDVEAEAHRARPPTGKDEDGTHVGRVSPDDALDVGETGAE
ARSDDA
333991751YP_004524365.1 hypothetical protein JDM601_3111 [Mycobacterium sp. JDM601]MTDRPDIDPATDTTDDDTLPPSEATDSDELRNDDGDATVTPPDSWQPVDD
ATDESLDDRLAAERPDAGLERDPDEAGQAVTGGRHRAQVSGSPEDGDSFY
NVEE
333991749YP_004524363.1 CsbD family protein [Mycobacterium sp. JDM601]MSDQEKSGPEEGFRGAVEGVKGKAKEAVGTVTGNDELAREGKAQQDKGEA
QRDAAKREAEAESARAGAKAAESREQSHQ
333991747YP_004524361.1 hypothetical protein JDM601_3107 [Mycobacterium sp. JDM601]MGDTFHDPVDHVRTTRPHAGRAVIDVMGWPGYSLLVVGMVAGIGCLTAFA
TGHDRQGVAVAALAVFAAGLGALWLLMEHRRIGRVNQQWQLAHPELQRQH
STG
333991745YP_004524359.1 RNA polymerase sigma factor SigF [Mycobacterium sp. JDM601]MTRGAARSGSQSGSEYSDVGDMFRELAHYESGSTDFRNRKDKIVERCLPL
ADHIARRFEGRGELRDDLVQVARVGLVNAVTRFDVETGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGSATADLSQRLGRAPTATELARE
LEMSREEVVEGLVAGSSYNTLSIDSGGSSDEDDVRSIADTLGDIDAGMDR
IEDREALRPLLNALPERERTVLLLRFFESMTQTQIAERVGISQMHVSRLL
AKSLSKLRDQLE
333991743YP_004524357.1 pyridoxamine 5'-phosphate oxidase-like FMN-binding protein [MycobacMCIIDHDMRLIVASAKLAFVATVCEDGSPNLSPKESLLVYGDEHLAFMHM
ASPTTVADLRRDPRVEVNVVDFLRRRGYRFKGTAQLRPPGDEVYEWLRQW
VTETQGPQFPCREAVLVRVERALPIASPAYMFGGAHESELVRTWSEIYRL
R
333991741YP_004524355.1 hypothetical protein JDM601_3101 [Mycobacterium sp. JDM601]MTEPGDEDERGGVEPESKTSLESTVDRLDEKAAKEYGSEARARESPKRGS
PDEPPD
333991739YP_004524353.1 glycosyl hydrolase [Mycobacterium sp. JDM601]MDDGQSLLERFPPQVLRQYALIADGERGIVVGPRGDFCWMCLPRWDSPAV
FSSLLGGDGVYAVTPQRRYVWGGQYEERSLIWRSRWVTIDGIVECREALA
FPGDPHTAVVLRRITALDRPVRMQVALHVRADFGTTAMAGLSCCDGVWTG
RSGPHRFRWTGAGGAHRAADGSLRMVVDVAPGHDHDLVLELSERELPDRP
ADAAQAWHVTESSWRQAVPEFTGTLADVDVRQAYAVLRGLTSTGGGMVAA
ATMSLPERARAGRNFDYRYCWIRDQCYTGQAIAVAGAYPLLDDAVRFVSE
RVLADGPDLRPAYCVDAGAPPPEHDLDHLPGYPGAAARTGNRVGDQFQLD
TFGEILLLLAAAARLDRLDSTHWAAVHILVDAIENRCGEPDAGVWELGNR
RWAHSRLICAAGLRRIAGVASPAEGARWQRLAHKLVSDAGDDCLHRDGRW
QRAPGDPGIDAALLLPGLRGAVPADDARTLATLAAVRRELTRDGFVYRYR
PDRRGLGEAEGAFLLCNFAMALADHQQGNDLAALQWFERGRTACGPPGLL
TEEFDVGQRQLRGNLPQAFAHALLFESAHLLTGAGSSGLSAKA
333991737YP_004524351.1 cutinase [Mycobacterium sp. JDM601]MISRILAAACLCGCVLPCWPAGEAAAFGCPEVEVVFARGTAEPPGVGWMG
QQFIDALRWRLGGRSVGVHPVDFPAVPEFGPTVAGVADAAGHITDMAAGC
PDTALVLGGYSRGAALIGYLTEPAPAADGFPPPPGPEAADRVAAVALLGR
PSTEFLHSLGAPPLTVGPGYAAKTIELCAPGDPVCSAGADGAAHAAYATN
GMTALAADFAVQRIVPPEPVPDQPF
333991735YP_004524349.1 hypothetical protein JDM601_3095 [Mycobacterium sp. JDM601]MAQSTGAGNAIADAAKREADAYRGNDPRPLGGYALVLLVYGGLVAAVTVA
AAATGRRLPQRWAAGDLLTVTLGAHKLSRTLTKDAVTSPLRAPFAHYAGT
GGPAEVMEETRHSSQLRHSLGELLTCPFCLDMWAVTAFVAGLVFAPRFTR
LVAGTFTALAGADFLQLAYAKAQQIAQE
333991733YP_004524347.1 oxidoreductase [Mycobacterium sp. JDM601]MLDFPAWLRVEHWLNVLFLTLLIRSGIEILSTHPKLYRHDDSAPGTEWAR
FTRKVMPTDKLYDTLDEEEDYHPVIALPGHAQLGMGRHWHFFAVIGWILV
GLSYYILLFATGQWHRYWPYSWSIFADAWNDIVTYLSFNLPPLLPGEPLD
AIQKLTYAAVIFLLAPFQILTGAAQSPAIEARFPRYVRLFGGRQGARSLH
FLGLAAFGVFIVIHLTMLFCWGWGRLNALMIFGSVRNTYWATALSLLIVA
AIVAVHIAATLWSLRSPASVRRVLGVVIAVPRRGLLRRLDSRQDYPARMI
SAQHRVNGKPPTAENYKVMAVHNFVDWRLRVGGLVEQPATLDLAGLRALA
APQTQRVLHNCVQGWSSIGEWTGVPLGALVDLVRPLPQARYICFMTMQDN
STDEPSAHGGGQFYEVFDLKLAHKPQMLLAYAMNGRPLPIKHGAPLRLRA
ETQVGFKMAKWINQIEFVDDYAHIGKGRGGWREDNVYYSMDGEI
333991731YP_004524345.1 hypothetical protein JDM601_3091 [Mycobacterium sp. JDM601]MSSIERIRIDDDVAVLTEQVRALRELGQRAQVHDWHIYDLSIRWGTALAG
RLRRLAYYHDRGLLDDDAERRVAAVCDELRSVADLVERFDLARPDLPA
333991729YP_004524343.1 PfpI family intracellular protease [Mycobacterium sp. JDM601]MEQVELTEPWRAVAKAGASPVLVSTTTGPVQAFNHLDRADQFDADRVVDD
VSADDFDALVLPGGVANPDQLRTNHRAVAFVREFFDAGKPVAVICHGPWT
LVEAGVVAGRRLTSWPSLRTDIVNAGGQWVDEQLVRCDGGPSILLSSRKP
DDLPAFCDALVSELESRKVAL
333991727YP_004524341.1 hypothetical protein JDM601_3087 [Mycobacterium sp. JDM601]MAEMDHRRAPVLEALADYHRKDRYGFSPPGHRQGRGADQSVRDVLGDDLF
RADVLARGGLDDWQARGEVLTGAEQLMADAVGAEMAFFSTCGSSLSVRAA
MMAVAGGSSGGLLLPRDSHKSIVGGLIFSGIQPRWITPRWDAERHFSHPP
SPERVAGAWEEHPDAAGALIVSPSPYGTCADLAAIAEICHRRGKPLIVDE
AWGAHLPFHDGLPTWAMDAGADVCVVSVHKMGAGFEQGSVYHIQGDLIDR
ERLTACADLLMTTSPSVPIYAALDGWRRQMVQHGHEMLNAALALAREVRA
RIDELPDVEVLEDVLLGVEASHDLDRLQVLVDVAATGMSGYQARDWLREQ
RCLDVGLADHRRILATMSFADDRASADRLLDALSGWRAAAMTFDPPAPVR
LPSPEEMQLESVALPRDAFFGPTEMVAAAQAAGRIAAEQLTPYPPGVPAV
VPGERLDTAVIDYLRSGLAAGMALPDAADPSLEHIRVVA
333991725YP_004524339.1 hypothetical protein JDM601_3085 [Mycobacterium sp. JDM601]MIGLGLLLLIIGLVFDVYVLWAIGIVLLVIGVVFWVLGAVGRPVGGRRYW
Y
333991723YP_004524337.1 cutinase [Mycobacterium sp. JDM601]MFARGTGEPPGVGPTGQAFVNALSTRLDPHPLSVYAVDYPANDQWDTGVD
GIRDAGAHVVSRATTCPRTKMVLGGYSQGAAVMGFVTSAQVPDGVDPATV
PKPLDPDIAEHVAAVVLFAMPNERAMKFLKEPTIAIGPSYQAKTLQVCAP
EDAVCSEGLSFAAHDSYAGDDATMIEQGADFAAHRLQSRLG
333991721YP_004524335.1 hypothetical protein JDM601_3082 [Mycobacterium sp. JDM601]MNGELDAANAGELAEHVHHCATSCQWLVLDLSDLEFIGTAGFSALRDIVD
RCADTVTYCTTVPGPAVTRLLRICDPANALPTTSSVAEALAAVPGLRRVH
333991719YP_004524333.1 transferase [Mycobacterium sp. JDM601]MVSEHASPLAALGGADAGGQNVHVAELSAALARRGHDVEVYTRRDDPDLP
ERIDTEQGYTVVHVPAGPARYVPKDELLQYMGTFGRYLDQQWDRERPDIA
HAHFWMSGIATQLAAKRRRVPTVQTFHALGVVKQRHQGHRDTSPAERLRL
ETRVAQEATWVTAGCSDEVFELMRLGRDRLRISVVPCGVDVDRFTPHGPT
APRSGRRRIVAVGRFVPRKGFDTVIEALTTVPAAELVIVGGPERAELDTV
PEACRLRKLATDLGVAERVSLYGAVAREDMPALLRSADVVTCTPWYEPFG
IVPLEAMACGVPVVASAVGGMLDTVVHDLTGLLIPPKDPRACANAVTAIL
RDRRGAAAFGAAGRERARSRYSWERVATDTLRVYDRLLPVRAPVRTAARA
SGQG
333991717YP_004524331.1 hypothetical protein JDM601_3077 [Mycobacterium sp. JDM601]MAGACLLRALGRLDSSTYLELRDSVIKAALDEPQAVMVDVGGLDVPAPSA
WSVFASARWHVSTWPDIPILLICPRPEITDQISGTGVTRYVPVHADVESA
LVSLVAAKRPRRRVRIELPRRLSSLRGGRDFVAEWLTNWSQEQLIPTAKV
IVDVLVENVLRHTESPPVILLENADSTVTIAVQDADGSPAMRREAGAGGA
YRTSGLAVVGALCRAWGSSPTPGGKTVWAVVGPENRL
333991715YP_004524329.1 response regulatory protein [Mycobacterium sp. JDM601]MGHGEPQRVGRFRYWLGEQRWEWSDTVARMHGYEPGTVEPSTELLLQHKH
PEDRPQVAEVLERVVQGEPFSSRHRIIDTREQEHWVIVVGDRMVDDAGVV
TGTAGFYVDVTDVLQADVSAAVSEVAESRSVIEQAKGVLMVAYGISAERA
FDILVWRSQETNVKVRDLAARFLAAMSGAFSPDSVSLVDHTLLTVD
333991713YP_004524327.1 hypothetical protein JDM601_3073 [Mycobacterium sp. JDM601]MATTQVPGAQRYLPDRRTLSALREAAAGCHGCELYRDATQTVFGEGRRGA
PLMLVGEQPGDQEDRQGHPFVGPAGRLLDRAIHDAGIDPELVYATNAVKH
FKFTRREGKRRIHQKPGRTEVVACRPWLIAEIDAVRPQLVVCLGATAAQS
LLGAAFRVSTGRGELLNPPTGAQCRPPVLATVHPSAVLRDRSDRRDEAYR
AFVDDLRVAATAVTGEHRLYDGAV
333991711YP_004524325.1 methylase [Mycobacterium sp. JDM601]MTPAGVYAPQQDSHLLVDVMESSGLARRRRVLDLCTGSGVVAIAAAELGA
GSVTAFDICPRAVRCARDNAGAAGVDIEIRHGPWAGALSCEPFDLIVSNP
PYVPSPRHSGPVPVAGGPEWSWNGGVDGRIVLDPLCRTAATLLRSGGSML
LVQSALADAARSLKALRDSGLAADIAATRWIPFGPVLSARADWLERTGRL
PRGCREEQLVVIRADKP
333991709YP_004524323.1 hypothetical protein JDM601_3069 [Mycobacterium sp. JDM601]MMIDAEGLSPSEGLPEADRAEQWLAADAGEEDDGLDPARLENIDEKDANP
ADVIDQAISVPLPHDDYDTEP
333991707YP_004524321.1 molecular chaperone [Mycobacterium sp. JDM601]MSADIDDLLQIEEVEMMLMRTDPFRDLDRWTQQVLGTAARPAVMPMDAWR
DGDQFIVEFDLPGMKEDSLGLDVERNVLTVHAERPGLDQSREMVSAERPR
GVFSRQLFLGDNLDAEQIQASYQDGVLRVTIPVAEKAKPRRIKVASGHGE
RAING
333991705YP_004524319.1 hypothetical protein JDM601_3065 [Mycobacterium sp. JDM601]MTATRRADPSGEFGHIGWQYRDHDEFICRATEYLAIGLNLGQRVGYVGDD
EPTRIRAALAAAGLGAAADGVDVKTVPEHFVFRAGGEVVDAAGMAERYAA
AAIAAVADGYSGLRVVIDVTPVARTPEQREAQAALEFLGDRRISTLPVAA
LCGYNIAELGEAAAGLLCLHAAAGPASSPFQLYSQPARRNAIALAGHLDA
ASEVLFAATLHRILPLLSQATLEIDARELDFVGHRQLLLLDRCCAAHDRV
AVLHSSRPTVRRLFDLIGFEHIHIDTGGGVRPEADVRVGTQGR
333991703YP_004524317.1 hypothetical protein JDM601_3063 [Mycobacterium sp. JDM601]MMIALGVILLILALVLKINVLWTIGIILVVIGAALWILGAIGRPVAGRRY
WY
333991701YP_004524315.1 hypothetical protein JDM601_3061 [Mycobacterium sp. JDM601]MLVTPPVVIAGIGGVFSRRWAKRWLPLTAGVYAANGLLGEYLHARGVARK
PGGWRNASYNVPMGPPIAAPGLMAMVGGMGLLAAVLRRER
333991699YP_004524313.1 cholesterol oxidase ChoD [Mycobacterium sp. JDM601]MGDFWRGLLKGSLGPPDNDSRFLLDVQSRQLPGENTMRRYATDDEVDLVV
VGAGAGGSVLAQRLARAGWRIVIIEAGPFWHPDTDWVSDEAGSHPLYWTQ
KRIIGGDDPIELGKNNSGRGVGGSMVHYAGYCPRFHPSDLRTYRLDGVGA
DWPIDYSDIRRHYEVLEAELPVAGQNWPWGYPHRYPSSPHPISSAASKLW
EGARNLGIEMRVGPVGIVNGTFGNRPHCIYRGYCLQGCKVNAKASPYVTH
LPDALAHGVEIRADSMAARIELDDTGAARGVVYLDSDGTEHLQRAKVVAV
AGYSIETPRLLLNSTSSRFPNGLGNNTDQVGRYVMVQGASQTAGRWPEEL
RMYKAPPPQVSSEQFYETDATRGFARGFSIQTVSPLPIGWAEHVLADGHW
GRAMREYMRDYNHWSTIGVLNELLPLPDNRVTLADEADDFGIPVARMDYT
RCDNDKANMAYSTRVITDILYAAGAQDVLTIQRYAHLIGGARMGTTPENS
VVDADHRVWEVPNLFLSDGSVCPTQGSANPALTIMALASRLAERLAGKQV
LQKGFQS
333991697YP_004524311.1 hypothetical protein JDM601_3057 [Mycobacterium sp. JDM601]MGRDAFADRDTIMACLDAAEAAHGRLEQCSFDALTTEELVDVLARREALA
WRAPAIDHQILTRLVTEGDAGLLGECSLGKALAERLRISSAAARRRLAEA
AELGPRTAVTGEPLAPELPELATAQARGRIGPEHTAIARKTMAKIPAAVD
AADRERAERDLAVLAGQFGPETFQRLADHLLAALNPDGDITDRERQARRG
LRLSRQDADGMSTLSGKITPELRATLEPILAKLGAPGMCNAADEKPCVSG
TPSQEQIQADHRTRDQRHHDALLAASRAVLACGDLGQLNGLPVTVIVSTT
LAELQAAAGKAHTGGGSLLPMSDLLRMAAHSYHYLSIFDGRGRALWLGRT
KRIASADQRIVLHARDHGCTRPGCTVSGYLSQAHHLERDWADNGQTDIDS
LALACAPDNRMASEQGWVTRLGESGRVEWIPPPKLDHGQPRVNPFHFIEA
VIDYHRRPPPEDLPPPDADCPWPGDSVRDDPLFDDPLFDGDAYEAVAVEG
LAQRHLFEEHDWAEAG
333991695YP_004524309.1 hypothetical protein JDM601_3055 [Mycobacterium sp. JDM601]MPKTTKSGAAKQGELPSTLQRSSAKAQRTFAKAHDAAAKEYGSEQRAHRV
AYAALKHSFEKVGDHWEPKKKRGPSDKRAQGGGPNNSGPSAEGVDANASK
QHLMDVARRLDIHGRSTMKKSELVTAIKKHNRRVRGT
333991693YP_004524307.1 hypothetical protein JDM601_3053 [Mycobacterium sp. JDM601]MCLTGTVNGPQRRATIETVVRAIVEPRVVVNDIEVVQLCEPVEQVTG
333991691YP_004524305.1 HAD family hydrolase [Mycobacterium sp. JDM601]MTAQSAVLFDVDGTLVDSNYLHVHAWRRAFAEQRIEVESWRIHRAIGMDG
SALVRLLSDDAPDDVRRRLKELHSRFYLESAPLLSPLPGARRLLERIAAL
QLPVVLATSAPDDELAVLRKALDCDDLIAAVTSSADVDIAKPEPDIIGIA
LDRIGATAERAVFVGDAVWDVAACVRAGLPCIGVLSGGVSRAELETAGAV
GVFDNAEELLTQLDRTPIADLPDGRPGHG
333991689YP_004524303.1 anti-sigma-factor antagonist [Mycobacterium sp. JDM601]MVAADGEIDAANAAPFADYARRCADCCEWLILDLAELAFIGTVGFTALQS
VSARCAAAQTRLMVVPSPAVTSVLRICDPQSRLPLVPSLADALADVQKSG
RPLRAVT
333991687YP_004524301.1 F420-dependent glucose-6-phosphate dehydrogenase [Mycobacterium sp.MTRFGYTLMTEQSDPKDLVRYAVSAEERGFDFEVCSDHFSPWLASQGHAP
NAWAVLGAVAQATEQVGLCSYVTCPTMRYHPAVVAQQAATVQILADGRFT
LGLGSGENLNEHIVTGAGWPNVGRRQAMLGEAIKIIRELLMGETVNLHGD
HFQVDRARLWDLPEIPVALAVAVSGDKGVDRFATAADDLIAVQPDADLVS
AWHTARRASGLGDGRVIGQLPVCWGPDRDAAVQRAHRQFRWFGGGWLVNS
ELPTPAAFAAATRFVTPQDVADAIPCGPDLDPIVEAVGAYRDAGFTDIAL
IQIGGETQDAFLKEAAEPLLAALRDAAA
333991685YP_004524299.1 bifunctional acetyl-/propionyl-coenzyme A carboxylase subunit alphaMANHASSKISKVLVANRGEIAVRVIRAARDAGLPSVAVYAEPDADAPHVR
LADEAFALGGQTSAESYLVFEKILDAAAQSGANAIHPGYGFLSENADFAQ
AVLDAGLIWIGPSPQSIRDLGDKVTARHIAARAKAPLVPGTPDPVKDADE
VVAFAEEYGVPVAIKAAFGGGGRGMKVARTIEEIPELFESATREAIAAFG
RGECFVERYLDKPRHVEAQVIADQHGNVVVAGTRDCSLQRRFQKLVEEAP
APFLTDAQRKEIHESAKRICKEAGYYGAGTVEYLVGQDGLISFLEVNTRL
QVEHPVTEETSGIDLVREQFRIANGEQLDITEDPEPRGHSIEFRINGEDA
GRGFLPAPGPVTRFDPPTGPGIRMDSGVETGSVIGGQFDSMLAKLIVTGA
TRTEALERARRALDEFHVEGLATVIPFDRVVVRDPAFVGDENGFSVHTRW
IETEFENTIEPFTGGEPLDEEDAQPRQKVVVEVGGRRLEVSLPGDLALGG
GGGGGGAAGVIRKKPKARKRGAHGGAAASGDAVTAPMQGTVVKVAVEEGQ
EVAAGDLVVVLEAMKMENPVTAHKDGVVTGLAAEAGAAITQGTVLCEIK
333991683YP_004524297.1 thiosulfate sulfurtransferase [Mycobacterium sp. JDM601]MPVPADPSPALQSYAHPERLVTADWLAGNLGKPGLVVVESDEDVLLYDVG
HIPGAVKIDWVTDLNDAPVRDYISGEQFADLMNRKGISRDDTVVIYGDKS
NWWAAYALWVFTLFGHEDVRLLDGGRDLWVSSGRETTLEVPSKTTTGYPV
VERNDAPIRAYKEDVLEIIGRVPLIDVRSPQEYTGERTHMPDYPEEGVLR
GGHIPTAVSIPWSKAADDAGRFRKREELEQLYGFLKPGDNPVAYCRIGER
SSHTWFVLTHLLGMEGVRNYDGSWTEWGNTVRVPIVDGEAPGAVPA
333991681YP_004524295.1 nucleotide-binding protein [Mycobacterium sp. JDM601]MLRGAGIEPLVVVSGVDEDAVIAGLDPHAAPAQVVAALAAAKADAVAADL
DADVTGDCIVVGCDSMLDVEGRLCGKPDSADAARAQWNSMGGRTGLLHTG
HCLLRLRDGAVIHREAEVGSTAVHFAKPAAADLDTYVASGEPLGVAGAFT
IDGRGGWFIDRIEGDPSNVVGLSLPLLRRLLAAAGISIAALWAANSARRV
333991679YP_004524293.1 propionyl-CoA carboxylase subunit beta [Mycobacterium sp. JDM601]MTVTEHSGESAVEAQGEHVVDIHTTAGKLADLKRRAEETLHPVGEAAVEK
VHAKGKLTARERILALLDEGSFIELDALAKHRSTNFGLAGKRPLGDGVVT
GYGTIDGREVCIFSQDATVFGGSLGEVYGEKIVKVQELAMKTGRPLIGIN
DGAGARIQEGVVSLGLYSKIFHNNILASGVIPQISLIMGAAAGGHVYSPA
LTDFIVMVDQTSQMFITGPDVIKTVTGEDVTQEELGGAHTHMGKSGTAHY
VASGEQDAFEYVRDLLSYLPPNNYADPPRFAVPVAEGAIEDNLTDEDLEL
DTLIPDSPNQPYDMHEVITRILDDDEFLEVQAGYAGNIVVGFGRIEGRSV
GIVANQPTQFAGCLDIYASEKAARFIRTCDCFNIPIVMLVDVPGFLPGTE
QEYNGIIRRGAKLLYAYGEATVAKITVITRKAYGGAYCVMGSKEMGADVN
VAWPTAQIAVMGASGAVGFVYRQQLSEAARNGEDVDALRLSLQQEYEDTL
VNPYVAAERGYVDAVIPPSHTRGYIATSLRLLERKIVQPLPKKHGNIPL
333991677YP_004524291.1 lipase [Mycobacterium sp. JDM601]MSLASRLVVKNVVRAWAIRPDMPWPFASVDRFAGWVPYRPAVTVERLRLG
SCVAERVQAKETSAQRAILYLHGGAFLTCGLNTHRALVARLSQAAEAAVL
NIDYRMLPSHGITDAIEDGLNGLRWLFRRGYDPERIVVAGDSAGGYLAFM
TALAAVQSDLPKPAGIAVVSPFTDADPTAKMRHRNANRCAMFPCGALPAF
TRCLRRAHVVSPVDADLSALPPVTIHASSDELLLPDAEVMAERLGSAGVP
CDLHLWDGQIHDFPLAADVLPEGRRAIRYIGDFVKRVTDVSEPPESGTAA
A
333991675YP_004524289.1 transmembrane protein [Mycobacterium sp. JDM601]MGYPESVLAEDEQVVLHRHPHVKRLLGPVLALLLATACAGFASGFVNPRA
WDPNAKNVVFAVIWAIWLVVVGWLALWPFLSWLTTHFVVTDRRVMYRHGL
LTRSGIDIALARINSVEFVHGLIDRMLRTGTLIIESASQEPLEFYDIPRV
EQVHALLYHEVFDNPSAAG
333991673YP_004524287.1 phosphoribosylaminoimidazole carboxylase ATPase subunit PurK [MycobMVGGGQLARMTHQAAIALGQRLRVLATATDEPAAQVTSDVVIGSHTDLDD
LRRVATGATVLTFDHEHVPGELLDKLVAEGVNVAPPPAALRHAQDKLVMR
RKLAALGAPVPRFAAIETAAGMPALDEFGAQTGGAMVVKAARGGYDGRGV
SIVDDVAGARAAVADYLASGVPVLVEERVAMRRELSALVARSPFGQGAAW
PVVETVQQDGICVAVIAPAPELSDESAAAAQQLALRLADELGVVGVLAVE
LFETVDGELLVNELAMRPHNSGHWTMDGAATSQFEQHLRAVLDYPLGATD
PVVPVTVMANVLGAPEPPAMTIDERLHHLFARYPDARVHLYGKDERPGRK
IGHINLLGDDAAGSAELRERAENAAHWLSHGEWRAGDDAERQR
333991671YP_004524285.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MAGWAGNPSFDLFQLPEEHDELRAAIRALAEKEIAPHAKEVDEQARFPEE
ALAALNASGFNAVHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN
KLGTMGLILSGSDELKQQVLPGLAAGEVMASYALSEREAGSDAAAMRTRA
KADGDDWILNGAKCWITNGGKSSWYTVMAVTDPDLDANGISAFMVHVDDE
GFTVGPKEHKLGIKGSPTTELYFENCRIPGDRIIGEPGTGFKTALRTLDH
TRPTIGAQAVGIAQGALDAAIDYTKDRKQFGKNISTFQGVQFMLADMAMK
IEAARLMVYSAAARAERGETELGFISAASKCFASDVAMEVTTDAVQLFGG
AGYTTDFPVERMMRDAKITQIYEGTNQIQRVVMSRHLLR
333991669YP_004524283.1 class V aminotransferase [Mycobacterium sp. JDM601]MPGLLPDVDPDGLLEYSVVYTDRALNHMSVRFRDVMTDVSAMLREVYRAD
AAILVPGNGTCGMEAVARQFANGADVLVVRNGFFSYRWSQILETTGITDA
VTVLTARPAGDGEQAPWAPAPIDEVEAAIARTRPAVVFVPHVETASGILL
PDDYLARVGAATTAVGGLFVLDCIASGAVWVDMTALGVDVLVTAPQKGWS
AEPGCAMVGLSGRALAAMARTRSTSFALDLKKWREIMAAYENGGHAYHAT
MPTGVIGRLRDAMAETRDRGFGEVADQQCTLGRKVRALLAERGFPSVAAP
GFEAPGVVVSYTTDPEIRSGRKFLGQGLQTAAGVPLQCGEPATFSTFRVG
LFGLDKLADIEGTVARLRSAIDRIS
333991667YP_004524281.1 acetate kinase AckA [Mycobacterium sp. JDM601]MSAVSAGVVLVLNSGSSSIKFRLIDPVAGTAVVSGLVEQIGEPDSAVADH
AAGLRLIHQRLADSGVDLGEVRAVGHRVVHGGTRFHAPTLITDAVVAEVS
RLAELAPLHNPANVIGIEVARADFPDVPHVAVFDTGFFHSLPAAAAAYAI
DREVASQYGIRRYGFHGTSHEYVSREAALLLGREPAEVNTIVLHLGNGAS
ASAVRGGVAVETSMGLTPLEGLVMGTRCGDIDPGVLFHLNRTAGLGVDKL
DELLNRRSGLKGLSGVNDFRELLQQVSHGSSAATLAYDVYIHRLRKYVGA
YLAVLGRVDAIAFTAGVGENVAAVREDALAGLDGLGIVVDPQRNRGGNGA
RIISAEHSRSTVLVVPTNEELAIARAAWQFV
333991665YP_004524279.1 phosphate ABC transporter substrate-binding protein [Mycobacterium MDCGGKQDLHAAGSAAQQNAIAQFGYAYGRACPGQTLNYTANGSSAGVDD
FLAAETDFAGTDVALDPAKGQPERAAERCGSPAWHLPTVFGPIAVTFHIS
GVGALNLDGPTVAKIFNGTIGTWDNPAIKALNAGVALPSTPIHVVYRSDK
SGLTANFQRYLENASEGAWYAADGEMFNGGVGEGAAGNNGTSAALQNTDG
SISYSEWSFAAGKQLPMAQIIATAGDRPVSISAESVGKTIAGARFAAGSG
HGNDLVLDMSSLYKPSTPGAYPIVSATYQIVCSKYADDATATAVRAFLQA
AIGPGQDGLDQYGSIPLPEAFAAKVLAAVNAVS
333991663YP_004524277.1 hypothetical protein JDM601_3023 [Mycobacterium sp. JDM601]MSGVIVTAADVHAARIHGRIGAHDATVHDKNATAHFGPGPAAGPLSLQDP
G
333991661YP_004524275.1 metal cation-transporting p-type ATPase CtpC [Mycobacterium sp. JDMMSAANSAELIVVSDAAGRMRVRTPWVRGDSRRAVAVEETAGRVNGVRTVH
AYPRTGSVVVWYSPQRCDTDAILAAIRDAADVAADLIPARTPRSADIRNT
DVLRMVIGGTALAMLGLRRYAFARPPLLGPSGQLVATGATVFMGYPFLRG
ALRSIRSGRAGTDALVTAATIASLVLRENVVALTVLWLLNIGEYLQDLTL
RRTRRAISDLLRGSQDTAWVRLGQGPPENPEYTEVQVPIDTVQLGDEVIV
HDHVAIPVDGEVIDGEAIVDQSAITGETLPVSVIAGTAVHAGSVVVRGRV
VVRATAVGSQTVIGRIISRVEEAQHDRAPIQTVGENFSRRFVPASFILSA
FTLLVTGDVRRAMTMLLIACPCAVGLATPTAISAAIGNGARRGILIKGGS
HLEQAGRVDAIVFDKTGTLTVGRPVVTNIVAIHKDWEPEQVLAYAASSEL
HSRHPLAEAVIRSTEERHIVIPPHEECEVLVGLGIRTWADGRTLLLGSPN
LLRAEKVRISKKAAGWVTKLRAQAETPLLLAVDGTLVGLISLRDEVRPEA
HEVLEQLRAKGIRRVVMLTGDHPETAAAVAAELGIAEWRAEVLPEDKLQV
VRDLQDEGYVVGMIGDGVNDAPALAAADIGIAMGLAGTDVAVETADVALA
NDDLRRLLDVRDLGSRAVEVIRQNYGMSIAVNAAGLLIGAGGALSPVLAA
ILHNASSVAVVANSSRLIRYKLDREPMASGAAEA
333991659YP_004524273.1 hypothetical protein JDM601_3019 [Mycobacterium sp. JDM601]MTNLSSAILDPIMRADPAGPRITYYDDATGERIELSAATLANWAAKTGNL
LRDELGAGPGARVAVLLPAHWQTAAVLFGAWWIGAEVLLGDAAPDADIAL
CTADRLDEADAAVAATGGEVVVASLDPFGKPAPDLPVGVTDYATAVRVHG
DHLDPERSPGTALAGSSADEVLALCEKSAAATGLTAADRVWSANGWQTPA
RLIDNMLAVFAVGASLVQVGNPDPDVQARRRESEKVTRALG
333991657YP_004524271.1 dTDP-6-deoxy-L-lyxo-4-hexulose reductase RmlD [Mycobacterium sp. JDMGALQRIVITGARGQLGRFLTGRAAEAGRDVLALSSAQCDITDPGAVDAV
DLRAGDLLVNCAAYTAVDAAETDPERAHAVNAAGPGHLAAACARAGARLI
HISTDYVFDGDFGGAPPRPYEPGDPTRPLSVYGDTKLAGEKAVLAGSPDA
LVVRTAWVYTGAVGGSDFVAVMRARAEADETVEVVDDQIGSPTYVGDLAD
ALLRLAEAWPAARLLHAANAGAASRYEQARAVFTALGADADRVRPVSSTA
NPRPAARPAYSALSGVDSGRAGLAPLRPWRDALAAAVAR
333991655YP_004524269.1 d-alpha-D-mannose-1-phosphate guanylyltransferase ManB [MycobacteriMTLSQVDAVVLVGGKGTRLRPLTLSAPKPMLPTAGLPFVTHLLSRIAAAG
IEHVILSTSYKPAVFSQEFGDGSALGLEIDYVTEDEPLGTGGGIANVAPK
LRHDTAMVFNGDVLSGADLAELYAYHREREAEATLHLVRVGDPRAFGCVP
TDDGRVTAFLEKTEDPPTDQINAGCYVLSRNVIDRIPRGRAVSVEREVFP
ALLSDGVKVCGYVDTSYWRDMGTPEDFVRGSADLVRGIAPSPALGGRRGE
SLVHDGAAVAPGTVLIGGTVVGRGAEIGPGARLDGAVIFDGVKVEAGSVI
ERSIIGFGVRIGPRALIRDGVIGDGADIGARCELLRGARVWPGVSIPDCG
IRYSSDI
333991653YP_004524267.1 CopG family transcriptional regulator [Mycobacterium sp. JDM601]MRTTVEITDEQHRALSAIAQRRGVRGFSLLVQEALDGYLASLDTDEVDLL
IGLEGTLTDAEAQEMETRINDARATWRAS
333991651YP_004524265.1 F420 biosynthesis protein FbiB [Mycobacterium sp. JDM601]MTGPGEHGSAAKVEILPVTGLGEFRPGDDLAGALAQAAPWLADGDIVVVT
SKVVSKCEGRIVPAPHDPEARDALRRQLVEAEAVRVLARKGRTWITENRL
GLVQAAAGVDGSNVGACELALLPVDPDGSAATLRARLAEQLGVDVAVLIT
DTMGRAWRHGQIDVAIGASGLTVLNGYAGAVDRHGNELVVTEVAVADELA
AAADLVKGKLTDVPVAVVRGVVSPDDGSTAAALVRSGPEDLFWLGTAEAI
EAGRRQAQLLRRSVRAFSAEPVPAETITDAIAEALTAPAPHHTRPTRFVW
LQSPGVRTRLLDAMADKWRADLTGDGKSPEAVEARVARGRILYEAPEVVI
PVMVPDGAHHYPDATRTAAEHTMFTVAVGAAVQALLVALAVRGVGSCWIG
STIFTPDLVRAELDLPTDWEPLGAIAIGYSVEPPEPRPPAAIDGLLVRR
333991649YP_004524263.1 transcriptional regulator [Mycobacterium sp. JDM601]MSYEHLWGVMGATPHANTGFTAPAEAEPAPSRPHLSLVPELDDYDEFDPF
DPASATNEQWQDRALCAQTDPEAFFPEKGGSTREAKKICQRCSVRSECLE
YALAHDERFGIWGGLSERERRRLKRGII
333991647YP_004524261.1 hypothetical protein JDM601_3007 [Mycobacterium sp. JDM601]MATLTFVYSDSTAVVGPLATAAEPHSWDLCFSHAGRITAPRGWELVRHPG
PWVSPEEDDLIALAEAVREGQSGQAAPANGWYPQAGPADTGSRGASSGTP
GGGVLAPPGPPGKSNGRRRGHLRVLPDPSD
333991645YP_004524259.1 hypothetical protein JDM601_3005 [Mycobacterium sp. JDM601]MNAFPGSFSSTVDLDDAEALLAADRDGALWAASMAGAQVRATAAAVAEGA
LDTVRGDIRDFPARTLIWVATRGAAATAGSLLAAARGDSAREPLVLAAEA
PAWMGSLDVLVVAGDDPGDPALVAAASAGVRRGARVVVAAPYQGPLRDAT
AGRVAVLEPRVGVPDEFGLPRYLAAGLAVLEAVEPGNPAAQIDLGVLADE
LDAEALRNSAGRELFTNPAKILADRIVGRDVALAGDCAASLALARHGSAM
MLRIGRTAVAATGLADAVSALRARAADGAGGSADIFHDEQIDGPAAERLR
VLALALSAERTVVAARISGLHDVDLIGAGDVPLTPAAAEETSGPAAVPAP
AGPGRAEQQLAVLAVRLEMAAAYVRLLRG
333991643YP_004524257.1 cation transporter [Mycobacterium sp. JDM601]MSTSGSTRAILAALLANAGIAVAKFTGYVITGSAAMLAEAVHSVADTSNQ
ALLLFGQRAAAKAPDELHPFGYGRSRYFWSFVVALVLFSLGSMFALYEGY
KKVHHPVELSSPVVAIVILVVAIGMETFSFRTAVVESRPFKGEGSWLRFL
HTSRTPELPVVLLEDTAALIGLVLALMGVGLSVVTGNPVWDGVATLGIGV
LLGVVAVFLMVEMHSLLIGEGATVAEDRAIRAALEQTRNVTRLIHIRTLY
LGPDEMLVGAKIALRPQLDLPAVAATIDDAEANVRRAVPAARVIYLEPDL
DRTAVPDSRQQKG
333991641YP_004524255.1 hypothetical protein JDM601_3001 [Mycobacterium sp. JDM601]MDFLDISATSADTAGAADAGIWIDGFDSSYSNLHADLQDFITDPGNTDLL
NLINGYGLFESLFGRLLIGNGIDEFAGTNTSLFGWLPGIGDLGDGGFLFG
DGGAGTDASYVDNLLTAAGVGGNAGLIGNGGIGGAGLDADYYGGNTLVEA
TAGGAGGSGGWLFGDGGDGGAGGAGWSGILADGLNGSIGAGGGEGGSAFL
FGSGGNGGNGGAGGHGSAGAGSQLDQVGGNGENGGAGGAGGNGGNGGNGG
NGGWIIGDGGDAGAGGAGGGGGLGGSGSDSIAHDHDHDHYVHEATEGGNG
GVGGNGGAAGAAGVARTLFGFGVNGTAGTLGAGGDGGAGGNGGNGAVDEA
SFISAGAAGGAGGGGGDGSIGGAGGAGGNGGDGDVLGGAGGAGGTGGDSN
AGDGGQGGVGGNGGSSAGESLTLPDGSVVSGAAGHGGAGGNGGDNANGHG
VGGDGGAGGSGGSGAVDEYGQVLAPGGDGGVGGNGGASGNLLGDPGEAGG
EADGATGGTGGAGGIGHPHDHDHDHDHDAGGDPGGDPGGDHDHDHDHDHD
H
333991639YP_004524253.1 hypothetical protein JDM601_2999 [Mycobacterium sp. JDM601]MARESTRRRLTAKQADTVERLSRAAMTVLGREGFSGLTIRMVAAEAGIGA
ATAYTYFSSKEHLVAEIFWRRLALTPAPTVDSPDRIIRVVTVLRHIALLV
ADEPELAGAVTAALLGSDPDVEHLRRRIGTEIHDRLATAVGPGGEPDLVD
SLELLYSGALVRAGMGYGSYQQIADRLEKSARLLLSAAS
333991637YP_004524251.1 hypothetical protein JDM601_2998 [Mycobacterium sp. JDM601]MRSAEAGAPGVPGVLTPQQCRQTAASIAAVQESSGAIPWSATGHTDPWDH
VECAMALTAAGLIEPARAAFDWSRESQRADGSWPIQLRAGEIEDANSDSN
FCAYIATGVWHHVLITGDRPFAAAMWPTVAAAIDFVLGLQRGSGEICWAA
SPAGPVGEALLTGCASIYHSIRCALALADYLGAPQPEWEVALGRLGHAIT
AHPGAFTEKPHHAMDWYYPVLTGALRGPAADERIAARWDAFVVDGLGIRC
VDDRPWVTGAETCELVLTLDAMGRADAARNQLAAMQHLREADGSYWTGLV
FSDGKRWPVERTTWTGAAVILAADALSDTTAGAGIFRGADLPRGLEGDYD
CACAELPR
333991635YP_004524249.1 glycosyltransferase [Mycobacterium sp. JDM601]MSRQPADDVERLRIALLSYRSKEHCGGQGVYVRHLSRGLAELGHHVEVFS
GQPYPERLDPAVLLREVPSLDLYREPDPFRVPRPSEIRNRIDLLELTTMW
TAGFPEPRTFSLRAARLLAARRDDFDVVHDNQCLGTGLLRIAATGLPVVA
TVHHPITRDRRLDLAAAPWWRKPAVHRWYGFAEMQKRVARRLPELLTVSS
TSAADIAADFAVDPARLKVVPLGVDTEVFRPREQPRVAGRIVAIASADVP
LKGVAHLLAAVAELRTERDVELQLVAKLERGGVTEKLIAELGIADIVTVS
SGLTDAELAAVLASAELVCIPSLYEGFSLPAVEAMASGTPVVASRAGALP
EVLGDDGVCAHLVPPGDAAALTRALGVLLDDPDRRRRLGAAGRRRALDVY
SWPAVAAATVAVYRDAIERSAAPC
333991633YP_004524247.1 hypothetical protein JDM601_2993 [Mycobacterium sp. JDM601]MVYAIARPQIEGKIAVGEDRQLGFAEFGAPQGRAMFWLHGTPGARRQIPV
EARVVAKEAGIRLIGVDRPGIGSSTPYQYETVSQFAEDLRSVADTLGIDK
MAVIGLSGGGPYTLACAAAMPERVVAAGILGGVAPAVGPDAIDSGLMTLA
RIAEPVLQRAGRPIGILATGLIRMIRPVAEPALELYALISPEGDRRLLAR
PEFKAMFLDDLLNGSRKQLAAPIADAVLFARYWGFRLDEVKVPVHWWHGD
ADHIVPFAHGEHAVSLLPDAQLYPLPGESHLAGLGRAEEILRTMSQVWDD
AEAR
333991631YP_004524245.1 transmembrane alkane 1-monooxygenase AlkB [Mycobacterium sp. JDM601MSTEAAAEVWRDKKRYLWLMGLIAPTLLFTMLPMIWVMNRLGWHVAAQLP
FWIGPILVYILLPALDLRFGADGQNPPDELMAQLESDRYYRYCTYAYIPC
QYASVVMGAYLFTATDLSWLGVEGSLSWFAKIGLALSVGTLGGVGINTAH
ELGHKKDRLERWLAKITLAQVCYGHFYIEHNRGHHVRVATPEDPASGRFG
ETFWEFLPRSVFGGLRSAWQLEAARLRRLDKNPADPRTWLSNDVVNAWLM
SVVLWGVLIAVFGPALIPFVIIQAGYGFSLLESVNYIEHYGLLRQTRANG
RYERCTPEHSWNSDHLVTNLFLYHLQRHSDHHANPTRRYQTLRSMDEAPN
LPSGYASLIGLTYLPPLWRALMDHRVLAHYDGDITRVNIEPRRRAKILAR
YGAPLDEGAAA
333991629YP_004524243.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MKRVPYAEASRALLRDSVLDAMRELLTSRDWSSITLAAVAEAAGVSRQTI
YNEFGSRQGLAQGYAIRLADRLVDAVERAIYDNVGDVHAAFLEGFRSFFS
SSAADPLVISLLTGAAKPDLLQIITTDSGPIITRCSARLTSSFMHSWVKA
SEEDAGILARAIVRLAMSYVSMPPEADHDVAADLARLFTPAAETYGVLDI
333991627YP_004524241.1 thymidylate kinase [Mycobacterium sp. JDM601]MLIAIEGVDGAGKNTLTNGLRAAFEAAGKSVASLAFPRYGVSVTADVAAE
ALRGRHGDLADSVYAMAMLFALDRAGAKDQIGELCREHDVVILDRYVASS
AAYSAARLRQDADGEVVAWVRELEFERLGLPAPDWQVLLDVPAELAAQRA
RDRETRDAARARDSYERDDGLQRRTGEVYRGLARAGFGGPWQLAGPTVAP
AELAGVLCG
333991625YP_004524239.1 two-component sensory transduction histidine kinase MtrB [MycobacteMIFSSRRRPRRSGPLLLGVNTLRRAVQIAWRRSLQLRVVVLTMGLSAAVI
LALGFVLTSQITDRVLDVKVRAATEQIERARITAGGIVGGEEARSLTSSL
QLARNTLMSKTDPASGSGTAGAFDAVLVVLGEGPRAATSAGPVDQVPAAL
REFVKAGQVSYQYATVHVEGFSGPALVIGTPTTSRITNLELYLIYPLGSE
RNTISMVRGTIATGGLVLLVLLAGIALLVSRQVVLPVRSASRIAERFAEG
HLSERMPVRGEDDMARLAVSFNDMAESLSRQITQLEEFGNLQRRFTSDVS
HELRTPLTTVRMAADLIHDHSEDLEPSLRRSTELLVSELDRFESLLNDLL
EISRHDAGVAELSVESVDLRSTVNSALDNVGHLAAEAGVELRVNVPGDPV
IAEVDPRRVERILRNLIANAIDHAEHKPVVIRMGADADTVAVTVRDHGVG
LRPGEEKLVFSRFWRADPSRVRRSGGTGLGLAISVEDARLHQGRLEAWGE
PGKGACFRLTLPLVRGHKVTTSPLPMKPVSAAERRERRQRAREHAERSG
333991623YP_004524237.1 triacylglycerol synthase [Mycobacterium sp. JDM601]MEQLTTLDAGFLEAEDSDRHVSLAIGGLVILAGPPPDYASLVATLGARIS
GCRRFGQKLQLHPFDLAPPQWVADPEFDMAHHLRRVALPSPGGDAELFGF
VADQMARRLDRDRPLWHIWVIEGLTDDRWAMLIKVHHCVGDGIATSHLFT
GLCDESGDLGDRVASFAGHLPSSHESRPGEWHFGLPTVNGSPASWAAELW
NVSTAISAAAVRAARGTVELSAGLLRQGTPTSLNGPMSAMRRYSSAKVSL
ADVSQICQAFDVTLNDVALAGLTEAYRGMLNRRGERPLPETLRTLVPVST
RGGDAVGATDNRVSVMLPCLPVEEDNPVRRLKLVHARLSRTKRTGQRQAG
SVFVSAASHIPFPLTAWAVRLLTRLPQRGVTTLATNVPGPSQTLHIMGRT
VLEVLPVPPIALQLRSGVAMLSYAESLFFGVLADYDTMPDVDEFARSIET
AVARLVAVAKRRNARRERSEHRQPVLVVTG
333991621YP_004524235.1 cyclic nucleotide-binding protein [Mycobacterium sp. JDM601]MSDDPFRRNAILGQLPEAEYARLRPALRLEQAEMKQTAYEPGVAISRLYF
PLSAVYSLVGSADGRLAVEVATIGHEGFVGLPVYLGAATSPQTAFCQVPG
DTAAIDAEDFRRAMARDGGLHALLGRYTQTTMVQISQNVICNRSHPAEQR
MARWLLTTHDWVGRDEFPLTQEFLAQMLGVHRPTVSETAQRIQAGNMIHY
RRGVITITDRQLLEQLACDCYRIVKAEFDAIINYRGEGR
333991619YP_004524233.1 two-component sensor histidine kinase [Mycobacterium sp. JDM601]MTDDGPADGPDPLRDTLSQLRLRELLVGVQDRVEQIVEGRDRLDGLLAAM
LVVTSGLELDATLRSIVQTATNLVDAKYGALEVHDNDRRMLEFVHEGIDD
DTFARIGRLPEGLGVVGLLIEDPKPLRLDDLTKHPSSVGFPSGHPTMRTF
LGVPVGVRDEVFGNLYLTEKANGLPFSEDDEVLVQALAAAAGIAIANARL
YAQAKARQSWIESTRDIATELLSGTDPSTVFRLIAEEAGKLTGSESALVA
IPLDDDTLEAEVNELLVVETIGAVMAPLDGDTIPVAGSSVGEAFSQRKPR
QVARLALPGIDATGPALILPLRAADAVAGVVVVMRHGTTIPFSVEQLDMM
AAFADQAALAWQLATSQRRMHELDVLTDRDRIARDLHDHVIQRLFAVGLS
LQGTIPRARDAVVRRRLTDAVDDMQEIIGEIRTTIFDLHGTSATVTRLRQ
RLDNAVAQFSGSGLHTTVAFIGPLSVVEPVLADHAEAVVSEAVSNAVRHS
RATELTVQIKVEDDLAIEVADNGRGMPEVVTPSGLANLRRRAEQAGGTFG
IEAAPGGGTVVRWSAPLTI
333991617YP_004524231.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MDRSALNALFDLTGRTAIVTGGTRGIGLSVAHGLAAAGAKVVVASRKSDA
CQRAAQQLCQAGAEAIGVPTHLGDVEAIQQLVDTAAERFGGVDIVINNAA
NALAQPLGEITPEALVKSFTVNLQGPVLLVQAALPHLRASGRGAILNMVS
AGAFVYSPATSMYSAAKAALVSFTRSMAAEFASSRIRVNALAPGPVDTDM
VRNNPPEFIESLRAATLQQRIADPAEMVGPALLLVSDAGSFITGQTLHAD
GGMVAR
333991615YP_004524229.1 hypothetical protein JDM601_2975 [Mycobacterium sp. JDM601]MTMPGAWVWLMSGYALLLLVFAWGFDAMARRTSDRAAQWRTGKFAYHDDH
DAWKCPEDQWLWPSSFDPDNRVMRYRATPSICNACPVKDTCTTSNHGREI
TRPVDPWPHSEAGRFHRGIACAVAGFGVVMPLATLIANHRPGDVLVLGAT
ILIVLAGGAPLVRHLWNTPSNAPAERLDRAGGQAQVEQVEAAIDRYSTRW
GGFSDSSSTTRTRKAARK
333991613YP_004524227.1 hypothetical protein JDM601_2973 [Mycobacterium sp. JDM601]MGDGSFTVVLDLVLPRQCGGCGAPATRWCPGCAAQLAIGPDEPRLVSPRL
DPQVPVFALGRYAGARRAAIVALKEHGRTDLITPLASTLAEALHRLLCWR
MVDLPLTLIPAPTRRSAARRRGGDPIGRVAAAATARQPGMTVVPALRMRA
LTRDSVGLGSGARERNIAGRVLLNRRRLSAAGGDVVIVDDVVTTGATLAE
SVRVLRAGGVRVIAALVIAAA
333991611YP_004524225.1 preprotein translocase SecA1 1 subunit [Mycobacterium sp. JDM601]MLSKLLRFGEGRMVKRLRKVADYIDTLSGDAEALTDAELRAKTDEFRERH
QAGESLDDLLPEAFAVAREAAWRVLTQRPFHVQLMGGAALHYGNVAEMKT
GEGKTLTCVLPAYLNAIAGKGVHVVTVNDYLAKRDSEWMGRVHRFLGLEV
GVILSAMTPDERRVAYNADVTYGTNNEFGFDYLRDNMAHSLDQLVQRPHN
FAIVDEVDSILIDEARTPLIISGPADGSSNWYTEFARIVPLMEKDVHYEV
DLRKRTIGVHELGVEFVEDQLGIDNLYEAANSPLVSYLNNALKAKELFNR
DKDYIVRNGEVFIVDEFTGRVLVGRRYNEGMHQAIEAKEQVEIKAENQTL
ATITLQNYFRLYDKLAGMTGTAETEAAELHEIYKLGVVPIPTNKPMARTD
QIDLIYKTEEAKFAAVVDDLVERYEKGQPVLIGTTSVERSEYLSKQLTKR
RIPHNVLNAKQHEREAHIIAEAGRRGAITVATNMAGRGTDIVLGGNVDFL
ADQRLRRKGLDPVETPEEYEAAWDETLSEIKALAAVEAKEVIEAGGLYVL
GTERHESRRIDNQLRGRSGRQGDPGESRFYLSLGDELMRRFNGAALESLL
TRLNLPDDVPIEAKMVNRAIKSAQTQVEQQNFEIRKNVLKYDEVMNQQRK
VIYAERRRILDGENLAEQAHDMLVDVITAYVNGATSEGYAEDWDLEQLWT
ALKTLYPVGIDYHELLHAADVGEADDLTREELLEALIADAENAYAAREAE
VDGKAGAGAMRELERGVLLSVLDRKWREHLYEMDYLKEGIGLRAMAQRDP
LVEYQREGYDMFTGMLEGLKEESVGFLFNVAVEAAPTQPQVAPVDAPEGL
AQFGLRAKGVDGANGADGADGTAGLTYSGPDEDGSAQVRRGRDLQPAGAN
NSTSRRSRREAARREGRGPRQPKTQRKG
333991609YP_004524223.1 hypothetical protein JDM601_2969 [Mycobacterium sp. JDM601]MVNRLSATDAAFYRLENTTTPMYVQSLFILRRPRGGLSYEQLLATVEQRL
PQIPYYRQKIREVTMSLARPVWVDDHEFDITYHVRHLAVPSPGSDRQLHE
LIAHLGQQPLDRHRPLWELYLIEGLADNRIAVYIKSHQALVNGMAAPALG
HVLVDRTQRPPPFDEDIWVPRREPGAVELVLGAVGDWVAAPRAQLQAVGS
TFSDPLTWVGRKAFDTARALVRGTAPHTPLNTQVSQNRLFTVAHGALEDY
RTVRARYGCAINDVVLAVITGALRNWLLSRGEPVSSTRTVRAMAPLSVYP
DHEYDTAGQPIGAVTPFLVDLPVGEPNPVVRLSQIAYATESHPTPTGLVD
ARTILTVSGFAPPTLHAMGVRVATAFAGFSGRVFNLLITNAPGAQRQLYV
CGAKLLETYSVPPLLPNKAFTIGVTSYNGTLYYGVNADRKSMSDVGLVSA
LLDEALAELLEAAT
333991607YP_004524221.1 hypothetical protein JDM601_2967 [Mycobacterium sp. JDM601]MRVYIPATLAMLAQLVADGSLQAVSGTAFAVTPALRESYAHGDDEELAEV
ALAEAALASLRLLGAAGTGPDGDTLPTRRAVLVAEVDGAAARPDLDAAVV
RLAGRVEIGDVVAAYVDNAAAEPAVRAAVAAIDDADLGDEDAELTVGDAQ
DHDLAWYATQELPFLLDLL
333991605YP_004524219.1 linoleoyl-CoA desaturase [Mycobacterium sp. JDM601]MAVTDVEVFAHLSDADVENLAAELDEIRRDIEASRGERDARYIRRTIAAQ
RVLEVTGRLMLAAGSRRSVRWAGTATLGVAKIIENMEIGHNVMHGQWDWM
NDPEIHSSGWEWDMAGSSKHWRFTHNFQHHKYTNILGMDDDVGYGLLRVT
RDAPWKRFNLFNLFYNTMLAIGFEWGVALQHLEIGKIFMGRADRAATLVR
LREFAGKAGRQLFKDYIAFPALTALSPGATFGSTCKANAIANVIRNVWSN
AIIFCGHFPDGAEKFTKTDMVGETRGHWYLRQLLGSANIDAGQPMRFFSG
SLSHQIEHHLYPDLPSNRYPEIAVRVREICERYDLPYTSGPFLVQYGKTW
RTIAKLSLPDRFLRDTADDAPETRSERMFAELGPASTGADPVTGRRRGLK
TAISTVRGWRRDKPARLAA
333991603YP_004524217.1 3-phosphoshikimate 1-carboxyvinyltransferase [Mycobacterium sp. JDMMTTWPAPTTTTPVDATVTVPGSKSQTNRALVLAALAAARGGGVSTLSGAL
RSRDTDLMLDALRALGLRVEAVAHQVTVSGEIDPEPDTWLNCGLAGTVLR
FVPPLAALGTATVTFDGDEQARARPIAPLLDAMRGLGIAVDGDTLPFTIK
GTGSVTGGTVAIDASASSQFVSGLLLAAAAFDDGLTVVHTGASLPSAPHI
AMTVTMLRQAGIDVDDTTANRWRVSPATLQARHWEIEPDLSNATPFMAAA
VVTGGEVRIADWPALGVQPSDTIIDIIGRTGATVRHSDSQLQVQGPPSYA
GFDVDLRTVGELTPTVAVLAALAEPGSVSRLSGIAHLRGHETDRLAALTT
EINRLGGDAVETPDGLVITAAPLHGGTWCSYADHRMATAGAIIGLRVPDV
DVEDIETTGKTLPAFPRMWAEMLADSGSSA
333991601YP_004524215.1 PPE family protein [Mycobacterium sp. JDM601]MIDYGALPPEVNSARMYVGAGSGPLLAAAGAWDVLAQELSITAAAVHMTI
TDLTSGPWRGPSATAMAAAALPYTTWFQTTAAQAEQAALQAKAAAAAYEA
AFAMTVPPPAVLANRVQLMTLVATNFFGQNTPAIAATEAQYAAMWAQDAA
AMYAYAGGSAAATQLSEFTSPPQITNPAGPAEQAAATSNAAGNSAATQAL
NQSLAQAGTASGTPTTPGTPVPPGTAPPGEPVSPLTAFLQRFVDAMKPLD
SMRGNPLLPTRYMHPAGEVFKGWQHAGSGPAGVRTFLADSAKAAEEAAKS
AGSAATRTSGFTPAAPSAAVGRGIQLGGLSVPQSWPVAPSGANQAAATLV
SRMAVSGGAAASEAGAMPRGAGMGSMAGLAALPAAAAGAGGGPTGFRFVP
RYGYRHRVMNRPPSAG
333991599YP_004524213.1 PE-PGRS family protein [Mycobacterium sp. JDM601]MSFVTTQPEALLAAVANLRAIGSSLAAHSAAAASPTTGVVPAAADQVSAL
TAVQFANHGQSYQAVSTQAVAVHEMFVNALSNGANAYAATEAANAAAAG
333991597YP_004524211.1 methyltransferase [Mycobacterium sp. JDM601]MSSDAEFAGAVPSGPPEPWDIGRPQPVVQQLVAYGALRGEVLDPGTGPGH
HAIHYASQGYPTTGIDVAPAAIAGAQRNAAKAGVTVNFQVADAVELAGFD
GRFDTVVDSAFYHVFQDDEETQLRYARSLHRATKPQARLYMFEAGRHNVN
GWQLDGLSPERFGPLLAEAGWRIDHIGPTTYQGTFDPNSFTEMITVMEAL
GREDLLDGVRALAERFAYLQPLLEDNVVHMPFWAVTATRLD
333991595YP_004524209.1 PPE family protein [Mycobacterium sp. JDM601]MDFAFLPPEINSGRMYAGAGAGPLLAAASSWDALAAELNAAGLAYESVLT
ELSSGWAGPSAAAMASAAAPYAHWMRTAATQAEETAIQARAATAAYEAAF
AMTVPPPVIAANRSLLTTLVATNFLGQNTAAIAATEAHYGEMWAQDATAM
SGYAAGAASATRLDPFSQPPPTTNAAAGAAQAAGIGKAVGHATGIGKTVG
HATGIGKTVGHATGIGKSVGHATGLGKAVGQAAATAAEGQGEGLLAGIAP
ALPGSTLPTAAGSSTGATALAGIIGPLTAAAASSTPTIELVDAGLEVVVD
SIGTFGIDALGSFLIDPLGVAGIAEELFRAAMSGALPMTASMASAVSISG
LSVPLAWASAVPSVIGQAGVSLASAGSSAAPAIAGETAVPAVGMAAAGLA
GRASAGAAGGRRTPTTGATTLGPREQRPNELPELTPESAFGLLMGADIEL
RELAELRNAGVLTDEEYAAEKRALVGH
333991593YP_004524207.1 two-component regulator receiver domain-containing protein [MycobacMADSRSADRRGGIPSARGAETFSVGTPRVLVVEDSETIREMVSEALSDAG
YLTETQPDGRGLEEVLDGFRPDLVVLDVMLPGRDGFDLMEVILRWGEVGV
VLLTARDGLPDRLRGLDSGADDYVVKPFELAELVSRVGAVLRRRGRLPSA
VQFGDLMVDVDAGVASRSGTPLGLTATELRVLVYLVEQRGRIVSSAQILN
AVWGYEAYDPNLVQVHISGLRQKLETHGPRILHTVRGIGYRLQLSAS
333991591YP_004524205.1 hypothetical protein JDM601_2951 [Mycobacterium sp. JDM601]MLQEAMARRLHRRSEATGRIKLPAVPGMVDEYVRMCETMFAALGTPLDTQ
QRDHLQKVLQTEAEAAFSGSPRSYIIISYEVPVGSVLNYWVRAEWQSIEA
GYESWVALREPPLFGTEPDARVWALAGEATDPENCRVLDIGAGTGRNSLA
LARRGHPVDAVEMTPLFADGIRADAQRDGLGVRVIQRDVFTAGDELGSDY
QLIVLSEVTPDFRSTGQLRDMFELAARRLAPGGRLVFNVFLARDGYLPDA
AARELSQQCYNMFFTWDEMHGAAAGLGLQLVADDSVHDYEKTHLPEGAWP
PTGWYTEWTRGQDVFDVAPAACPIEMRWLVYRKPAQAGEATMAR
333991589YP_004524203.1 iron-regulated short-chain dehydrogenase/reductase [Mycobacterium sMANPAPLSGKTMFISGASRGIGLAIAKRAARDGANIALIAKTAEPHPKLS
GTVYTAATEIEEAGGQALPIVGDIRDGDSVTSAVAATVERFGGIDICVNN
ASAINLGSILEVPLKRFDLMNGIEVRGTYAVSQACIPHMIGRENPHILTL
SPPIRLEPKWLKPTAYMMAKFGMTLCALGIAEELRSHGIASNTLWPRTLI
ATAAVQNLLGGDEAMARARTPEVYADAAYAILTKPATEYTGNTVLCEDVL
VESGVTDLSVYDCVPGSDLGVDLWVDTVNPPGYVQQ
333991587YP_004524201.1 succinyl-CoA:3-ketoacid-coenzyme A transferase subunit alpha ScoA [MALNKVVESAAAAVADIPDGASLAVGGFGLAGIPWFLIEALLQQGATDLT
IVSNNCGVDGAGLGLLLDARRISRVIASYVGENKEFARQYLSGELTVELT
PQGTLAERMRAGGSGIGAFFTPTGVGTAVADGGLPWRYHPDGSVALASPP
KEVRNFRGTDMVLEEGIVTDYALVRAAVADRAGNCQFHAAARNFNPPAAM
SGQITIVEAERVVEVGELHPDAVHLPGIFVKRILELTAEQAARKDIEKRT
TRQQETIR
333991585YP_004524199.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MAIDYAQLPVEEAVRAARTDSRRRQILDAAVKVMQQTGFHQMSMQDLAAE
ANVSVGLIYKYFGGKEDLLLATIVRIQEAFVDQLAPVIAAAGTDPVAQLT
AGIRRYIEIVDENLDAVVLTYRESRTLNAAGRTQIKELEIASAAPLRTAI
EAGIAAGTFAEVNVDLMVFDIMLLAHGWALKHWHFGELYSLDDYIGLQTR
YALNSLLR
333991583YP_004524197.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MATDSSPAFDALDPLSLDSLLSDDEIAVRDTVAKFCAEHVLPHVGEWFEI
GDLPARELAREFGKLGLLGMHLHGYGCGGASAVHYGLACVELEAADSGIR
SLVSVQGSLAMFAIHHNGSEEQKQRWLPGMATGELIGCFGLTEPDVGSDP
AAMKTRARRDGSDWILNGRKMWITNGSIADVAVVWAATDDGIRGFVVPTD
SPGFTANTIHHKLSLRASITSELVLDDVRLPAEAMLPQARGVKGPLECLS
EARYGIVWGAMGAARSAWQAARDYATARTQFGKPIAGFQLTQAKLADTAV
ELHKGQLLSLHLGRLKDSVGLRPEQVSFGKLNNTREAIEICRTARTILGG
NGISLEYPVIRHMVNLESVLTYEGTPEMHQLVLGKAFTGLAAFN
333991581YP_004524195.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MDADDSAAQRPGDAAGADIVDGIRPLSQLSRDAILETAIEFIDRQGLSKL
TMRRLGTACGVEAMALYRYVHSRGDLLTGVVDHIVDRLYADQLAARRQED
GWQDYLMRLAHGVRQIALDHPEVFPLVATQAPEAPWVRPPLRSLRWMESF
LDTLISYGFDDGAAVDAYRSYTTFLIGHLLLEVSARGAELHPDEALLDEG
ERPARDLTSYPNLQRLQPMLSEDHSGIEFEEALEAMLDRLELLHSRV
333991579YP_004524193.1 hypothetical protein JDM601_2939 [Mycobacterium sp. JDM601]MTAVRRLLWPVALMVLLAGAIVLLAPVSVADGDGGSIGCGNAVAADFSAA
LDANAESVATAVIAGQGGPYTNYVAGCRSSLSARRAWALALVSIGAIAAA
VGFTT
333991577YP_004524191.1 RNA polymerase sigma-E factor SigH [Mycobacterium sp. JDM601]MATAIGLLEIASSAGPVVGTATEGTAAIEMADGESATETETTGPVRSDET
DEQLTARFERDAIPMLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRS
FRDGTNLKAWLYRILTNTYINSYRKKQRKPAEYPTDEITDWQLAATAEHS
STGLRSAEVEALESLPDTEIKDALQQLPEEFRMAVYYADVEGFPYKEIAE
IMDTPIGTVMSRLHRGRRQLRSLLADVARDRGFIRGGQSEEVSS
333991575YP_004524189.1 hypothetical protein JDM601_2935 [Mycobacterium sp. JDM601]MNRFANPRIRLPLICAGAMTLATLGFGVASAKAAPALVDDPMPIPAPIGA
PALPGPAVGGSSAGVNAANSFLQALNGMLNRVVPGVGSIMPSDVSSLTPP
GATVPGAPALETPPAPVAPVPQTLAGARTFH
333991573YP_004524187.1 sensor kinase from two-component regulatory system [Mycobacterium sMSTLGDLLAEHTVLPGNAVDHLHAVVGEWQLLADLSFADYLMWVRRDADA
GGALVCVAQCRPNTAPTVLLSDAVGTVAAADWMPLVAGAFESGAIARESI
AGQRNTEAVPVRHDDRVVAVLTHQTALRAGREFSRLEAAYLDCAADLVHM
LSEGTFPDVGDIAVSRSSPRVGDGFIRLGVDGTVSYASPNAVSAYHRMGL
AAELAGHDLVAVTRPLISDTFEAHELAEHIADSLAGGSSMRFEVDAAGAV
VLLRTLPLIVHGRPAGAAVLVRDVTEVKRRDRALLSKDATIREIHHRVKN
NLQTVAALLRLQARRTISTEGREALLESVRRVSSIAVVHEALSMSVDEVV
NLDEVIDRILPMMNDVASVEIPIHVARTGTLGALDADRATALTMVITELV
QNAIEHAFDADADRHDVTIRAERSARWLDVVVHDDGHGLPAGFSLETADR
LGLQIVNTLVSAELNGSLTARDAPGGGTEMVLRIPVGSRRTRQAL
333991571YP_004524185.1 hypothetical protein JDM601_2931 [Mycobacterium sp. JDM601]MRAVLIVNPNATSTTPAGRDLLAHALKSRLELSVVHTDYRGHAIEISQAA
ARDGIDLVIAHGGDGTVHGVVNGLLGTPGSAPPKNLPAVAVVPGGSANVF
ARSLGIAADPTIATNQLIGLLNGPGGQPSWRRIGLIDCGERWSVLNAGMG
VDGEVVAAVEAEREKGHAVTALRYVRAAVPAVLATTRRAPTLTLQLDGAA
PVAGVHLVFISNCAPWTYADERCVWTNPDTTFEGGMGVFATTSMKVLPTL
RLVRQMLSKRPKLRAKQLIRDDDVTALRVDAGDTPIATQIDGEYLGLRSA
MTFRAVPDALNVVAPPLKRAVDLHR
333991569YP_004524183.1 phosphoglycerate mutase Gpm2 [Mycobacterium sp. JDM601]MGIEEHRLLLLRHGETEWSKSGRHTGRTELELTETGRHEAVAARATLAKL
RLDNPFVVCSPRRRAQLTAELAGLHVDEVSDDLAEWDYGRYEGLTTAQIR
ESESDWLVWTHGSAGGESVAQVSDRADRAVAAALRLLVSRDVVFVGHGHF
SRAVIARWLELPLADGARFGMTAASLAVCGFEHGVRQLTALGLTGPKAAG
L
333991567YP_004524181.1 hypothetical protein JDM601_2927 [Mycobacterium sp. JDM601]MVRPERRTAGDVLAAAVIAVVVVVAGVIIWWTSDARATVSRPALDEATTP
QSAAMVPAALKQLWTAASPVTRAPVMVSGTVITGEGPQLTGRDPATGEER
WSYARDVDLCGVSWIYRYAVAVYPDSRGCGQVSTVTAATGRRGPARTSYA
DRSVNVTSEGSSVLSAGSTRLELWRSDMVRVLSYGEIDARVKPTARGRGQ
GCTLVSAAAASSAVSVLEACPGQDDLQLTLLRAGKEEDEPETQHVPQPGV
AADSGARVLTVTDADSGTNTAVYLPTPQPRVEVVDQTGTTIATTMLPAKP
SPASAALQVSRPTGLVCWWTGDAVMVFDSGTLTYRYTIPAAGAAVPLGPA
AMMADRLLIPVTGGVGVFNQRTGAAERVIPVSRPAGVRAVFPAVSGPMVL
EQRGDTVVALG
333991565YP_004524179.1 hypothetical protein JDM601_2925 [Mycobacterium sp. JDM601]MVMNSVPSTDAEAQSSPPRLSADHPGVNELFAVLAYGEVAAFYRLTDEAR
MAPDLRGRISMAAMAAAEMGHFELLRQALDARGVDVVEAMSKYATALDNY
HRLTMPSTWLEALVKTYVGDAMAADFYLQIANGLPDEVADVVRAVLAETK
HSQFVVDEVRGAVTASAKQRSRLALWSRRLLGEAITQAQYVLADHDELVD
LVVAGAAGLAHLAGFFDRIQHTHDERMRELGLA
333991563YP_004524177.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MSKPIDTAERGGGKSAGRGSGAAKAPAATSRRGSRLPRDERRGQLLIAAS
EVFVDRGYHAAGMDEIADRAGVSKPILYQHFASKLELYLAVLARHVENLV
SGVRQALRTTTDNRQRLRSAVQAFFDFIEHDGQGYRLIFENDNVAEPQVA
VQVRVATESCIDAIFDLVSHDSGLDPHRARMVAVGLVAISVDCARYWLDS
DRPISKEDAVEGTVAFAWGGLSHVPLTR
333991561YP_004524175.1 molybdenum cofactor biosynthesis protein MoeB1 [Mycobacterium sp. JMSRSLPPLVEPAGELTRDEVERYSRHLIIPDVGVQGQKRLKNARVLVIGA
GGLGAPTLLYLAAAGVGTIGIIDFDVVDESNLQRQVIHGVADVGRAKAES
ARDSINAINPLVDVRLHQFRLDASNAVQLFESYDLILDGTDNFATRYLVN
DAAALAHRPYVWGSIFRFEGQVSVFWEDAPDGRGLNYRDLYPEPPPPGMV
PSCAEGGVLGVLCASVGSVMGTEAIKLITGIGESLLGRLLIYDALEMSYR
TIRVRKDPSTPKITELIDYEAFCGVVSADAAEAAAGSTITPAELRELLDS
GQQLELIDVREPAEWEINHIEGARLVPQSMLNTGEGLATLPQDRIPVLYC
KTGVRSAAALATLKKAGFANAVHLQGGIVAWAKAMQPDMVMY
333991559YP_004524173.1 DNA-methyltransferase [Mycobacterium sp. JDM601]MATVTDEQVERVRALILGIPAGRVATYGDIASAAGLSSPRIVGWILRVDG
ADLPWHRVIRASGRPATQLRTEQLARLRAEGVTAVDGRVDLRAARHRF
333991557YP_004524171.1 ATP-dependent DNA helicase [Mycobacterium sp. JDM601]MTQHWEPYAGEVAAALDPLRRGVLQVRGGPGTGKTSLLLEVAAAHVAAGA
DADSLLLLTGSGRLPAAARGALTATLLAAGGPAATRAIREPLVRTVHGYA
FAVLQRAARRAEAAPPRLVTGAEQDSVIRELLAGDGARAWPSSLHAALGT
DGFATELRDLMARCAERGVDPAELVRLGKRYRRPEWTAAGRFARQYEQVM
LLRAAVGTAAPQATTPALGAAELVGAALEAFAADPGLLVEERSRLRLLLV
DDAQLLDPQAARLVRVLAAGVQRTVIAGDPDQAVFGFRGAEPAALLSDDP
TPGGAPTVHLTASHRCAPAVIRAVNTIAARLPGRSATRRLEAVGPDAGSV
TVRTAVSGHAEAALIADTLRRAHLVDGVPWSQMAVIVRSVPRAAARLPRT
LTAAGVPVALPIAGGLLAQQPAVAALLTVLQCAAEGVDGPRALALLTGPI
GRVDPISLRQLQRVLRRGAAADPESDPGDRLVAVLRGEAGQLPVAHARAL
RRVRAVLQAAARSHADGRDPHHTLWQAWNRSGLQQRWLSATQRGGPAGAQ
AGRDLDAVTALFDLTEHYVARTAGATLTGLIEHVTAMQLVMPRTEAAAGV
EAVEVLSAHAALGREWDLVVIAGVQEGLWPNTVPRGGVLGTQRLLDSLHG
LGDEVSARAPLLAEERRLLVAAMGRARHRLMITAVDGEGDGGATEEQLPS
EFHAELAACATPDGVPAPAPPVAAPPVLSAAGVVGRLRAAVCAPDGVVTD
SERADAATQLARLVRAGVPGADPADWHGTAPVSTEEPLWRTEGGQVVTLS
PSALQSLLDCPLRWLAERHGGTDGRDLRSTIGSLMHALVAESAVSREELL
AELDRAWRQLPFESPWHSANEQDRHRAMIETFLAWRAQTRDELTEVGTEI
AFDGVIDAGEGVRLRGRIDRIERDAAGRLVVVDVKTAKTPVSKDDAQQHA
QLAVYQLAVEAGLVGPDEQPGGARLVYPAKTAAGGATEREQDPLTPESGR
DWRERIAAAAAATAGPQFTARVNDGCRHCPIRPICPAHTGGSGA
333991555YP_004524169.1 transmembrane cation transporter [Mycobacterium sp. JDM601]MASARWRRLRGLDEPLTAQPSYALVGRMHMPQRQSSPGRTVYRRTAIAFA
ALLVSTLLVYLDRDGYQDVQGDRLSFLDCLYYSAVTLSTTGYGDITPVTE
FSRMINVLVITPLRIAFLILLVGTTVEAFTENSRQAFRIQRWRRRVKDHT
IVIGYGTKGKTAIAAMRGDDESPPKDIVVVDNDQAVLDQAEGKGLVTVRG
DGTKSDVLRLASAQRAAAIVVATGRDDTAALVTLTAREIAPEATIVAAIR
EAENQHLLEQSGANSVVVSSETAGRLLGIATTTPSVVEIIEDLLTPDAGY
AIAEREVEQQEVGGSAKHLNDIVLAVVRDGQLLRLDAPELDAVEAGDRLL
YVRTVNNP
333991553YP_004524167.1 glutaredoxin protein [Mycobacterium sp. JDM601]MYTTQWCGYCRQLKKALEKFEIGYDEINIEQDPTAAKFVESVNGGNRTVP
TLRFADGSTMTNPTGREVKAKLDRLSS
333991551YP_004524165.1 transcriptional regulator [Mycobacterium sp. JDM601]MPCNRDPDLWFADNPADLERAKVLCGDCPIRRQCLALALQRGEPWGVWGG
EILDRGTVIGRKRPRGRPRKQPLAA
333991549YP_004524163.1 hypothetical protein JDM601_2909 [Mycobacterium sp. JDM601]MTRVESQTHAYTLDPARPVLLRPDGAVQVGWDPGRAVLVQPPRGLTATGL
AAVLRTMQTPATAAELRLEAARHGTVDTAELDNLLSALVGAGVAVRDSAP
RRPRRTASLRVHGRGPLSDLLVESLRCSGAVVRRSSQPHAAVSTAGTDLV
VLSDYLVADPRLVRELHAERVAHLAVRVRDGTGVVGPLVLPGMTSCLGCA
DLHRRDRDASWPAVAAQLRDTVAHSDRATVLATVALALSQVDRVIAAVRG
PAAGSDLGPPPTLNATLEMDLATGSIMTRRWARHPLCGC
333991547YP_004524161.1 hypothetical protein JDM601_2907 [Mycobacterium sp. JDM601]MGAGFNIADLGQIFTQLGQMFSGAVSTSGRPSGPVNYDLARQVAARSIGS
VAPVTASTTTAIGDAVHLAETWLNGATSLPAGTTGSAAWTPVDWVEHTMA
TWQRLCDPMAEQVSSVWASALPEEAKSMAGPLLSVMSQMGGLAFGSQLGQ
ALGRLSGEVLTSTDIGLPLGPKGVAALLPGAIEELAGGLEQPRSEIVTFL
AAREAAHHRLFTHVPWLANQLLSAVEAYARGMKIDIRGIEELAQGFDPAA
MSDPSAMADLLNQGVFEPKSTPEQLAALERLETLLALIEGWVRTVVTAAL
GERIPGTAALSEMLRRRRATGGPAEQTFATLVGLELRPRKLSEAAVLWER
LTVAVGVDARDQVWQHPDLLPEAADLDDPAAFIDRIIGGDTSGIDSAIDQ
AIAEFQRDADASGDTDD
333991545YP_004524159.1 transmembrane protein [Mycobacterium sp. JDM601]MPKLTPRSRIMIGSALAVIVLLLVGPRLIDGYVDWLWFGELGYRSVFVTT
LLTRLIAFVVVGLVVGGIVFAALAMAFRVRPVFVPSNGANDPVARYRTAV
LSRLRLVAFGIPTGIGLLAGIVAQSYWVRIQLFLHGGDFGIADPQFGKDL
GFYAFDLPFYRLIIGLLLVTFFLAAIANLTTHYIFGGIRLSGRAGALSRP
ARIQVVSLIGTLVLLKAAAYWLDRYELLSHTRTGKPFTGAGYTDINAVLP
AKMILLAIALICAIAVFSAIVLRDLQIPAIGLVLLLLSSVVIGAGWPLLV
EQFSVKPNAAQKESEYISRSIAATRHAYGLTEDVVTYRNYSGDARATAAQ
VGADAATTSNIRLLDPTIVSPAFTQFQQGKNFYFFPDQLTIDRYRDSEGQ
LRDYVVAARELNPDRLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND
PNQNGGYPEFLANVVGANGTVVSAGPARLDQPRVYYGPVIADTVADYAIV
GRNGPDREYDYETNTETKNYTYTGEGGVNIGNWLARSVFAAKFAERNFLF
SSVIGAESKILFNRDPAGRVQAVAPWLTTDSTVYPAIVNKRLVWIIDGYT
TLDNYPYSELTSLSSATMDSKEVEFNRLLPDRRVSYIRNSVKATVDAYDG
TVNLYAQDEQDPVLQAWMKVFPGTVKPKAEISAELAEHLRYPEDLFKVQR
MLLAKYHVNDPITFFSTSDFWDVPLDPNPTASSFQPPYYIVAKNLVKEDG
SASYQLTSAMNRFKRDYLAAYISASSDPDTYGQITVLTIPGQVNGPKLAN
NAITTDTAVSQDLGVIGRDNQNRIRWGNLLTLPVAQGGLLYVEPVYASPG
SSDAASSYPRLIRVAMMYNDKIGYGPTVSDALTGLFGPGASAAATDIAPT
DGGAPAAKPEAPSPPAAAAVPTPPPPAGSVELSAAKAAALREIDAAIAAL
RDTQHKGDFAAYGAALQRLDDAVAKFNSTK
333991543YP_004524157.1 hypothetical protein JDM601_2903 [Mycobacterium sp. JDM601]MLWHVLADRRYLFVLPRAVCLLMLHPGIAAGITEHALMRDRIWLHKKRTV
TQAVNYVYTGVDLSPQMRFSHEHVKGVDSVGRKYHALNPDTFHFQHAAYV
ESLFVMVNTFIRPLDRDEHEQLYRECCVWYRRYGISSRSMPPNWPEFVEY
FENHCRTELFAGAHFEPYREQIFAPADWWMRAVPHRAIRALQHPHARELT
GVTVTAADRRSLWRFIQVARLSALAPRHHWNARARAALRSDREDGTRSPR
SASSRSM
333991541YP_004524155.1 hypothetical protein JDM601_2901 [Mycobacterium sp. JDM601]MMILVRLIDLVVSMLRILASPEARLLRAGVLTVLACGAPVGAVGLTWLLA
QLPQYFAHP
333991539YP_004524153.1 Mce associated membrane protein [Mycobacterium sp. JDM601]MPNAADPDVFDQLAEQVDDDTHAEANDDAADDQPATPAPARRHGRAAMLT
VALLIAALAYSGYTSWQLYQVHARAAAGEAALGAARDYAVTLTTLDTADI
DGNYARAIDGATGGFKEAYSLGAKQLRQILIDNKASGKGIVIDAAVKSAT
ATRVEVLLFVDQSITNAVRSEPRIDRNRIQMTMELVDGRWLASEVDLV
333991537YP_004524151.1 MCE family lipoprotein Mce6E [Mycobacterium sp. JDM601]MRRPTWWRRGARAALAIATALLTVGCGLDLQSVALPAPGGGGPYYTITAV
FSDALNLPEKAKVRLYGAQIGEVESIRAQDFSAYITMRIKSAVPLYAGST
AELRSATPLGDIFVQIWPDKDRPDDAPLLHNGAVLPLESTANAPTIEELI
SSMAMLVNGGTVRHLVSMLNGAGKAVGGRGEKLGLLLDQTATLLSRMSTR
SQQLDLALRRSSELAAAMSARQDTFDAALTQLAPALNVISDNTSDLIELV
DTGARITRQLSRFPSLQGTDTRSVSADINKLARVFNDIAVDPELSLMSFN
RFLGILMKTFNGPAAHVKGEINKITLAPWPDKNYPGDPEFHWTDGTDWHL
MIGDLRYEWNMLLSRIYGPQR
333991535YP_004524149.1 MCE-family protein Mce6C [Mycobacterium sp. JDM601]MSLIPVALKRPIESFSRPWMGVFAIVVIAAVLMATDVYSGLGIGKTRYDG
EFAQAAQIRPGAVVTIAGIKVGTVERVKLAGDHVVVGFNVERGIPLGADT
RAAIKLTTILGSRYLELSPAGTGQLENRTISLAHNEVPYDLQRTLAGATR
TLGPVDANRFVDSLNMLNANLGGVAEELPQALTNLQAMADIIADRREQLG
TLLTNTETLTTMLRDQRANLGALVLQGRDVLREIATRRAAVQQLFASATL
LVDRAHGILGDETAVNQMIRDFSEFMQMTADHDALLRSFLQSTPVALRNF
ANATGSGNAADVFLPAGIFVDSWMCALSGRARQFNLVEYFKDCQ
333991533YP_004524147.1 Mce protein Mce5A [Mycobacterium sp. JDM601]MPNSFDTDPRGPSNLRVFALGVVFITVAVATATLMVAKSQGKLDNLVRID
VRLSNIGDGLPPRSDVKYHELLVGSVADITPSTHGLPNEVHVVLKPEHAA
KIPNTVTARVVPANLFAVSAIQLVDNGTGSDHLRSGSVVFEDESLPTVLF
QNVLNKLRQLVSPLGRKPDDTTVGVIAALGTATHGRGEELTDTGHNLNEI
LAQLNSVVATDDTDPTTLSALAAAAEGLHRVSPELFDALDRSIRPMTTIA
EKGPQLSSLLTGGHDTATTLAAALENQADRMITITTALTPPLGVIADHAD
EFHGVSTKLQNLANRVYDVIWDPEDNLLRVKAAIALTPSRTYVRADCPRY
GELAGPSCATAPEVPTAPDLFPALESQGVSPAPGMTENRPNITPPRHSMP
GDPQGPPIPPPLGPPAPAPAEVPAAPRGAVIGGNVGLVGSAEEKQQISRI
TGRADTPTVLLLAPLLRGSTVQLSQTTEGGR
333991531YP_004524145.1 hypothetical protein JDM601_2891 [Mycobacterium sp. JDM601]MIPMTASDSTRRLIRIADAQLAGRPGLRAVVDWLLQYVKNHPIASLGTGG
SQVVLGVRAIQYLFVDLFTGRFLVGEFIDQTAFVAGAAFLPTVFVTIPVG
VTLSIQFSVLAGQVGASSLAGAATGLVIIRQAAPLVAAMLLAVAVGSAVC
ADLGSRTMREEIQAMEVMGVSPVRRLVVPRLAALMTVGVLLTGITFFVGY
VAGYIFNVFLQNGTAGSFIATFSSFSDVGDMWLAFAKSIVFGIIVAIVSC
QKGLASHGGPAGVANSVNAAVVESILLLMFVNVLMSQLYVILFPRQAL
333991529YP_004524143.1 hypothetical protein JDM601_2889 [Mycobacterium sp. JDM601]MGRYELTYLLDTHTLLWALTDPKRLGPRARAVIEDRSDRLLTSAASAWEL
ATKSRLGKLPQADALLGAYTRYLDRLGVVRLPIDDEHALLAGRLEWDHRD
PFDRMLAAQAMVESLVIVTADAAFAGCRGVQTLW
333991527YP_004524141.1 Short-chain fatty acids transporter [Mycobacterium sp. JDM601]MQSLTGLSVRYVERLMPDPYLFAVILTLIVAGLVAVLVRGASADGMVTAW
YSGVWGPENIFTFAFQMVLILVTGYTLAEAPVLKRATVRIAATPRNQTQG
ALLCFTVSAVLSLLNWGLGLVAGALVARQVARRFPDSHFGYLIAAAFMGF
IVWTQGLSSSIALANTDPGSPINVIHKTVGFSVPLRHTIFQPYSWLSVLI
VLAVLALAVWRMEPSVGLAPDAAVFDDDDPLVESPASRTFAEWLENQWIL
NVLVFAAGMTYFVMSGFALNIASMIMLFTITAALLHGTPIRFIRAFTAAA
KVSGPLLLQYPLYGGLIGLLAYQGAEGATPLQTVLAQLLVNGATQYTLPF
LTFLGSVIISLFVPSGGGHWAVQGPIAVDSALAIGQHSPGYLGLISMAVA
VGEGVANMIQPFWLLPLLAIAKLNVRQVMGFTVVAFVIGLAVMGAMTLVA
PWLV
333991525YP_004524139.1 monooxygenase [Mycobacterium sp. JDM601]MRAKYALERDKRMRPDAVNQFIEVTADFSHYADDPWTERVERDPVRDHVQ
VAIIGAGLGSLIAAARLQEAGIDEIRMVDTAGDFGGTWYWNRYPGVQCDV
ESYIYLPLLEELNYVPTERYAHGPEIRGHLQNIAKHYGLYENALLGTTVT
GLRWNETARNWQITTDRGDAFTATLVAVSPGSLTRPKLPGIAGINEFRGH
TFHTSRWDFGYTGGDESGGLTKLTDKRVGVIGTGSTGLQCIPHLGEWVQQ
LYVFQRTPSTVSVRGNRPTDPQWAAGLKPGWQRERMENFTRVTCGVEMDL
DLTDDGWTQKALELSESAVVRETQRLGREMTPQEVADFLFRADYEAMERL
RKRIDDTVHDRTTAEALKPWYRLNCKRPGYHDQYLDTFNRDNVTLVDTDG
RGVERFTETAVVVDGIEYELDALVFATGFEVGTEFTRRLGFEIVGRDEVR
LSDKWAKGMRTLHGLQTHGFPNCFFLGYTQSGVSPNYTHTAEERARHFAY
LVDTFVRRGANTIEATRAAEDQWLAAMEAASEKPKAFYAECTPSYLSSEG
DKENPHGMLSTNFGGRPVDFFDMLEKWRATGQLEGVVLE
333991523YP_004524137.1 NADPH quinone oxidoreductase FadB4 [Mycobacterium sp. JDM601]MRAVQISQLDGPAAARVVDLDEPSGDDLVIIDVHAAGVAFPDVLQSRGLY
QHKPELPFVPGGEAAGVVRSAPAGAHVRAGDRVAALTMLNGAMAQVIALP
AEQVFKLPDVVSFEAGAGLLFNDLTVLFALTTRGKLSQGATVLVHGAAGG
IGTSTLRLAEPLGASRVIAVVSTEAKAEVARAAGATDTVLADGFRGAVSE
LTGGKGVDLILDPVGGDRFTDSLRSLAPGGKLLVVGFTGGEIPTVKVNRL
LLNNIDVVGVGWGAWVMSHPGELQRQWDTLEQLLASGTVSAPQPEVFALE
DAADALAALEHRTAAGKVVLRLRG
333991521YP_004524135.1 oxidoreductase [Mycobacterium sp. JDM601]MKVLTALSGLTGVADQARELRDAGVSGVFTFEGPHDVFAPLTLAAGVGGL
DLMTNVAIAFPRNPIHLAHQANDHQLLSGGRFVLGLGTQVRAQIEKRFGA
AFDRPVDRMVELVGALRAIFESWNTGARLDFRGHYYRHTLMTPTFSPGPN
PYGAPPIYVGALGPRLTRAAAEHADGLLVMPFSTKRFLHQNTMAAVRDGL
AHAGRAREDFAVVPEIIVATGATDAERETAEAATRMLLGFYASTPAYAPV
LAAHGWEALQPELNALSKQGQWAQLGAAITDEILHTIAACGTPAQVAARI
RDRVDGIAQTVCVYQAAPIAPAVVGAIVSELS
333991519YP_004524133.1 hypothetical protein JDM601_2879 [Mycobacterium sp. JDM601]MADQPTVERDVGRIQRSSRDVTTLPTVMSRWLATQLPDGATPEITVESGV
DTNGMSSETIMLTGRWAQQGAPLEQRWVMRVAPSDEDVPVFPAYRLDHQF
EVMRRVGELTDVPVPKVRWIEATGEVLGRPFFLMDRVDGEVPPDVMPYTF
GGNWFADATTEQQRTLQDTTVEVLAKLHAIPDATGQFGFLDEDDDGSTDD
TALRRHFDRVRQWYEFAVPDIGRSALLDRTIGWLEAHWPADVAAGETVLC
WGDSRVGNVLYRDFRPVAVLDWEMVALGPRELDVSWVIFAHRVFEELAGL
AGLPGLPQVLREDDVRASYQRLTGVELGDLHWFYVYAGLMWAIVFMRTGA
RRVHFGEMERPDDPESLFYHAGLLKKLIGEQN
333991517YP_004524131.1 GlcNAc-PI de-N-acetylase [Mycobacterium sp. JDM601]MSGFPEPLPFPADWTSLLVLVPHPDDPEYGMAAAVAKWTAAGKTVRYALA
CRGEAGIEGMPPQQAGPLREAEQRRAAAIVGVHPDEGVDFWDFPDSDIRN
TPELRAKIAAVITEVRPEVVVSIYGGAQFGPDAPNQRDHIEFAAAVTDVW
DTLDKPPRWLFQNGPEPTHVEAVDGYLDAAIDALAAHEVYLSVLDPDTPV
REQARAVIDMTTPAQHGARVAGFSLQRTTAA
333991515YP_004524129.1 oxidoreductase [Mycobacterium sp. JDM601]MDDESFQRLVAMLDYTMFVVTTAADGHASGCLVGFATQTSLAPPRFLVGV
SERNHTFGVAARSDHLAVHVLSRGDIELARLFGGRTGDDIDKFEHCSWHS
GPAGMPILDDAPAWFVGKTLSRIELGDHLGYLLEPIAGYAPPHTGGLLAF
SDVDDIEAGHDA
333991513YP_004524127.1 flavodoxin oxidoreductase [Mycobacterium sp. JDM601]MSRQVSKRRALVSSLAEVLTWPHRIDRYTELVTPTWSPGEARAKVIAVHR
STPRSVTMTLQPNTAFPGFRAGQHLNLTVDIDGRRHTRCYSPANAEGQRL
IELTVGLHDGGLVSSYLRDHARPGLVVGLTGGSGDFVLPAVRPQRILLIS
GGSGITPVMSMLRTLLAEGHVAAGGEISFVHYARTCAEACYRDELAAMPG
VRVLHGFTRAHEPNAPGDLTGHFGADHLNAAMPAPDLVYVCGPPALVAAV
REHCADAIAENFVPPRFAPAADPAGGRVTFLGSNVTVVDDGRPLLLQAES
AGLQPASGCRMGLCKTCTCRKTVGTVKNRITGMLSDAADEDIQICVSIPV
GDVELAL
333991511YP_004524125.1 NADH dehydrogenase I subunit M [Mycobacterium sp. JDM601]MGAGAVIVLPAGAARLAKLTGLLVSLVTLAIAVVITVEFDTTPVAAPYQF
VESHAWIPAFGARYTLGVDGIAVVLALLTAGLVPLLMLAGWNDGEGKRRR
GPHAFAALTLAVEAMVLISLVSLDVLLFYVFFEAMLIPMYFMIGGFGNGA
KRSQAALKFLLYNLFGGLIMLAAVIGVYMVSAREGTSGGTFDFRELVSLF
SSATTTVDPGVLKLLFAGFMFAFAVKAPLWPLHRWLPDAAVESTPATAVL
MMAVMDKVGTFGMLRYCLQLFPDASTYFRPAIIVLAVIGVVYGAMVAIGQ
RDIMRLIAYTSISHFGFIILGIFVMTSQGQSGSTLYMLNHGLSTAALFLI
AGFLISRRGGTRAIADYGGVQKVAPVMAGTFMVAAMATLSLPGLAPFISE
FLVLVGTFNRYWLAAAVGSTALVLSSIYMLWLYQRVMTGPVTAGNERIRD
LVPRELVVVAPLIALLVFLGFYPKPVLDIINPGVAHTLTTIGETDPAPLT
AEGAH
333991509YP_004524123.1 NADH dehydrogenase I subunit K [Mycobacterium sp. JDM601]MNPENYLYLSAMLFTLGATGVMLRRNALVMFMCVELMLNAANLAFVTFAR
LHSALDGQMVAFFTMVVAACEVVIGLAIIMTIFRARRSVSVDDANLLRG
333991507YP_004524121.1 NADH dehydrogenase I subunit I [Mycobacterium sp. JDM601]MAKLRDALAGFGVTWRTMFRRPINDGYPEQKKPTARRYHGRHQLNRHPDG
LEKCIGCELCAWACPADAIYVEAADNTDDERFSPGERYGRVYQINYLRCI
GCGLCIEACPTRALTMTNDYEMAADNRADLILERHQLLAPLEPDMTAPPH
PMPPGATEKDYYLGRVGPDGLDENPDLFVMLDRKKQGKA
333991505YP_004524119.1 NADH dehydrogenase I subunit G [Mycobacterium sp. JDM601]MTFTIDDQQVTVPKGTLIIRAAEQLGIEIPRFCDHPLLDPVAWCRQCMVE
VEGQRKPQPSCAVAAAEGMVVRTQHTSAEADRAQHLVMELLLINHPLDCP
TCDKGGECPLQNQAMTHGRTETRFEEAKRTYPKPINISSQVLLDRDRCIL
CARCTRFADEIAGDKFIEMMDRGALQQVAIYTETPFDSYFSGNTVQICPV
GALTGASYRFRARPFDLVSSPSVCEHCASGCAQRTDHRRGKVMRRMAGDD
PDVNEEWNCDKGRWAFTYAVQPDRISTPLVRDDRGELVPTSWPHALAVAA
RGLAAARERTGVLVGGRVTAEDAYGYAKFTRVALRGDDIDFRARTLSAEE
AAFLAARVAGSGIGVSYADLETAATVLLVGLEPEEESPIIFLRLRKAARK
KGAGVFAVAPFADRALTKMFGTLLPTAPGGEAAALDGILDGSSHAELNEK
LRQPGAVVLVGERLAGSPGALSAAVRLAEATGARLAWVPRRAGERGALDS
GALAGLLPGGRPLGDASARAEVARAWGLDGPDELPSQPGRDTDAILAAAA
DGTLGALLVGGIEPGDLADPAAAVAALDSVGFLVSIELRRSEVTERADVV
LPIAAAVEKTGTYLNWEGRPRRFGAALDERGTLSDVRVLDALAEEMGVDL
GLPTVAAAREELTRLGAWNGERVASPDVAAGRPGQPGSGEAVLASWRMLL
DNGLMQAGEPNLASTARKPVARLSAPTATEIGVAAGDQITVGTEHGEVAL
PLVITEMPDRVVWLPMNSSDSAVHRNLGVGPGAVVRIGRRS
333991503YP_004524117.1 NADH dehydrogenase I subunit E [Mycobacterium sp. JDM601]MSETGGLERKEVNKTGRGRLMPATAGTDGNRVFLQLGRPPEEPNQFNHPD
APRSYSDEVRARLEADAKEIIGRYPQPRSAILPLLHLVQAEDSYITPAGL
SFVADVLGLTGADVAGVASFYSMYRRKPTGEYLVGVCTNTLCAVMGGDAI
FDALKEHLDVNDTQTTADGKVTLERIECNAACDCAPVVMVNWEFFDQQTP
ESARDLTDALRSGGEVRPSRGLPLTSFRETARVLAGFADDRPDDGQGGPA
GPTLAGLRFAHEHGMAAPESDTDGSGQ
333991501YP_004524115.1 NADH dehydrogenase I subunit C [Mycobacterium sp. JDM601]MSQGTADGEGPADSEDVIKVRRGLFGAAGTGDTSGYGRLVNKAALPGETP
RPYGGYFDEVVDTLTAVLQREGIEFADAVEKVVVYRGELTLYVHRAQLPA
VAQLLRDEPDLRFELSLGVSGVHYPADTDRELHAVYPLRSITHGRRIRLE
VAAPDADPHIPSLYGIYPTTDWHERETYDFFGIIFDGHPALTRIEMPDDW
HGHPQRKDYPLGGIPVEYKGAQIPPPDQRRAYN
333991499YP_004524113.1 NADH dehydrogenase I subunit A [Mycobacterium sp. JDM601]MNQYLPILALAALAAGFAVFSVVAGALAGPSRYNRSKLEAYECGIEPTDQ
PVSGPHAPPGQRFPVKYYLTAMLFIVFDIEIVFLYPWAVAFDGLGVFALI
EMLLFAAVVFVAYAYVWRRGGLNWD
333991497YP_004524111.1 aminoglycoside phosphotransferase [Mycobacterium sp. JDM601]MTADQLADRLSAVLAPVLGPVTVEGLRALTGGASRVTWAFDAVGGSGRRA
LILRTGPPDEVHASMELEAHAQRAARTAGAPVPTVLIADNSPAALGNPFL
ICDEIAGETVVRRIERQLDDPGRDALLRQCAQALAAIHRADPGDMALSDE
DQLAACRAQLDAMHDTTAVFEWAFRWLAAHRPPPAQAQLVHGDFRMGNLI
VDGADLAAVLDWELVHLGDGCEDLAWFCQRAWRFGAPPERAAGGLGGIEE
FLTAYQHASGTVVDRRRFDWWLVLGTLRWGIICRYQAERHLSGQTRSVEL
ATIGRRVSETEWDLLRLLARAPADTRPSAPEEQAGPLTPGATGRRPTAAE
LVTAVAEFLDAAFLNRGGRGPTDGQVNFHARVAANALRIVERELRDTAAG
AATHALSGLGFTDEAGLAAAIRAGDLDDRFDAVEACLYTLVRHRLSIDHP
GYDR
333991495YP_004524109.1 transcriptional regulator [Mycobacterium sp. JDM601]MSSQRELSSKGRQTRQAIEQAARELFAERGFHGTTLADITSAAGKSTAVL
YRYFQDKEDLLAALAESFLSDVVEPSRLKMRLPDSPQDTEFFTSVVGAYW
SMFKQNIGIMIAVAQLAATSQRFAVLQNEFRRFGMEIVAASVRRAQQQGH
GLDLDPDHIAAAIALLFENFTVVFVGPSGPGWRISDSDAIATLSTIWRKT
LYGR
333991493YP_004524107.1 hypothetical protein JDM601_2853 [Mycobacterium sp. JDM601]MTTPAGALDGIRVIELGTLISGPFAGRLLGDMGAEVIKVELPGKPDPLRT
WGQAELDGRHFFWTVHARNKKAVTLDLRTDRGRELFLELIDNADIVVENF
RPGTLERWGLGFDVLRQRNNGIILVRVSGYGQTGPDAHKAGYASVAEAAS
GLRHMNGFPGGPPPRLALSLGDSLAGMFAAQGALAALYRRTVTGEGQVVD
VALTESCLAIQESTIPDYDVGGVVRGPSGTRLEGIAPSNIYQSADGSWVV
IAANQDSVFARLCQAMGRSELATDPRFADHVARGRNQDELDAIIGEWAAQ
RKPDDIIATLSDAGVISGPINTVAEVVNDPQLRARGMLAEHWDEGAERTV
LGPGIVPVLSDTPGRIRTAGSARPGQHNDEVYGELLGKTAAELDALRAEG
VL
333991491YP_004524105.1 oxidoreductase [Mycobacterium sp. JDM601]MRGLPMESFVHLRKGVTPKRVHADLDGLKDDELGRGGFTGRTANMYRRHD
PTAYRAEGPLRPVDVLAPQLEPADATDPAGHPLRLFHNDDCAISLSRRPA
EMPFHVRYVDGDLLCFVHAGSGRLETEFGPLDYRDGDWVYLPKATTWRQV
PAAETTLLMIQATDEFRVPPPGPLGRHFPFDPSQAIIPEPAPIDPDPFRD
GRDEYEVRLIHEGGPTTLYYQHNPIDVEGWRGDNFAFTFNIADYNVVTSD
SLHLPPTVHLFMQATGVYVMNFLPKPAEGVPGTERTPWYHRNVDYDEIAF
FHGGSLYGIPMPPGLISHAPQGVHHGAPEKARERARRKFDDYQRVDWQVI
AIDTRRRLTPSPQVLAADLGQHA
333991489YP_004524103.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MTDTASAAPGSKSKRSGRSSAIGLDKPKRTPIAAALALVTPLVSQSFLDR
HNLRDPLNRSLNYGVKAVFSTAGAATRQFKAVQNLGKSPVRLKASGADYF
DLTPDDEQQMIVDTVGEFAAEILRPAAHDADEAVDYPRELIGKAAELGIT
AINIPEDFDGIAAHRSAVTNVLVAEALAYGDMGLALPILAPGGVAAALTH
WGSASQQATYLPEFAGENVPQACVAIAEPQPLFDPTALKTTAVRTPSGYR
LDGVKSLVPAAANAELFIIGAQLNGKPALFLVESSANGLSVKPDPSMGVR
AAALGQIELKNVSVPLSARLGEDEASDQDYSEAIALSRLGWAALAVGTSH
AVLDYVMPYIKEREAFGEPIARRQSVAFMCANIAIELDGLRLITWRGAAR
AEQGLPFIREAALAKRIAADKGMQIGSDGVQLLGGHGYTKEHPVERWYRD
LRALGVAEGVLVI
333991487YP_004524101.1 hypothetical protein JDM601_2847 [Mycobacterium sp. JDM601]MWEIWALLLLLAILAVFVAPRFFRPGPGSEAQQGTLLITGVSPRPDAVGM
QYVTITGVITGPTVAEHEVYQRRAVDVDNWPTVGELLPVVYSPRNPDNWN
LTEPAS
333991485YP_004524099.1 peptide chain release factor 2 [Mycobacterium sp. JDM601]MEPDRQPDIAALEATLTTVERVLDVDGLRSRIDKLEHEASDPNLWDDQTR
AQRVTSELSHAQGELRRVEGLRSRLDDLPVLYELAAEEEGQAAADAQAEA
DAELVSLRADIEAMEVRTLLSGEYDEREALVTIRSGAGGVDAADWAEMLM
RMYIRWAEQHNYGVEVFDTSYAEEAGIKSATFAVHAPFAYGTLSVEQGTH
RLVRISPFDNQSRRQTSFAEVEVLPVVETTDHIDIPEGDVRVDVYRSSGP
GGQSVNTTDSAVRLTHVPTGIVVTCQNEKSQLQNKVAAMRVLQAKLLERK
RSEERAEMDALKGDGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPAAVL
DGDIDGFLEAGIRWRNSPDGD
333991483YP_004524097.1 hypothetical protein JDM601_2843 [Mycobacterium sp. JDM601]MTARQSEPQAAQPDGRRWRWPAQLFNGRVRTSTVLLIIAFVAVWWVYDTY
RPQPTPPAAPQVVPPGFIPDPAYTWVPRTRVQQPTTTVSETPAPTTETPN
PTEPPGEPPTPTPEPGFPFCPPLCPPPAPTPPEPPGQSPPPGSPPAPVTP
GVPTPSASPGPATSQPAAP
333991481YP_004524095.1 cell division protein FtsX [Mycobacterium sp. JDM601]MRFGFLFNEVLTGLRRNVTMTVAMILTTAISIGLFGGGLLVVRLADQSRN
IYLDRVESQVFLNADVAADDPNCEAQACKALRERIENRDDVKSVRYLNSD
DAYADAIRKFPEFKDVASKDSFPASFIVKLENPEQSTDFDAAMTDQPGVL
SVLNQKKLIDRLFAVLDGLSSVAFAIALVQAVGAVLLIANMVQVAAYTRR
TEVSIMRLVGASRWYTQLPFLLEAVLAATVGVIIAVVGLIVVRALFLDNA
LSQFYQAHLIARIDYADILYISPILLLLGAAMAGATAYVTLRLYVRR
333991479YP_004524093.1 hypothetical protein JDM601_2839 [Mycobacterium sp. JDM601]MGDFVGGLASRRVSPLRVLLVSTPLALVGLTATAVVTGGPIHPGAVGWGA
ACGLALGVASWWFYAALRSGPISVVSPLSAVVTAGVPVTAGLIRGERPGL
VASVGIVLALVAVVLVSREVTDEDVRPHRFTPKVAWLTIGAGVGFGLNFV
FIEKAPVESVLWPLMFARLAATVVVIIIAAAAGDLRLPSGTPMKLSLTAG
MMDVGANVAMLLALRNSSLSLGGMLISLFPVVTVLLAIAVLRERVHPWQV
VGMVAAVVSVAMITAG
333991477YP_004524091.1 hypothetical protein JDM601_2837 [Mycobacterium sp. JDM601]MAQGILLTDDEVVALAALLGRPWPTGLATVATTAQELSQAGKRGVRSLII
RGIVTADAESGYTTHPGVSAVIETFVNASQRIGGYIARSAALETMAGASL
TAVPVAGIWWIDAATAQGVHGFRQAEAEEVLAAITELADHTRDGTLLSGV
DDAAEYAFVIVYGDGPEQRIVVPANSSDGTAWDRGPLQQAFAAAAV
333991475YP_004524089.1 hypothetical protein JDM601_2835 [Mycobacterium sp. JDM601]MLTDSGGLTVSMAHLNMEELIRIADVPRSSVYRAWRTKEAFYVELMERMA
TPGPEGSYAEEVVRVARAVLEQHRELLGTPQGRRTVLAELIRCTVTHSFH
GAARSLAWRSFTALALAVPTFDEGDQERILAALARSHARVIDRVAEVYAE
ALPKLGMRVKAGFDIRTCIATGSSAMDGLIRLSLTDPDTVASRTVRAGPN
GEPVEWELPAVAFMAILDAMVEPDPEFCE
333991473YP_004524087.1 hypothetical protein JDM601_2833 [Mycobacterium sp. JDM601]MTETSQQSEALRPSRIYAAAAAVLLILGLLLPWNVHVGAGIAETRGWVFA
IMVIATVPCLAALFVVESVPRWALTVPYLILVGVFTVFAIVISVRYGGTG
MVAPGVGPGAWSGLAGALLAAQPRTATCDQQRVDRTCRLIGWSSIVLAVL
ATLFNLYFRTRFVIPGIGGDAGIQNLATAVAALLYGVVALAPALVAGRWV
MSGRPGPRLAAVLLGGAAVVAGALVWFLPAGRLLDAFHGIAQNTGTVSVG
YEGYLAWIAVAAIIGTPVLRSARAAGSAELWRYATRCCLALITVWCGGKA
VLRITDVWLAGVLSLPTPPYNTTMLMAFDLLTAVLALWLFVNSRNRSASR
TVTVVVLGILVVLTVCRLILGVALVPRIDPLNPGTVNPVFGNHLVQQITS
TFDVTLSFVALLLLTGAVGFGARTSTKAVSAQPVPRPAAADTPTPAAAAR
IAAPNPVEAQPAAAPDRVTDVLAQSTQRFAAGTTYGGGPSTVGESESGS
333991471YP_004524085.1 hypothetical protein JDM601_2831 [Mycobacterium sp. JDM601]MTGSEHRRRGLGCDDAYSYGIFGDFLVAAVADGAGSVTGTSAWGAFVACR
GILKDAMDPDFVDRYRTGSTDDAQQLMRSLFARALQRVHRQAAAMGMDVM
LLSTTLCVGLADRNLATFAQIGDGIIATERDDEIATMLIERKDEYANTTS
FLQSERALDDSLRTACCAGVTAFALSTDGMSYKITDVATGDAYQPFFRGS
WQHLRSGAEPQRFEAMLDNIEDDQTGDDKTMVLAALGQLSSGTPAETMRW
AHSGPPGAGTDSGGSVPSAAIDDLGEAAEPAPVGAHNWWGRWRK
333991469YP_004524083.1 von Willebrand factor A [Mycobacterium sp. JDM601]MPVPTVLVVDGSGSMNIADAPGPRIDAAKAASLSLVDDLPDGVRLGLMTY
GTSTGSAPSDKAAGCRDVTVLVPLERLDRSRVKDAIAGIVASGYTPLSLA
MQQAVNQLPADDSAQAVVLVSDGEDTCDVPPCATAKQLKAQRPGLTISTV
GFRLDGGAAEQLGCIAQVTGGLFVTADNTEQLAARLKATQDLNRAQSALT
ASGLAGIELGQRIGDIRSAKTDFPSAPSAGTTTVTWRDCDWTFVDGVLTE
IVPHDGGHTIDGVGPGTPLSRVAELYGKPITVETDGRGGYRLTYRAADNS
DAAYRMIVEGYNDTGGTISGTVKTIVLCTCAGPGAPAAPIRPAAVNEQVI
AAMTFPVGTCGDGSGGWQNTVPITVVDGRGEARDANGDFAGASIRDVELI
GWLDADADGTQDVVVSFVCFGSPFAMCCAGRASMMEFVGVYDFTDSAAPR
PIGKTIMPGISPVRGKSYGEPRRIEAVRLSGSTIITDEKLIYADTSGATA
DLGYPPDATVEVTHVFTDGQWTATERVRGR
333991467YP_004524081.1 hypothetical protein JDM601_2827 [Mycobacterium sp. JDM601]MDLADVDCTGYGARTEEVGASDTGSGVVAVESAAVSIRDIPG
333991465YP_004524079.1 hypothetical protein JDM601_2825 [Mycobacterium sp. JDM601]MNPQDDPRYDPPATATPMVSKIDSKALTVAAIAMGITFALWAVKGALTGS
TGWLIVLLMLAAGVGYVFYRRNPQQVRAFEARVAQLRQNATGVKVADNPG
AAPPFANPASGVPACPPPQPPAQFSGVGTVPSSPGTGAAVSAALLIPSLI
AYGWVYTSTSFTYAWQPWWVLTGLNLYFVCCVAARAHTGRRFLATLLGLA
GTGLSALANNPSGDVSLTSMFSSKEYYDGVAYPVLPPPDVLVWISRVPML
AILLFVASWGIARRQRPGWVLGLIPAGLLVWWAIYGAEHSSGWRASWQGG
WFQPWVITVGTFVGGCLCCWLAELLTTGGAANAAAQRYAPPVWNGPQGPP
ETPAGPPIRTQPPAHADYRAQAARHFQGHPANPYEPPR
333991463YP_004524077.1 hypothetical protein JDM601_2823 [Mycobacterium sp. JDM601]MTGRFNPPPGWPVAPGWLPPPDWQPDPSWPAAPADWVFWVDEEAGEPATA
GSAGKHPTQPGSPSAPVSRNLPLILGIVGVVVLIVLAGGVATFLPGRGNT
ASHSGGPVDQWTEVSKTLPSTPVDLPAGAGTRVVVNVDGAASHMNVTSIE
KWASDVTKHDEEALVQKCWTYPRSYIQDRYLADTARVADLMGRSPQMAQA
GPMWKTGQSGDSSLVAWAEAKSDYACPEIVFAEDGRVRDDVILYRARRYI
LREQNNPVNHNDTARNYPLACEFVTGTISNIHRANPDDMAMVSSNSSGWV
VRAGDVEITMHQEPGITCIESAR
333991461YP_004524075.1 von Willebrand factor A [Mycobacterium sp. JDM601]MPTVLILDASGSMNETDAPGPRIDAAKRAAQGLVDGMPDSTSTALVAYGT
STGSADAEKAAGCQDVKVLIPMGSLDRQQMAAQISGLSASGYTPISLALR
TAVSQLPAGDDPQAIILVSDGEDTCGTPPCDTAREAEHKYPNIAISTVGF
KTQGNASEQLRCIAEATGGLFVTAQNASQLAARLLATQNVQEAQNSLSSN
GIGDIAIGSSLVDIRKAHPDFPDASASGSVVVVYRDCDFGFVDGVLDSIT
QHNGGRTIDGVTPGTPISRVIELYGNAVKTETDGHGGYRLTFTADPAAGA
SYRILVDDYAESGGTVTGQVKTIMLCRCAGTGASAGVPNAVITFPDNGVD
LFTQSGLRCQVNVPNAVSGFAPPNVICESGAGWGPSKYNGVVTTKTGDWS
WAEGNLGKIIDKVSIEPGRTYRVDGWTVVADGDGARFTYDDTGSGIFVSI
ADVHPVHR
333991459YP_004524073.1 DNA translocase FtsK [Mycobacterium sp. JDM601]MQAKFILRRPNGSRAQVAITADATASVADLAQALVLSDPEQRQHPDGGGL
TLKLEQAASVRGTAGRLLDPSRSLIDSGLHSGSTISVAPAAALPPKRRQG
RTIAVLRVLDGPNAGMEFPLPAGNSTIGSGPSNDVVLNDPGILDVHAALA
IGESIEIASLAGPSGLRIEGQPIQRALVGATDTVQLADTAVAVLHTVRPG
AAQTDSIAIEFNRSPRVTTRFAERKFKAPRPPQHPEPARFPIISMVAPLI
MGLVMFAVTRSLMSIAFIALSPLLMLGSYVDTKFQTRKKHEQQVRTFNDA
LAALTESLTAAQRVERAVRLSETPALAEVVEAIHRLGPLLWTHRPEHPGF
LTARIGLGDTPSRCLIELSDADDAEAAYTAQLHELQQEFANVTDVPIIAD
LRESGALGICGPRNVVDGVARGVIMQLIGLHSPADLTVTAFSSPQSRASW
EWLEWLPHAGSAHSPLSGNHLTDSANGGLGLLSRLEDLVKGRKASAGAKA
DYTFGDIKPGATDDTRAQTVTPAVVVLVDDTAPIDRPRLTRLAEQGGAVG
VHVVWVAAQVTSLPAACRTFVLVENESDGATVGQVRHGRHTVPVACESIE
VADARQVALLLAPVIDAGAAVDDETDLPRAVSYLGLAGTRLAAQPAAIAQ
QWLANNSVLARNGQPRSVSGKPATLRALVGSTGTAELYLDLREHGPHALV
GGTTGSGKSEFLQSWIIGMAAEHSPDRVSFLLVDYKGGAAFADCVQLPHT
VGLVTDLSPHLVRRALTSLGAEIRRREHLLNLKRAKDLIALEQTGDPDTP
PSLVIIVDEFAALAGEVPEFVDGVIDVAQRGRSLGLHLVLATQRPAGVIK
DNLRANTNLRIALRLNDVEDSVDVIDDPQAAFFPPEIPGRAVAKTGPGRL
TTFQSAYVGGRTSEEPEQTPIDMWEFVFGRRRPWANPAAAKSAHKPSGPT
DITRIVATVNAAAQQLHIPAPRKPWLPPLEQTYALEALARQSDTAELVIG
KCDTPAGQAQPVGTFSPDTAGNMAIIGTGGSGKSTALRTLAITAALNPNA
GPTHVYGIDFSSGGLRLLEELPHVVAIVDGTDEESIGRVLRRLVALLEGR
SRKFTRAHASTITEYRKLADPDEPRILLLLDSIGPFRDQYEFVSHSPFFE
MFSQLASDGRMVGIHVVITADRPAAIPSSLASTIQQRMVLRLASEDDYVM
MGVAKDVLSPKSPPGRAIMEDREIQVGVFGGSANVAVQARAVGQLAQQMR
ESGFVAPEPIQRLSEHIDLDALPASAAADTAVIGVADESLAPIGVTTAGV
MMVTGPPGSGRSTALVTLAQAMRRQHPNARVVHVAPAPSTIGSAKVWTDT
AVGQEPVSDLAGRLLATHASDNGPLMVVIEGVSDFGNTDAESTLVDLVKA
VGSTAFVIGESEVSSWGQAWALAQPFKASRRGLLLWPNGMEADSLLNTSI
GTVRRTEFPPGRGILVERGKGVWLQVAQPVI
333991457YP_004524071.1 PPE family protein [Mycobacterium sp. JDM601]MPSIWIAAPPEVHSALLANGPGPGVLLTAAGAWSALSAEYSAVATELVTV
LGAARSAAWQGLSADSYVAAHAPYLNWLARASADSARAAAQHEVAAAAYS
TALATMPTLAELALNHTIHGVLTATNFFGINTIPIAVNEADYVRMWVQAA
TVMATYDAVSGAALAAMPATDPAPPILTSDTGTTDPGGGEEPTDPVEEAN
RWFWFIFWNIVFWSTFLFIVTIPVRIPIVLPLMIMAINDFIAAMQVEPEP
VVEEPAPEPAPAPVPQHIVATRPTDHPVAVAVGIGPGIAGSAGTSAGAPA
PATTAPAMPVSGAELLGYLVGGNYSEDFGPTLIDRDQATAPAAGLSAVSA
AKAPSARAPLRSRRRRRAAMKEYADATMVMDPDFAAPPVDPATGSSETGA
GPLGFTGTAARAAARSTGLVRLRDDGFGDGPVVPLLPETWDRVEEEVQD
333991455YP_004524069.1 hypothetical protein JDM601_2815 [Mycobacterium sp. JDM601]MAAKTTIRVARVYDEPRAEDGQRILVDRVWPRGFRKNDPRVGRWFKDAAP
SRELRSWYDHRPERFDEFVARYKDELASPQGAAALEELRELTRGAKTVTL
VTATRDVDGSQAAVLAELLASR
333991453YP_004524067.1 transport protein [Mycobacterium sp. JDM601]MLGANFLIALGYGVVSPVLPVYARHFGVSISATTFLITAFALMRLCFAPV
SGLLVQRIGERRVYVTGLLIVSVSTTACAFVQTYWQLLFFRALGGVGSTM
FFIAAVGLMIRVSPADARGRVAGMFATAFLLGTVGGPVLGSLTAGFGLSA
PFLFYGSVLLVAATGVFVSLRNSHLAEPAGSTGPTVSVRAALGHRAYRSA
LLSNFATGWSVFGLRVALVPLFITEVLERGPAVAGLALATIGIGNVCAVL
PSGHMSDRIGRRGPLIIGLAVAGVATILLGASGSLAVFLIAAYLAGLASG
MYGAPQQAVIADLVGNQARAGTAVAAYQMMADFGSIVGSLAVGQIAQRLS
FEWGFAISGGVLLVAAVAWVLAPETRARAPIGEITGATWLGSVDGDAGPA
GQRSGELRGSPAVLFRPADDDAEQRRDARGDR
333991451YP_004524065.1 D-amino-acid dehydrogenase [Mycobacterium sp. JDM601]MGADNRIDGAPRSVIVVGAGIVGLSTAWFLQERGVEVTVVDRVGVAAGSS
WANAGWISPALAIPLNEPANLRFGLRSLFSRAAPLQVPLNAGPALWSFLA
RFAANSRPSAWRRAVRANAPLSAECIEAYDVLVANGVDAPVTDAPITAIF
RTSADAERLLDELRRFSEAGRPVFCTELTGAALRERVPLASSAVAAAVQI
DGQRFLDPGRFVTALGRAVVERGAALHTMDVTDVAPTGDGAVVTGRDGTT
LTAAAAVIASGAWLSQLTTCWIRVPVRAGRGYSFTVPVDGPVTGPIYLPD
ARVACTPLNAKLRVAGTMEFGDPDAPIVPARVEAIVAATRPLLDGVRWAE
RTDVWVGPRPVSPDGRPLVGEVSPRTVYVAGGHGMWGLTHGPVTGRLLAE
QITTGKQSAVLRELDPLR
333991449YP_004524063.1 hypothetical protein JDM601_2809 [Mycobacterium sp. JDM601]MCAGGVVALTSGEAAPVAGAADAAVLAGAGVPCGPAAADLTTLAGPVPMG
LPGPVPPVPIAPIPVLPGAPPPVPFVAPGPAGAAAASPIAAAATEAIGAP
IGLAGGTK
333991447YP_004524061.1 amidohydrolase [Mycobacterium sp. JDM601]MKSIDELSSDPNFTTAKAGAERIVTFLPEPPRAQRRYTVISVDDHIVEPP
DTFEGRVPRKLADRAPKVVETENGGQTWIYDGQSLPNVGFNAVVGRPVSE
YGFEPARFDEMRRGAWDIHERVKDMDLNGVYASLNFPSFLPGFAGQRLQL
TTDDGELALASVRAWNDWHHEVWAGSYPDRIIGCQLPWLLDPELGAAMIY
ENAGRGFRAVTFSENPAMLGLPTIHSGHWDPMIAACAETGTVVNLHIGSS
GSAPSTTDDAPPDVAGVLFFAYAISAAVDWLYSGLPSRFPELKICLSEGG
IGWVAGLLDRLDHMLSYHEMYGTWKTLGETLTPAEVLQRNFWFCAVEDQS
SFCQHERIGTDHIMLEADYPHCDSTWPHTQRVIHEQIGDLAPDVIRKLTW
ENASRLYQHPVPEAVQRDPDAF
333991445YP_004524059.1 FadR family transcriptional regulator [Mycobacterium sp. JDM601]MLPKEDELLVEFAISKPSLREAMRILEAEGLLTVRRGKRGGAVIHRPTPA
NVAYTMGLVLGSRQVSLADVATALLQVEPACAALCAGRPDRKSTVVPILR
RLHEESVAAVDDLPQATSASRRYHEALVTHCGNTTMLVMAGALETLWSAH
EQSWSSQVTDHSTVPVPERRAVLEDHRQVIDAIDVGDAQRARDLAAAHLM
HVQHYPGRSGVVDPAMIRPRGLSPFRDDDA
333991443YP_004524057.1 cytochrome P450 [Mycobacterium sp. JDM601]MTETPHLLPEGFDFTDPALIGERIPHEEFALLRRTEPIWWNAQPFGVSGY
PDEGYWVVTKHADVRAVSLQDDVFSSHENTSLIRTNTTSNQDLHEASRDN
IMLFLDGPKHAKLRRIVSRGFTPRVVAGMRDSLDRQAREIVAAAAEHDTG
DFVTEVASRLPLATICELIGVPAAERQQVFDWSNRLVGGGNGDPQAAADG
MQASAELLGYAYQMAEDRKARPRDDIATALVTATIDGEALTALEFGYYVM
MLMVAGNETTRNATSQGMVAFFDHPDQWRLFVAERPATMVDEVVRWATPV
ISFQRTALRDVELGGVHIAKGQRVGMFYGSANYDEEVFDEPFTFDIRRSP
NPHLGFGAPGAHYCIGANLARMQINLIFGALADIMPDIRRLDRASRSVLP
WINGIDAMPVEFGGAAMSTGSR
333991441YP_004524055.1 ABC transporter ATP-binding protein [Mycobacterium sp. JDM601]MADITRRGAARNAKLVGLPLSFAGRAALGLGKRLAGRSKDEVTAELMEQA
AEQMFTVLGELKGGAMKVGQVLSVLEAAVPAEFGEPYREALTKLQKDAPP
LPAARVHRVLDAQLGTRWRERFSSFDDDPVAAASIGQVHQAVWADGRPVA
VKIQYPGADEALRADLKTLRRLTGVLKPLAPGADVQGIVDELIERADMEL
DYRREADNQRAFAKAYTGHPHFAVPHVVASAPKVVIQEWLDGIAMSQIIA
DGTAAQRDLLGTRLVELIGDAPARVGMLHGDAHPGNFMLLADGRMGVIDF
GAVAPLPDGLPVELGMALRFAGQANYDLLLPTLEKAGFIQPGEQISIEDV
DDMLRRYVEPMAPEVFHFSRDWLQTLAAAQLDQSIHQIKTARQLDLPPNL
AMLGRVIGTTAGILAQLDAHVPVRALALELLPGFAG
333991439YP_004524053.1 carbon starvation protein CstA [Mycobacterium sp. JDM601]MAAPTAPQLIERRDGPVTYLHTDAALPPVAVVDRSPISVRQKLVLGALAV
AGAVAWALIAFVRGESVNAVWFVVAALCTYIIGFRCYARLIELKVVKPRD
EHATPAEIFEDGTDYLPTDRRVLFGHHFAAIAGAGPLVGPVLATQMGYLP
GTIWIVIGAVFAGCVQDYLVLWCSVRRRGRSLGQMAREELGAVGGAAAII
GVLVIMVILIAVLALIVVRALAVSPWGVFSIAMTIPIALFMGVYLRYLRP
GRVSEVSLIGVVALLAAVASGRWVAETSWGASWFTLSPLALSWCVIGYGF
AASVLPVWLLLAPRDYLSTFMKVGTIALLAVGIVIAQPLMAAPAVSTFAH
TGDGPVFAGSLFPFLFITIACGALSGFHSLIASGTTPKLLEKESQMRLIG
YGGMLTESFVAVMALITASILDQHLFFALNAPVAATGGTAETAAAYVNGL
GLGGSPVTGEQITEAAAAVGEQSIVSRTGGAPTLAFGMAEVLGQVFGGPA
LKAFWYHFAIMFEALFILTTVDAGTRVARFMLSDALSNLGGPLHRLANPG
WRIGAWACSVAVVAGWGSILLMGVTDPLGGINTLYPLFGIANQLLAAIAL
TVVTVIVIKRSRRRSDLKWALVPGIPLLWDLTVTMTASWQKIFSSDPRVG
YWTQHFAYRAAERAGATSFGSAVDAAQLHDVVRNTFIQGSLSIVFATLVA
VVFVTGVLVSFTAIRGAVSTTEPPPVLSRRFAPAGLVPSAVERKVQAQWD
ARQAG
333991437YP_004524051.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MGIAVTDDHRELAEVARGFLTAQQARAASRALLDATEEGRPPFWGELASL
GWLGLHIAEEHGGSGFGLPELVVVVEELGRAVAPGPFLPTVIASAVIAAA
GTPEQQARLLPGLIDGSVTAGVGMAGGVALDGGVASGDAGIVLGAGLADL
LLLAAGEDVLVLERDRAGVNVDVPGNLDPTRRSGRVTLTGVGISADDTLA
GGRESALARARVLLAAEAVGGAADCTDSAVEYAKVREQFGRTIATFQAIK
HHCANMLVGAESATAAVWDAARADGEDEYAFRLAAAVAATLAFPAYVRNA
ELNIQVHGGIGYTWEHDAHLQLRRALTVQALFGGDAPALAVFESAAAGIT
RTNSLDLPPEAEELRTQIHADALEIAALSGEEQLDRLIATGYVMPHWPKP
WGRAADAVEQLVIEQEFSAAGVQRPDYSITGWVILTLIQQGTDWQIERFV
EKALRQEEIWCQLFSEPAAGSDAAAVKTKATRVDGGWKINGQKVWTSGAH
LCRRGLATVRTDFDVPKHAGITMVIVDMEAPGVEVRPLRQITGGSEFNEV
FFNDVFVPDEDVVGEVNEGWKVARATLGNERVSIGGGGSFTAGIDQKLIA
LTQQHRQSVADAAVRVGRFIADEHALRLLNLRRVARSIAGAGPGPEGNVT
KLKLAEHMGDGAAIGAALLGPDVALDDGPGAMAGRMVMGARGIAIAGGTS
EVTRNQIAERILGMPRDPLIK
333991435YP_004524049.1 hypothetical protein JDM601_2795 [Mycobacterium sp. JDM601]MTNTSFQDRFDTTRLPRELRDVAAQLTWDHFVATYGRAAGPLRVGRWRCL
DPDRPAARLGPQGRRYQATIAVGERTGTCTAAAHGPLAALTTMLHDCGIT
LEILGFHQLRCGDETATFIHGSNGRTTAWAVGFSVDAGRSAVQAVTTCAN
RLLMAE
333991433YP_004524047.1 cytochrome P450 [Mycobacterium sp. JDM601]MTTMTTPQYLLDQARRRFTPTLNTIPGMGAIEKRLLTVDWKQKTLAEPPA
GSGLKPIVGDSGLPVLGHIVEMFRGGPDFAMHIYRKHGPVYFAESPILSS
VVALGPDATETVFANRKKDYSTTGWIPVIGPFFNRGLMLLDFEEHLAHKR
IMQGAFTRPRLASYVEDMDRVASALVAKWPTNDPRFLFYPAVKELTLDVA
SVVFMGMDLRDDQKTVAKVNHAFEQTTRAGGAIIRTSVPPFKWWRGLQGR
KVLEDYFTQRVRERRNVEGTDMLTVLCHTADEDGNTFSDADIVNHMIFLM
MAAHDTTTSTLTTMAYHLAANPEWQERAREESARLGDSPLDIEALEKLET
LDLVMDESLRLVTPLPFNMRQAVRDTELLGHYVPAGTNVTLWPGMNHWLP
ELYTNPRQFDPERFLEPRSEHKKHRYAFAPFGGGAHKCIGMVYGRLEVKT
VMHRLLRRYRLELSRPGYRPKWDYAGMPLPMDGMPIVLRPI
333991431YP_004524045.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MTGVAQYYRGKRCFITGAASGIGRATALRLAEAGAELYLTDRNAEGLAET
VADARALGAQVPEHRVIDIADYDDVAAFAADIHSRHEPMDVVMNIAGVSA
WGTVDRLTHEQWRKMVDINLMGPIHVIETFLPPMVAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGVSEVLRFDLARHRIGVSVVVPGAVKTGLVN
TVEIAGVDREDPQVEKWVGRFAGHAVSPEKAAEKILAGVARNRYLVYTSG
DIRALYAFKRLAWLPYSAAMRQANRVFSRALLPSQKSVTR
333991429YP_004524043.1 glutaredoxin electron transport component of NRDEF (glutaredoxin-liMSITVYTKPACVQCNATYKALDNQGIAYEVVDISLDSDARDYVMALGYLQ
APVVVAGDEHWSGFRPDRIKALAQTALSA
333991427YP_004524041.1 ribonucleoside-diphosphate reductase NrdE [Mycobacterium sp. JDM601MGELDFHALNAMLNLYDSDGKIQFDKDVLAARQYFLEHVNQNTVFFHNQD
EKLDYLIQKDYYEREVLDQYSRNFVKSLLDRAYAKKFRFPTFLGAFKYYT
SYTLKTFDGKRYLERFEDRVCMVALTLAAGDTKLAEQLVDEIIDGRFQPA
TPTFLNSGKKQRGEAVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALL
LTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLH
AHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFS
PYDVERVYGVPFADISVSEKYYEMVDNSAIRKTKIKAREFFQTVAELQFE
SGYPYVMFEDTVNRANPIAGKITHSNLCSEILQVSTPSEYNDDLSYAKVG
KDISCNLGSLNIAKAMDSPDFGQTIEVAIRALTAVSDQTHINSVPSIEHG
NNESHAIGLGQMNLHGYLARESIHYGSEEGIDFTNIYFYTVLYHALRASN
RLALERGRSFVGFEKSKYASGEFFDKYINQVWEPKTVRVRQLFADAGIRI
PEQSDWQRLKESVAAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKIE
IRKEGKIGRVYYPAPYMTNDNLEYYSDAYEIGYEKIIDTYAAATQHVDQG
LSLTLFFKDTATTRDVNRAQIYAWRKGIKTLYYIRLRQMALEGTEVEGCV
SCML
333991425YP_004524039.1 hypothetical protein JDM601_2785 [Mycobacterium sp. JDM601]MGMSRPNAQSMKPATAAKKLDVYLPATPAEFQQNPITRDEITALQADPPQ
WLKDLRKNGPHPKNLVAAKLGVSIAALARGGVENALTTEQIQQLLVENPP
WLVAERESYQAVLREERRLKALRAERAGES
333991423YP_004524037.1 oxidoreductase [Mycobacterium sp. JDM601]MTQRFDLAIVGGGPAGSAAAWQARQAGASVVIVDKADFPRDKPCGDGLTA
RAVSYLQKMGLAEQVDRFHQVNRVKVFSPSEWELSFPRRPGMPDHGYVAR
RPELDTLLLKHAESAGAEVRQSAEASAPILDDSGRVTGVLLKSGEQVLAD
AVIAADGAYSPIKRALKLDSDYNGYSAIAIRAEMPAVRPDVDSLDIYMKL
VFEGDQLPGYGWVFPLGDGRVNIGLGYVNSYKNWQAINATHFLGEFLETL
PREWELPSITELKKSKTVRAWRLPMGFTAWPPWRPGVLFVGDSLGAGRPT
SGAGISKALESGLAAGECAVAALTNGGPDDFTNYAQRMQAAWGREYKRGR
FFHKLAGRPALANAGLKLLDNARFREVMLNRLYAKSEGRPDHKH
333991421YP_004524035.1 monooxygenase [Mycobacterium sp. JDM601]MSVVKQEADRRAREAVGDKPVETRALIIGTGFSGLGMAIALQKQGVGFLM
LEKADDIGGTWRDNTYPGCACDVPSHLYSFSFEPKATWSKLFSPQPEILD
YLRGVADKHGLLRHIRFGSQVDRAHWDDDEFRWHVFTTAGQEFVAQFLIS
GAGALHIPRLPDIDGMDEFAGAAFHSAQWDHGVDLTGKRVAVIGTGASAI
QIVPELVRDDAKVAQVQLYQRTPPWVVPRPNSPFPKALLTAFATVPGLRR
AVRAGIYCWLEGLGYAMTRRPGLLRAVELVGRWNIRRNVGDEELRRKLTP
SYRAGCKRILYAPNYYQAVANPKAKLITERIEKITADGLVTADGVEHPCD
VIVYATGFHVTDSYTYVDIKGPGGEDLVDRWNTEGVVAHRGVAVADMPNL
FFLLGPNTGLGHTSVVIMIESQIHYVAEAIAAVDAVGAQALAPTRAAQGR
FNDELQQQLGGSVWNTGGCRSWYLDEHGVNRTLWSGMTWQYRRATRKLRP
DEYRFSGAG
333991419YP_004524033.1 integral membrane nitrite extrusion protein NarU [Mycobacterium sp.MSVICFWAWNLVGPLSTQYATRMSLSSNQQALLVATPILIGALGRIVTGP
MTDRFGGRTMFVAVSLTSIPPVLVVGYAAHIGSYPLMLAAAFFLGVAGTV
FAIGIPFANNWFAPQRRGFATGVFGMGMVGTAVSAFVTPRLVASVGLFAT
HLIVAAALAISVLLCVVLLRNGPRFVPNTTAVLPKLKAAARLRMTWEMSL
LYGLVFGGFVAFSSYLPIYIKAVYQFSQVGAGERTAAFALAAVLARLLGG
TLADRIAPKYVVLASLAGIAVQTLISVFKPPADIWSGLTFLPLAVALGIG
TGGVFAWVSRRAPAGSVGSVTGIVAAFGGLGGYFPPLVMGATYDPVRNSY
AVGLMLLVATAVLLFIYTAVFLRAREPTAATTA
333991417YP_004524031.1 NADP-dependent alcohol dehydrogenase Adh [Mycobacterium sp. JDM601]MSTVSAYAATSPTDPLTKTTITRREPGPHDVAFDIAFAGICHSDIHTVKA
EWGRPQYPLVPGHEIAGVVTAVGAQVTKFTVGDRVGVGCFVDSCRECPSC
QAGHEQYCTGGGMVGTYAGVGRDGQPTQGGYSGAIVVDENYVLRIPDEIP
LDAAAPLLCAGVTTYSPLRHWKVGPGNRIAVVGLGGLGHMAVKLGTAMGA
EVTVLSQSLKKMEDGLRLGAEHYYATSDPETFKKLRGNFDVILNTVSASL
DLGAYLGLLALDGTLVELGMPEKSLAVPPGPLVRMRRSVSGSLIGGIAET
QEMLDFCAEHGVRPEIEVIEPEYVNTAYERVLASDVRYRFVIDTASLRDN
333991415YP_004524029.1 hypothetical protein JDM601_2775 [Mycobacterium sp. JDM601]MLVEDEAINFGASNHWRTVTRGTDIALQVASGQSEIAPSSTLQRTLSLSA
ELHSD
333991413YP_004524027.1 FEIII-dicitrate-binding periplasmic lipoprotein FecB [MycobacteriumMMRADRRAAAAALAMLLVAASGCAGKSAETAPTSTTTTMVAGAGVLGNDR
RPDESCAPEPARADPGPAMRSVHNAPGVEPPGVEVPEEPERIVVLSGDQL
DALCALGLQSRVVGAALPDDSENQPSYLGAVMHGLPAVGSRSTPDIDAIA
ALHPDLILGAQGLTPGYSELASIAPTVFTGAPGAAWEDNLRGVGAATARS
GATDVVLDKFGRAAAETGEAADATHFQASVVALTDAGVRVYGAANFAASV
LKAVGVDRPPSQRFTDQPYVEIAASDADLAGRADLSAADGDIVYVSFAST
AAKARAAAVFDSVSWRRLAANRDSRVFVVNNEVWQTGQGPIAALGVVDDL
RWLNAPIN
333991411YP_004524025.1 cytochrome C oxidase polypeptide I CtaD [Mycobacterium sp. JDM601]MVTTTDHKLIGIMYCVACMVFFFIGGLLALLMRTELVAPGLQFLSNEQFN
QLFTMHGTIMLLFYATPIVFGFANLVLPLQIGAPDVAFPRLNAFSFWLFV
FGATIALAGFITPGGAADFGWTGYTPLSNAVHSPGAGADLWIMGLAVAGL
GTILGGVNMITTVACMRAPGMTMFRMPIFTWNILVTSIMVLIVFPLLTAA
LLGLAVDRHLGGHIYDSANGGELLWQHLFWFFGHPEVYIIALPFFGIVSE
VIPVFARKPIFGYVTLVYATMSIAGLSTAVWAHHMYATGAVLLPFFALLT
LMIAIPTGLKFFNWIGTMWRGQMTFETPMLFSLGFIVTFLAGGLTGVMLA
SPPIDFHVSDSYFLIAHFHYVLFGTIVFATFAGIYFWFPKMTGRLLDERL
GRLHFWLTFIGFHTTFLIQHWLGNMGMPRRYADYLPTDGFQPFNIVSTVG
AFILGASMLAFTWNVFKSWRYGEVVTVDDPWGYGNSLEWATSCPPPRHNF
TELPRIRSERPAFELHYPHMIDRLRAEAHVGRHPGDELYEPTPV
333991409YP_004524023.1 PE family protein [Mycobacterium sp. JDM601]MVRGSGAVAVVLTGACLLSSPAPPATAAELQPVRLASSLGGGTALILGPS
GISTPSQAYADLVNELYLAPHGFTGTTEILTTPQGLYPFLGPFGETLDRS
LVQGNEVLEAAILEQIAGGHVDADNPVVVFGWSQSAVMSAQLMQQLADQG
VPSDYVHFVLLGDETVPNGGMLARFDLPLGTNPTIPSLGLTFSGAQPTTL
FPADVYTHEYDGFASFPQYPINFLSVLNAVMGILFQHSTYLGLTPEQIAD
AVLLPVSGPDVLTDYYMIPAETLPLLAPLQLLPFIGNPLVDLLQPALRVL
VNLGYGNIENGWSPGFADVPTGLGFLPDAHVLQQVPQALADGVQQGITDF
FARLADPDNYVYSLPAWAQQLLNEAEFIAGSQFSVLSMVPTTWQDLFETF
PPHTGIPPLDMLSAVLFTLPEYNYEIFAAELADGNLLDAIGIPLAADLGL
LPLIIVGALF
333991407YP_004524021.1 hypothetical protein JDM601_2767 [Mycobacterium sp. JDM601]MSAPQPPPLPTRPAATVMLVRNGESGRGPLDVFLMRRHAAMEFAAGVMVF
PGGGVDERDRSAEVAWFGPEPAWWAQRFGVEIDLAAALVCAAVRETFEES
GVLFAGPADDSRRVVADASVYADARRALSVGELSFADFLRTENLVLHAEL
LRPWANWVTPEAERTRRYDTYFFVAALPVGQRADGENTESDRAGWLTPEA
AIEDFAAGRSFLLPPTWTQLDSLAGRSVEDVLALEREIVVTQPGLARVGD
NWQIEFFNSERYNAARGKRWPG
333991405YP_004524019.1 phosphoglycerate mutase [Mycobacterium sp. JDM601]MQQGVTRPWIAGAVALVSASAVAAGPVVNPVAAPLTIPTAAEILLAAQDI
TLDLVRHGESVDNAEDVLGTIPPGAALTALGQQQAVDVAPGIQAAFPDGI
DGIYASEFLRAQDTAQPLADLLNMDITTLAGLNELHGGFLEGESLNILTQ
IGYIFAPVMWIMGQYWMPQLGSTIDVNGVVFNDRVSDAIEAIYSNTIADP
DSPTTSVAFAHAGTIAIWTLMNVKNPDLWLVINEGIKTLSPLANAAQVVI
EGNPTDGWTLVSWDGHEVSATPDLLTGLFVDWRDLTTAPQIATWHILEAI
QGGDQAEIAAALETGFEQVVAAISAFPQAVIDTFTDAFGG
333991403YP_004524017.1 PE-PGRS family protein [Mycobacterium sp. JDM601]MGIALAGAGIVTAIPVVPPPSARAFDIALTAEDITLDLVRHGQSTDDLNN
ILGTLPPGAHLTALGEQQAHDVAAAIQNEFPGGIAGIYASELVRTQESAA
ALALLPGMPDVQVLSDLNEIPAGLFEDQPRNLITEASFFLPMASWILGNL
FVSEPGTAYNGVVFQDQISSAVDTIYNNTIAGDGPMTDVAYSSGGVIAIW
ILMNVKNPDVWPIIQTVLENGGPPPNGGQAVLEGNPTDGWTLVSWDGIAV
SATPDLFTGLFVDFRDLITAPQIALWHLWEAIQGGDSADITAALQTGFND
VVAAFTGFPQAVIDTVTAAMGDAAGGSAADTGDVIGDALATLAG
333991401YP_004524015.1 hypothetical protein JDM601_2761 [Mycobacterium sp. JDM601]MARHRAHRINTAAPDAVVHDVTCSIGTELAALTELTDRVLGGDLDPVRLA
MARHNLGGSARLDGGEAKLGPPHGLGGIALVRADALTPVTRDAVVLADPG
RRGGGRRRFDPADYQPALDRLLEVYAGRDLVVKTAPGIDFDKIRMLGFQG
EIEVTSWRDSVREACLWSPGLAAPGVRRRATILDRGEQLTDADPDDCDVR
PAGRWIIDPDGAVVRAGLVRQYATRHGLWQLDPDIAYLSGDRLPDGIRGF
EVLEELPYSEKRLRQALVAHGCGALEILVRGVRDVQADPDGLRRRLRLRG
RLRLSVVITRIGSGTAARPIAFVCQPSR
333991399YP_004524013.1 hypothetical protein JDM601_2759 [Mycobacterium sp. JDM601]MLAAVTAATPALGGCANTDSWVEAAPAAGWPAQYADAANSSNTATAGATD
LQLDWTRSVKGELGAGPAVGAHGWLVLNAQTEDGCSLMQWENAEHGRQRW
CTRLHQGGGFFGPLIDGFDNVYVGQPGAMLSFPPTQWIRWRAPVIGMPST
PRILGDGLLLVVTHLGQVLVFDAHRGAVVGTPLDLVDGVDPTDFRRGLSD
CDAARPDCPVAAAPAFSAASNTVVVSLWQPGADESGLVGIKYHPGGTPLL
TQEWTSDAVAAGVLASPVLSADGATAYINGRDQRLWAINAADGKAKWSVP
LKFLAQTPPAVTPGGLIVAGGGPETELVAFADRGDYAEQVWRRDDVTPLS
SSSLAGKVGYTVAAGTSVGPAGLSLLVFDPDDGHSVNSYPLPESRGFPLG
VSVGRDQRVVVTTSAGQVFSFAPV
333991397YP_004524011.1 hypothetical protein JDM601_2757 [Mycobacterium sp. JDM601]MVVAPDWAEEYCRQHEIPYIAWNFERLNERSMEIAETLKERGVDVAIPLF
EETVEWAGAINSVLLDNPRLLGQAMLLRDKSLMKRRAQLGGIRVGIFEEA
HDRDDVIRFLKRVNQTLLKLDGDPNDPIHFKAFDKAGCLGHRVIRAPDDI
DSIPDEEFPALMESHLDGWEFAVEAWVHNGKIRFLNISEYVTLGYSVFVP
ASPELERYRPQITAQIEKLIKTFDIDFGFVHPEYFVTSDGEMYFGEVAYR
PPGFKVFELLERVYGFNGYQALVLTFDPKTTEDELEQFFPREIVDADGHA
GCFGVYPRRRVVSTLAIPEETEDHQYFESHELTAPLEETVTKRTAFGTHW
GLVYFFGEDPYEMRRLLKRQEELDFYV
333991395YP_004524009.1 hypothetical protein JDM601_2755 [Mycobacterium sp. JDM601]MPLLSALRLNMTNIPGAGHAQRYRAALEMASYADAHGVTAVGCEEHHLAA
TGWLPSPLLMAAAVAGCTQRIRISVGALLLPLYDPVRLAEDIAVLDQLST
GRVSYVTGVGYRPAEYHAVGKDFRRRGRLMDECLAVLLQAWGDDPFPFNG
RLIDVTPKPYTRPHPVLFVGGMSVAAARRAARFGLPFSPPMPMPELDAVY
QAELARNGKQGFVFSPQNGNTVTHLSTDPDRTWARCGDFFLNEAREYSSW
AVPEVPRPNESPAGTVAELRAAGTVEVLTPEELIAQCRDGRTGVTLHPLI
GGLPLEEGWESLRLLVEQVLPELQR
333991393YP_004524007.1 transporter [Mycobacterium sp. JDM601]MWDRISAGVTHRGSWLLTLVILTASAALMAVGGHSADATASPELLPGSSE
SAAVAAAQHDFPRGEQAAAILVATRQDGSALTPADLAAVGQARDRMQRVP
QALPGGPAPVPVSADGHAAIATVQLSSSLSGFELRDAVQALRSAVSDGLP
GQLTAHVTGGPAFGADIADAFSGANVTLLAVTALVVAVLLIVTYRSPVLW
LLPLLAVALADRVATVAGGVIAEAAGVSFDGSTSGITSVLVFGAGTNYAL
LLISRYREELRLAPDHRVALRAAVRAAGPAIVASNATVVLALLTLIAASI
PSTRSLGICAACGLVVAAVFVLLVLPPLLALCGRNVFWPFIPRIGDGPAT
TGWRRIAEAVGRRPVPVCAVAVVALAVLTTGLLGTRIGLSQTEQFRVRAD
SVTGFQTLAEHFPGGASDPTVVIGSTARTAPLREAITRVAGVTSAAPTGL
SPAGLTRWSVVIDAAPSTARAFDTVTALRDSVRAADPGALVGGADAQALD
IRDAADRDRRVLIPAILTVVLVVLYVLLRAALAPPVLVAATVLSALAALG
LGGWASIHLFGFPALDNGTPLFAFLFLVALGVDYTIFLVTRAREETAGQG
TREGMVAAVAATGGVITSAGIVLAAVFCVLGVLPLIVLTQLGIIVGVGIL
LDTFVVRTLVIPALFSLIGDRIWWPSMPAASTKTPDTAPGPR
333991391YP_004524005.1 hypothetical protein JDM601_2751 [Mycobacterium sp. JDM601]MTEKPSVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAAYLPLMRVL
RTLAAEGRRNLLTLGVTPVVAAQLDDPYCLDGMHHWLANWQLRATQATTL
PDLRDFGRHECAKAEQALDDFALLWRHGASPLLRELTQAGTVEMLGGPLA
HPFQPLLAPRLREFALREGLADTRARLAQRPTGIWAPECAYAPGMEAGYA
AAGVTHFMVDGPSLHGDTALGRPVGDSGVIAFGRDLQVSYRVWSPKSGYP
GHGAYRDFHTYDHRTGLKPSRVTGRNVEPEHKAPYDPQRAEAAVDTHVAD
FVKVVRTRLQDESERIGRPAHVIAAFDTELFGHWWHEGPQWLARVLRALP
EAGIRVGTLSDAIDAGFVGDSVELPPSSWGSGKDWQVWSGEKVADLVQLN
SEVVETALGAVDKAMAAAATPSGPSPRDRVADQILREALLTVSSDWPFMV
SKDSAAEYARYRAQLHAHATREIADALASGHRDAAERLAEGWNRADGLFG
ALDARRLPR
333991389YP_004524003.1 electron transfer flavoprotein FixA [Mycobacterium sp. JDM601]MTNIVVLIKQVPDTWSERKLSDGDFTLDRDAADAVLDEINERAVEEALLL
REKEGAEGTVTVLTAGPERATEAIRKALSMGADKAVHILDDGMKGSDVLQ
TAWALARALGQIEGTELVIAGNESTDGVGGAVPAIIAEYLGLPQLTHLRK
LTVADGKVTGERETDDGVFTLEASLPAVVSVNEKINEPRFPSFKGIMAAK
KKEVTVYTLAEIGVEPDEVGVANAGSKVTATTPKPPKTAGEKVTDEGDGG
TKIAEYLVAQKLI
333991387YP_004524001.1 transcriptional regulator [Mycobacterium sp. JDM601]MGAFASARRENGLTGRDGEQTQLRDLLGRARAGDSQVLVLRGEAGIGKTA
MLDYLAESATGFEVIGTAGVESDMELAFAGLQQLCAPLMPCAGALPEPQR
EALQIAFGLSSGPAPDRFLVGLAVLGLLAAAAGERPILCLVDDAQWLDRV
TAQTLGFVARRLVAEPVALVFALREPVDGLTGLPKLVLRGLGDADARELL
ASAVTGRIDTQVRDRIVAETHGNPLALLELPRGLSAAELAGGYHRPDVQP
VAGQLERHFLARVRSLPDDTQRLLLLAAAEPVGDPTLLLAAARLLGLPAE
ALAPAEAAGLAETGQRVRFRHPLVRSAVYRAADPAQRRQAHRALADATDA
AHDPDRRAWHCAHAAAAPDESVAAELEHSAGRAQLRGGTAAAAAFLARAT
ELTPDAARRGGRALDAAEAMRAAAEFDAADALLDTAELAPLDALQRARAA
RTRAMLEFTRGRGSGDAPTLNLSVRQLFDAAATLERHDTDMGQDALLEAV
SAAMYTGRLFGQDARLATAVSLADRVRADPGRAAGLLLHGLIIRVLDGCA
AAAAPLRAAIAAISPEDWTWQAFPIAHEAVLHEMWDDESWHRIATDAVRV
ATDTGALAVLPMALTTLAGVHVQAGEFASARALIADAGTLSAAAGQTPVR
YHELALAAWIGDEAEATGLLDAAVRYGMARGEGRVTALAGYAGAVLNNAL
GRYQAAYEMLARAGEYEDLGLYGWNLAELVEAAARTDRHTVAADALQQLD
DRTRAAGTDWALGVRARSAALLRDGDAAESLYTEAIERLARTRITVQLAR
THLLYGEWLRRENRRGDARTQLRLAHGMFSGFGARAFAARSYRELQATGE
KARKQPVATGDALTAQEEQIAELAGAGLTNAEIGVQLFISAHTVEWHLRK
VFAKLGIRSRRELRDAPWRRSAPG
333991385YP_004523999.1 dehydrogenase [Mycobacterium sp. JDM601]MNELSGQTALVTGGTAGIGLESARLLARHGATVIITGRSADRGAAAVAEI
GAGVRFVAADLSDLESVKALVRQCGEVDIVVNNAASFPGALTVDQDVSSF
ESTFDTNVRGAYFLVAALAPGMLRRGHGSIVNVTSMVAFKGVPGASSYSA
SKAALESLTRTWAAEFSPHGVRVNSVAPGPTATAGVAAEWGDVNDELGKA
LPLGRTAQAAEIAEAVLFLASPRSSFITGSTLHADGGGAAA
333991383YP_004523997.1 hypothetical protein JDM601_2743 [Mycobacterium sp. JDM601]MSPVVVALRLALLVLLVPLLPLFAVPLPGRARFQRGCCRLVLRCFGVRVV
TTGGPVRNLRGMLVVSTHASWLDVFVVGAVSPGTFVARADLISWPGIGAL
ARLMRVIPIDRDSLLGLPLVVEAVAARLRAGRTVVAFPEGTTWCGRAHGR
FYPAMFQAAVDASRPVQPLRVGYRHPDGSRSTLPAFVGDDTLVASMGRLI
TARRTVAQVHVASLQLPGSDRRELAARCQAAVGCRALPSRPACIFC
333991381YP_004523995.1 tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase TrmU MKVVAAMSGGVDSSVAAARMVDAGHDVVGVHLALSRNPGTLRTGSRGCCS
REDSDDARRVADVLGIPFYVWDFSEQFQEEVIDDFVESYARGETPNPCVR
CNEKIKFSAVAARALALGFDMVATGHYARLADGRLRRAVDADKDQSYVLA
VLTAEQLSHAAFPVGDTPKPAIRAEAAERGLAVASKPDSHDICFIPTGDT
RTFLGSHIGVRPGAVVDAGGEVLAEHDGVHGFTIGQRKGLGIAGPGPDGR
PRYVTGIDAATATVTVGTVADLDVLELTGRAPVFTSGGAWHGPVECEVQV
RAHGETVGAVAELVGEELQVRLREPLRGVARGQTLACYRPDPAGDEVIAS
ATIAGTGV
333991379YP_004523993.1 hypothetical protein JDM601_2739 [Mycobacterium sp. JDM601]MNAFATAIGSWPGSSARQAAEVVVGELGASLAHLVELPARGVGADLIGRS
GALLVDIAIDTAPRGYRLAARPGAVTRRAISLLGEDTDALEEAWEIGGLR
GSGHPVKVQAPGPLTLAAQLELGNGHRAITDPGALRDLAGSLGEGLRAHR
AELCRRLDTQVVVQLDEPALTAAVTGRLAGVTSLSPVPAIDEAVATALLD
GCADTVGGEVIVHSCAAELPWNVLQSSRIAAVSLDCTTTPVDYDGIGAFI
ESGRTVVFGLIPAVQPTPRPAVEEIAAAAAAITDRIGFARSVLAERVGIS
PVCGLAGATAQWARTAIGLVRQVGEALAGDPEAI
333991377YP_004523991.1 NAD-dependent DNA ligase LigA [Mycobacterium sp. JDM601]MSPEADSVSPDIRRQWYELAEEVREHQFRYYIKDAPIITDAEFDDLFNRL
LALEDRYPELRTADSPTQLVGGAGFTTDFTPAEHLERMLSLEDVFSPDEL
TAWAGRVAGEIGGDTTYLCELKVDGVALGLVYRGGRLVSGATRGDGRVGE
DVTLNARTIADIPEFLTPDGEFPIPAVLEVRGEVYFRLEDFETLNAGLVA
EGKPPFANPRNSAAGSLRQKNPAVTARRNLRMVCHGLGYSEGFNPDTLHE
AYTAMKAWGLPVSAHTARVEGMAAVAERITYWGEHRHDVEHEIDGVVVKV
DDRALQRRLGATSRVPRWAVAYKYPPEEAQTTLVDIRVSVGRTGRVTPFA
YMTPVKVAGSTVGLATLHNASEVKRKGVLIGDTVIIRKAGDVIPEVLGPV
VDLRDGSEREFVMPTQCPECGTLLAPAKEADVDIRCPNARSCPAQLRERV
FHVAGRGAFDIEALGYEAATALLGAGVITDEGDLFTLTEDDLLRTELFTT
QKGVLSKNGRQLLTNLDKAKSQPLWRVLVALSIRHVGPTAARALATEFGS
LDAITTASTEQLAAVEGVGPTIATAVTEWFDVDWHRAIVDKWRAAGVRMA
DERDASIQRTLEGLSIVVTGSLAGFSRDEAKEAIIARGGRAAGSVSKKTA
YVVAGDAPGSKYDKAVELGVPILDEAGFVKLLAEGPADDEPTD
333991375YP_004523989.1 glutamyl-tRNA(Gln) amidotransferase GatC [Mycobacterium sp. JDM601]MPQISRDDVAHLARLARLALTDAELDGFAGQLDAILTHVSTIAAVDVTGV
EATDNPLKAVNVTRPDEMVTSLTQQQALAAAPRAEDGRFAVPQILGESQ
333991373YP_004523987.1 hypothetical protein JDM601_2733 [Mycobacterium sp. JDM601]MMTRAEAAADLRRLADELEAGKISYGADRSLEVPEALEREIEIEREDKGT
NIKYQVEFELEWSVPKV
333991371YP_004523985.1 hypothetical protein JDM601_2731 [Mycobacterium sp. JDM601]MGKLSRTATALGALPIGLVLAAPAHGIGDAVSDYVADHGGEVCAFMDDQP
NLAGVKGAVNHILATSGLAENQTGRLLAGSVTADCPEYGGLVDEFVRYVH
RRQQQQQNGGIGAVLGN
333991369YP_004523983.1 tena/thi-4 family protein [Mycobacterium sp. JDM601]MADRMRDVLWADIAGIYRRICEHPFITGLTDGSLGHDRFRYYIAQDAHYL
RAYARALAGCAAKAPVEAELTMFAEHAGVALGAERELHTGLLAELGMDTA
QAAALPITPTTQAYASHLVAVTASGSYAEAVAAVLPCYWIYARVGEHLQR
HGSPVPLFQRWIDTYAGEDFQAVVDAVLAVTDGIGAQASPATGELMRRHF
HTSARYEWMFFDAAYRTEDWPV
333991367YP_004523981.1 hypothetical protein JDM601_2727 [Mycobacterium sp. JDM601]MLGVALLVLTGCAHFDDAQSQPFTTVPRRGMAPTTTPPPPPPLPANPFPK
QCPAPGVMQGCLESTSGLIMHADSKSALVAERTTGAVKEVSLTAEPKVKT
VIGVDPAGDGGLMDIVLSPTYRQDRLMYAYISTPTDNRVIRIADGDVPKD
LLTGIPKGATGNTGALIFTSPTTLVVLTGDAGNPAAAADPGSTAGKVLRI
EQPTTIGQAAPTTALSGLGAGGGLCIDHVDGSLYVTDRSPSGDRLQRITK
DSHVSTVWTWPDKPGVAGCAAMDGIVLVNLINTKQTVAVRLASGTGSVTS
EPEVMRQDTHGHVWAVEMSPDGNVWGATVNKTAGDAEKLDDVVFPLFPSG
GGFPRANDDKD
333991365YP_004523979.1 hypothetical protein JDM601_2725 [Mycobacterium sp. JDM601]MPSASHDPAPLVIRISPMAHFAVGFLTLGLLIPVMTWPLTAPLLLLPVLF
SALIVRWRTVADAQQVTVRTLRGSRSVSWDDIAGLGFSRGSWARAHLRNG
ERLRLPAVSFATLPLLTEASGGRVPNPYR
333991363YP_004523977.1 hypothetical protein JDM601_2723 [Mycobacterium sp. JDM601]MQPRRIRFNYPVAALQRHFVQGDLVMSHMIAHLSAVFPEGEDFFIRSVRH
YAGQITDPVLKDQVKGFIGQEVTHGREHRALNERLQQMGYPTRRIDRLVH
RRLKAAERRFSPLTCLSITAALEHFTAVFAETLLADEQAQELLGTTEVRS
MLLWHAVEESEHRSVAFDVYRAVGGDETRRIRTMRVIRFSFPIAVTMNTI
ISLFSDRAAYHPVRLVRSFAALRHSPFLTRAVFRRLGDYLRPGFHPDDHD
NTVLLQRWEAELFGERGSLVGHLH
333991361YP_004523975.1 acetolactate synthase small subunit [Mycobacterium sp. JDM601]MSTDWKTHTLSVLVEDKPGVLARVAALFSRRGFNIKSLAVGATETKNMSR
MTIVVSVEDTPLEQITKQLNKLVNVIKIVEQEDDNSVSREIALIKVRADA
GTRGQIVEAVNLFRARVIDVSPESLIVEATGTPAKFEALLRVLEPYGIRE
IVQSGLVSLSRGPRGIVTAK
333991359YP_004523973.1 hypothetical protein JDM601_2719 [Mycobacterium sp. JDM601]MNATLRPFALAGAAIIGATAIAATPVVVVPVSVPTPVIELTADAGGAFEG
ALGSLGDSLGNLLSSLDLSEILGDLFSNLNLSEIFGDFFANLNLSEMFGD
FFANFDLSGIFTGITDFFANFDLSGIFTGITDFFANFDLSGIFTGITDFF
ADFDLSGIFTGITDFFADFDLSGIFTGLGDFFADFDLSELLGGLDLSGLL
DDLFGGL
333991357YP_004523971.1 3-isopropylmalate dehydrogenase [Mycobacterium sp. JDM601]MSVKLAVIPGDGIGPEVIAEAVKVLDAVLPGTEKTTYDLGAKRYHATGEV
LPDSVLEELGAHDVILLGAIGDPSVPSGVLERGLLLKARFALDHHVNLRP
ARLYPGVSGPLVGNPEIDLVVVREGTEGPYAGTGGFLRRGTEHEIASEVS
VNTAYGVRRVVHDAFGRAQRRRKHLTLLHKTNVLNFAGDLWWRTVQEIAA
EYPDVEIAYCHTDAATIYLVTDPGRFDVIVTDNLFGDIVTDLAAAVCGGI
GLAASGNIDATRTNPSMFEPVHGSAPDIAGQGIADPTAAIMSVALLLAHV
GEDTAAERVDQAVAEHLATRGEAKLSTAATGDRILGLL
333991355YP_004523969.1 3-carboxy-cis-cis-muconate cycloisomerase [Mycobacterium sp. JDM601MLVDAGIAPDSARADLTATIAATDVEEVAVAAETTGNPVPGLVTLLRDRT
GGEPARWLHRGLTSQDVVDTALMLCLRDALERIHDETVAQVRRLAELAET
YRDSPMLARTLTQPALPTTIGMKVAHWLGGVLDAADSLAALPALPVQAGG
AAGTLAAATELADSPGDAVTLSGRLAAALDLTDTPPWHTTRSVLTRVGDA
LATCCDAWGHIAGDVAIGSRAEVGELAEGRGGGSSTMPHKSNPVLSILIR
RAALVAPSLSAAVHVASAASVDERSDGGWHAEWATLRTLSRHTVVAAAQT
AELLAGLVIDTDRAAANLAAAGDLLAEQRSMTELTGRTARRDYTGAAGHL
IDVVLQRARHTTGVT
333991353YP_004523967.1 protocatechuate 3-4-dioxygenase subunit beta [Mycobacterium sp. JDMMRGPCFGDSDVDAADADLTAQHPGEPIGERIVVTGRILDGDGRPVRRQLV
EIWQANASGRYIHQRDQHPAPLDPNFTGAGRCLTDDDGCYRFTTIKPGPY
PWRNHHNAWRPAHIHFSVFGSDFTQRMITQMYFPGDPLFSLDPIYQSITD
QRARDRLVASYDHDITSHEWATGYRWDVVLTGPAATPCEEPR
333991351YP_004523965.1 20-beta-hydroxysteroid dehydrogenase [Mycobacterium sp. JDM601]MDAYLEEGAQVAVLERDTAKCAALQEQLPGLPVTQGDATTAEANARAVAA
AVASFGGLDTLVNCVGIFDFYQGITEISTDELAPAFDEMFTTNVLSHLQS
VKAALPALRAQERSSIVLTESTSSFYPGRGGVLYVASKFAVRGLVTTLAH
ELAPHIRVNGVAPGGTLHTDLRGLRNLSLDHIRLDDTPDRARDLAARTPL
NVALTPQDHSWSFVFLASDRSRGITAGSIHPDGGFGMGKAAAPTGDNA
333991349YP_004523963.1 3-phenylpropionate dioxygenase subunit beta [Mycobacterium sp. JDM6MTSTERDERAGFPRPGDAARPWELAVLGGHAPRQVRTGKPLPFNDIRHLQ
AHQFLVDEAYLLDAQRYGEWLDTLTEDIHYFAPVRVTTASGAGFDTSPGM
AHFDENKYSLNRRVARFATEHAWTEDPPSRLRHHITNVRTFACDDDAHLI
VESAELLFRSRGDVNEAALISCGREDLLRLTGQGWKLARRTIYLDESVLR
MQNLAVFL
333991347YP_004523961.1 transcriptional regulator [Mycobacterium sp. JDM601]MPQYPIGSVDRALKLILLLGEQPRLRLTDAAEHLAVASSTAHRLLAMLQY
RGFVRQDPVSKAYYPGPALMSVASSVFNRLDIEDAATPVLRRLSEHLRES
VHIGMIEGAHVRFIAAAEGPTAVRVASRLGRTMPAHCTSTGKALLARLSE
AEVARLYPDEELERVTAHSVGTRTELQRELSRIRQQGYAVNREGSEDGVA
SVAVPIPTRASGVLLALNAAAPVHRLSPSRHRAVAALLVEAAKEIGDRIG
333991345YP_004523959.1 maleate cis-trans isomerase [Mycobacterium sp. JDM601]MSSAGRVGFIYPDHAAESDYPRAARLLGVDLPVVHIYGTDLHAVPELLDL
GSPARLAEGAALLAPQRPAAVVWACTSGSFVFGPEGAAEQVDRLAAEAGV
PASSTSFAFVHALAALGCRRVAVAASYPRDIAALFADFVAAHGVSVEAMG
DAGIPTAAQVGRLTRSQVRDLALGNDSPGAEALLIPDTAMHTVDQVDELE
RLLGKPVLTANAVTVWEGLRIAGITRRTAGLGILFEDNR
333991343YP_004523957.1 D-isomer specific 2-hydroxyacid dehydrogenase [Mycobacterium sp. JDMVTVQHGESVPAQLDSISAAAELRMVPSSRLGEAIAGTDVLFVYDFSSPA
LATVWSDADALRWVQVAAIGVDAVLFDGLIDSDVVVTNSRGIFEEPIAEY
VLGQILAFAKDFRRSWDAQAAKRWQHFDTEPIAGSSVTIVGPGPVGRAVA
RLLHAVGMSVRGVGRSARDDPDFGVITTDVVDAVADADYVVLAAPLTPET
RGMVDAAVLASMRPTARLINVGRGELVDTDALVTALRDGAIAGAALDVVD
PEPLPPNHPLWSAPNVRLTPHNSGDVKGWRNMLQQQFITNFQRYVAGQPL
HNVVDKGHGYAPSGTG
333991341YP_004523955.1 hypothetical protein JDM601_2701 [Mycobacterium sp. JDM601]MARFLSITLTSRGVSCRARLLEDAAPRTCAVVWNALPVAGQAYHGKYARN
EVYTLLPPMGAPGRENTTVTPIPGDVCFFSFEPGDIGNPAYGYDEGAQGN
SPVGATDLAIFYGRNNLLLNGDVGWVPGNVFATIEDGLAEMAAACNDLWM
AGAVGEQLAFSRA
333991339YP_004523953.1 L-ectoine synthase [Mycobacterium sp. JDM601]MIVRTLAEIKGTDRDVQAKTWNSQRLLLARDGQRFSLHETILYAGTETAM
WYANHVEAVYCVGGEGELVNEETGETFPLADGTLYLLDGHEHHRVSAHTD
LRMVCVFDPPVTGREVHDETGAYPLLTEEPQEAAP
333991337YP_004523951.1 acetyltransferase [Mycobacterium sp. JDM601]MTEPAHIALRTPTVADGPALWKMALDSVTLDVNAPYAYLLWCRDFAASSV
IAEVSGAPAGFITGYRRPDQPQTLMVWQVAVNDAHRGMGLAGRMLDHLAT
ALVADGGTHLETSITPDNEASRRLFGAFARRWAADLECSELFEASLFPES
HLAEELFRIGPLRVNIGR
333991335YP_004523949.1 2-hydroxyhepta-2-4-diene-1-7-dioate isomerase [Mycobacterium sp. JDMRLGRIASPDGVAFVSLEGDPDRPDDMTAMTAREIAEHPFGTPEFTGRSW
PLADVRLLAPILASKVVCIGKNYAAHIAEMGGAPPANPTMFLKPNTAIIG
PNVPIQLPANASPVHYEGELAVVISRPCKDVSAARAKDNILGYTIGNDVS
ARDQQKSDGQWTRAKGHDTFCPVGPWIVTDLDPADLAIRTEVNGQVKQDG
RTSLMLHDIGVIVEWISAVMTLLPGDLILTGTPDGVGPIEHGDTVSVSVE
GIGTLTNPVIRKGMS
333991333YP_004523947.1 hypothetical protein JDM601_2693 [Mycobacterium sp. JDM601]MGTKQRAQIVMTDAEVADFVTSHRTGTLATIGPDGQPHLTAMWYAVLDGE
IWLETKAKSQKAVNLRRDPRVSFLLEAGQTYDTLRGVSFEGVAEIVDDPD
TLFRVGVSVWERYTGPYTDEMKPGVDAMMNNRVAVRIVTRRTRSWDHRKL
GLPAMPLAGSTAPTGD
333991331YP_004523945.1 3-isopropylmalate dehydratase (large subunit) LeuC [Mycobacterium sMAVMSKTQQPRTLAEKVWDDHVVVSGGGSEPDLIYIDLHLVHEVTSPQAF
EGLRLAGRGVRRPDLTIATEDHNVPTVDIDKPIADPVSRTQVETLRHNCA
EFGIRLHPMGDIEQGIVHIIGPQLGLTQPGTTVVCGDSHTSTHGAFGALA
MGIGTSEVEHVLATQTLPLRPFKTMAVNVEGALAEGVTAKDIILAVIAQI
GTGGGQGYVIEYRGSAIEALSMEARMTICNMSIEAGARAGMVAPDDTTYD
YLRGRPHAPSGADWDAAVAHWDSLRTDPGAKFDAEVFLDAGALTPFVTWG
TNPGQGVPLGAAVPDPETISDEAQRRAAEKALAYMDLRPGTPMRDIAVDT
VFVGSCTNGRIEDLRAVADVLRGRRVSESVRMLVVPGSMRVRNQAEAEGL
AEVFTAAGAEWRQPGCSMCLGMNPDQLSPGQRCASTSNRNFEGRQGKGGR
THLVSPVVAAATAVRGTLSAPADLN
333991329YP_004523943.1 DNA-binding protein HU [Mycobacterium sp. JDM601]MNKAELIEVLTKELDTDRRSATEAVEHFVNAIVRAVHKGESVTITGFGVF
ERRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAIVSGAQRVPSEGL
AVKRGAGASTTAAKKAAKKSPAKKATKAAAKKTAAKKATPAAAKKTAAKK
VTAKKTAAKKAAPAKKVTAKKTAAKKVTAKKAATKAPAKKVTAKKTAAKK
APAKKVTAKKTAAKKAPARKATKATARKGRK
333991327YP_004523941.1 polyphosphate kinase [Mycobacterium sp. JDM601]MDEIEVGQRTEPRTDETDWRPNDATPSAPPAATAVPPTDPGDELPAHRYL
NRELSWLDFNARVLALAADTSLPLLERAKFLAIFASNLDEFYMVRVAGLK
RRDEMGLSVRSADGLTPREQLRRIGEQTQQIATRHARVFLESVRPALADE
GIHIVTWADLQPDEREQLSEYFQEQVFPVLTPLAVDPAHPFPFVSGLSLN
LAVTVKRPEDGGSHFARVKVPDNVDRFVELDAGAKGGEGRGEIRFLPMEE
LIAAFLPVLFPGMEIVEHHAFRITRNADFEVEEDRDEDLLQALERELARR
RFGSPVRLEVADDMTENMLELLLRELDVNPGDVIEVPGLLDLSSLWQVYR
QDRPDLKDRTFVPATHPAFAERETPKSIFATLREGDVLVHHPYDSFATSV
QRFVEQAAADPGVLAIKQTLYRTSGDSPIVTALIDAAEAGKQVVALVEIK
ARFDEQANIKWARKLEQAGVHVVYGLIGLKTHCKVSLVVRREGSAIRRYC
HIGTGNYNSKTARLYEDIGLLTADPDIGADLTDLFNSLTGYSRKDTYRNL
LVAPHGVRAGIVERIEREVAAHRDSGGQGRIRLKLNSLVDEQVIDALYRA
SRAGVQVELVVRGICALRPGVEGFSENIVVRSILGRFLEHSRVIECSAIN
EFWIGSADMMHRNLDRRVEVMVQVKDPRLSAQLSDMFDSAMDPATRCWEL
GPDGQWTAAPREGATVRDHQVSLMERHRNP
333991325YP_004523939.1 glycerol-3-phosphate dehydrogenase [Mycobacterium sp. JDM601]MGTEGAEDTVAVMGAGAWGTALAKVLADAGSQVRLWARRSDIAAQINETR
RNPDYLPGFTVPEAVRATTDAAEALDGLTTVVLAVPAQTMRANLAAWTPQ
LTDGATLVSVAKGIELGTLMRMSQVVAAVTGVDPGQVAVVSGPNLAAEIA
AEQPAATVVACTDSGRAVALQRMLNTGYFRPYTNADVIGTEIGGACKNVI
ALACGMAAGVGLGENTAAAIITRGLAEIIRLGVALGAKGATLAGLAGVGD
LVATCTSPRSRNRSFGERLGQGEAMPPLPGSAGLAGTADGHVVEGVTSCQ
SVLALASSYDVEMPLTEAVHRVCHTGLSVNEAVALLLGRRTKPE
333991323YP_004523937.1 hypothetical protein JDM601_2683 [Mycobacterium sp. JDM601]MIDPGDDTDGPPRVALIAALVVAVAAVVAALAVAAAHRPESQPDEPLRIA
TVPAPHAGGAACRAVLDGLPQQLGDYHRAEIADPAPDGAAAWTAGANGTV
VLRCGLDRPADFVVGSPIQVVDQVQWFEVREGERATWYAVDRKVYLALTL
PRGSGPTPIQELSDLIADRLDAVPIRPGPPG
333991321YP_004523935.1 hypothetical protein JDM601_2681 [Mycobacterium sp. JDM601]MIAQLRFTDRAAYDRYQAEFAGVFRRYSGTLLAADESPEVVEGPWDREKV
VLMSFPDEDAFRQWAESPDYRRISRDRQAGADTVVLLVKGLA
333991319YP_004523933.1 50S ribosomal protein L28 [Mycobacterium sp. JDM601]MAAVCDICGKGPGFGKSVSHSHRRTSRRWDPNIQVVHAARPGGNKQRLNA
CTSCIKAGKVARG
333991317YP_004523931.1 ATP-dependent DNA helicase RecG [Mycobacterium sp. JDM601]MVTLADRLDFIVGSDAAGKLDDAFGIRTVGDLLRHYPRSYVEGTGVRGAA
DSRPEEGDHITVVDTIGSAVLKDMQRRKGKYLAVTVGSGRNKVSATFFNP
KGLRWRLTPGTRVMLSGEVKLYRGAIQLTHPDFLVLKEADGAAQQHNFGS
SSLRNIADASQKVSGQISQADFERSCYPIYPATAKLQSWDIFACVRQVLA
VLDPVPDPLPAAVRTERGLLSEDEALRAIHLSEKAVERDRARDRLAVDEA
FGLQWALAMRRHSELSESGLPAPRRADGLVAELLRRLPFELTAGQRDVLD
VLKAELGETRPMNRLLQGEVGSGKTIVALLAMLQLVDAGYQCALLAPTEV
LAAQHVRSIRDMLGPLALGGQLGGSDNATAVTLLTGSMAAAAKKQARAEI
ADGRAGIVVGTHALLVDAVEFANLGMVVVDEQHRFGVEQRDRLRAKAPDG
ITPHLLVMTATPIPRTVALTVYGDLETSTLRELPRGRQPIVSSVIFEKEK
PAWLERAFARIREEVAAGRQAYVVAPRIDESDDGAKSGAAEENGRTSATA
VGLFDQLRAGPLSGLRLGLMHGRLNGDEKDAVMAAFRSGAVDVLVCTTVI
EVGVDVPNATVMLIADADWFGISQLHQLRGRIGRGEHASLCLLVTSSSPK
SKAGKRLEAVAGTLDGFALADLDLRERGEGDVLGRNQSGWRGGLKLLSLA
DHGELIEAARDFCVRAWAADPSDPGLALLAEPFADIEYLDKA
333991315YP_004523929.1 oxidoreductase [Mycobacterium sp. JDM601]MTPGTAIPTVALNDGHSMPTLGLGVAELSDAETERAVAAALESGCRLIDT
AKVYGNEAAVGRAIAASGVPREELFVTTKLANADQGLTAAIRACQASLER
LGLDYVDLYLIHWPAPALGMYVDSFGGLIQAREQGLARSIGVCNFTPAHL
DDVIDLAFETPSVNQIELHPLLNQAELRTLHAERGIVTEAYSPLGVARLL
DHPAVTAIAGEYSKTPAQVLIRWSLQLGNVVIARSSQPERIAANLDVFGF
ELADEHMASLNGLDDGTRFREDPLTYTGV
333991313YP_004523927.1 lipase [Mycobacterium sp. JDM601]MLPIGLQRLMTGGRSVTIDGNTLDPTLRLALAGQRAVGINGIVVDDDAAA
SRAQLRELTAGLGGADIHGCEVRDIALPGPAGEIAARHYRPVGGPDGPDG
TAHPLLVFYHGGGFVVGDLDTHDAVCRLTCRDADVAVLSIDYRLAPEHPA
PAALDDAYAAFRWACEHAADLGAIPGRVAVGGDSAGGNLAAGVALLARDD
SGPAPILQWLLYPVTDSAAVTRSRTLYGDGYLLTKHDIDWFTAQYVGRSQ
LEPTDPRVSPLLAGDLSGLPPALIAVAGFDPLRDEGELFAAALRDAGVVV
DLRRMRSLTHGFINLFGLGGGSATATAALISALRAHFSRS
333991311YP_004523925.1 hypothetical protein JDM601_2671 [Mycobacterium sp. JDM601]MSIAAPTESPAPPAPGTQPAASTAWLTLIAGVIGLAASVTLTVEKIRLLT
DAAYVPSCNLNPVLSCGPVMATPQASVAGFPNPLMGIVAFTVVVVTGVLA
VAKVPLPHWYWVGLAIGTLGGAGFVHWLIFQSLYRIGALCPYCMVVWAVT
MLLLVTFTALALRPGRIHKSLQLLHRWRWTLIALWFIGLFLLVFIRFQDY
WLTLI
333991309YP_004523923.1 methyltransferase [Mycobacterium sp. JDM601]MREALFNVLDARLDLDGMAVLDLYAGSGALGLEALSRGAASALFIESDRR
AADVLSGNIATLGLPGATLRRGTVAAVLTAGSATPVDLVLADPPYEVPAA
DIDALPGLLVTGGWAGPGTVVVIERAATSPAVAWPEGWNVWPDRRYGDTR
LELAELV
333991307YP_004523921.1 hypothetical protein JDM601_2667 [Mycobacterium sp. JDM601]MLDVVTLDSADLDSLDRAPQAFSQVLGPLERNANHVCGGALRYAHYLRGG
MPGEIAWTRTADNAGNDPQAAHDNLSAELRTLFAQSGAGSLRAHHPM
333991305YP_004523919.1 transcription regulator AmtR [Mycobacterium sp. JDM601]MNTDRRGRPRLTASRRPGDSARDEILDAAAELFTTIGYSGTSTRRIAEAV
GMRQASLYHHFAAKEDILDALLAGTVDASLQLAAELRAEDGPAAPRLHTL
VVADTAQLCSGAWNLGSLYLLPELRVERFAVFRRRRDELRSHYRELSAAV
IAEHNGPAAADDLPFRLVESVINRRSDDGGCPPDYPWTVAEVALRVLGCT
SGFARMREATTERPGLPPG
333991303YP_004523917.1 hypothetical protein JDM601_2663 [Mycobacterium sp. JDM601]MVTVSDELVPAREPWSKVVRAGERLQIIDLHGNQAVDCLLYDATDHTRRY
SAQATVAAQRNIFVGTGSVLRAADGSALMTVVADDVGNHDTIAGACSQES
NTLRYGHHTAHQHACVENFLAEGARYGLGKRDLVSNINWFMNVPVEPDGT
LGIVDGISAPGKSLTLRAEIDTLVLVSNCPQINNPCNGFDPTPVRMVITR
E
333991301YP_004523915.1 hypothetical protein JDM601_2662 [Mycobacterium sp. JDM601]MLVQDLFSRVPTTAAEATEVFDASEAVDPDFMLGTWRGAELPTGHPLDGL
LAASGWWGKQFVDAETVHPLLFPTRDGSALWAFNPVLAFSVLGPATKLPG
LKKRSFAAPITRLQPLLRTRSAKARLRTTRYRGVDSATMLYDQAPINDVF
RRLSDDAVIGAMDLRGSPRPYFFVLCRDDSLKLV
333991299YP_004523913.1 hypothetical protein JDM601_2659 [Mycobacterium sp. JDM601]MYRVFEALDELGSIVEEARGVPMTAGCVVPRGDVLELIDDIRDAIPGELD
DAQDVLDARDSVLNEAKEHADSMVSSATTESDSLVSHARAEADRLLADAK
GQADRMVAEARAHSDRMLGEAREEAARLTATAKREFETATSRAQAECDRL
VDNGNAAYEKAVQEGIKEQQRLVSQNEVVTSARAEATRLIDSAHAEADRM
RGECDIYVDAKLAEFEDFLNGTLRSINRGRHQLRTAAGTHDYATR
333991297YP_004523911.1 ribonuclease III Rnc [Mycobacterium sp. JDM601]MSRPRQAVLEALGVDLPDDLLTLAVTHRSYAYENGGLPTNERLEFLGDAV
LGLTITDELFHRHPDRPEGDLAKLRSSVVNTAALADVARGLTEDGLGAHL
LLGRGEINTGGADKSSILADSMESLLGAVYLQHGIDTAREVILRLFGPLL
DTAATLGAGLDWKTSLQELTAARGIGVPCYQVSSTGPDHDREFTAIVVVS
DTEYGSGVGRSKKEAEQKAAAAAWTALDALDAG
333991295YP_004523909.1 mycothiol conjugate amidase Mca [Mycobacterium sp. JDM601]MATVVAFHAHPDDEAILTGGTLARAADDGHRVVLVVATDGRVSNDDVERL
GELRSSAQILGVHRVECLGYADSGFGPEFYPDPRGRVRFGRADTERAAEQ
LAAILRGEGADLLLSYQPNGGYGHRDHVQVHHVGKRAAELAATPRVLEAT
MPRESLLWVARAARLLRLPAPYPLDVARTAYAPQAAITHRINVFRFARQK
RDAFAAHRSQISGNAAAARLFAVLLRLPPQVAGLMFGREWFIDPTLPPGR
VYRDIFE
333991293YP_004523907.1 LuxR family transcriptional regulator [Mycobacterium sp. JDM601]MSGVDDFSQLISKIYSAVLAPEQWNEAVAAIARAFDAHASSLVYSDNGCR
TLKHTQMPAATAQAYAAYYQRLDHVFSAVEAGPLGAVRTGAELMWPHQQC
EFQADWAQPNGLYDGLFVRLTAGPPVTSLGIANVRRPERFDSPEHVEMVH
LLIPHLQQALRIQGRLHDLDHRSDDLAQASETVSHGIVIVERGRSVYANV
AADRILCAGDGLRVENGRIRAEASGADAQLQRSIGRAAELGDGDTWGGSF
LCPRRSGRRPYVVHVLPVHPNCVAAPVSGRSMVIIVDPEREAAPPALLLR
RLYGLTKSEAQVALLAMRGEGLNPIAEKLSISLTTVRTHLRHVFEKTGIH
RQAELVRILVTLDPATPLR
333991291YP_004523905.1 OsmC family protein [Mycobacterium sp. JDM601]MTKLWVERTGTRRYTGRSSRGAQVLIGSEGVDGVFTPGELLKIALAACSG
MSGDAALASRLGDGYPATIQVSGPADRQQERYPLLEETLEVDLSALGDSE
KQRLLTVVRRAVDQVCTVGRTLRAGTEVRFEIKGQDGR
333991289YP_004523903.1 chromosome partition protein Smc [Mycobacterium sp. JDM601]MHLKSLTLKGFKSFASPTTLRFEPGITAVVGPNGSGKSNVVDALAWVMGE
QGAKTLRGGKMEDVIFAGTSSRAPLGRAEVTVTIDNSDNALPIEYAEVSI
TRRMFRDGASEYEINGSSCRLMDIQELLSDSGIGREMHVIVGQGRLAQIL
ESRPEDRRAFIEEAAGVLKHRKRKEKAVRKLDAMSANLARLTDLTTELRR
QLKPLGRQAEVARRAATIQADLRDARLRLTADDLVTRQTEFAGAGDAEAT
LRREHDQITERLTAAADELTAHESAVATLTQRAEAAQQTWFSLSALAERV
SATVRIASERAQHLDEEPITTGGVDPDALEAEAEQVAAGEQQLLAELADA
GTRLEAARAELAERERRSAEAEKAHLAAVRAEADRREGLARLTGQVETVR
ARVESIDAHVAQLSGRIEEAAARAQAAQAEFETVQGRVGELDQGEVGLDE
QHERTVAALRLADERVAELQAAERAAERQVASLRARIDALSMGLERRDGA
AWLVQNHSGSGLFGSIAKLVKVRSGYEAALAAVLGSAADALAAENAGAAR
AALHALKSADGGRAAIVLGDWPLPQAPEQRAALPDGAQWALDLVDAPDRL
RGAMTAMLSAVAVVADLPAALELVTTRPGVRAVTLDGDLVGAGWVSGGSD
RKPSTLEINSEIDRARTELAGAETQVGQLSAALSGALTEQSARQDATEQA
LAALNESDAAIAATHEQLGRLGHEARAAETEWRRQLRERAELEAGRAQTV
TELGELEARLRNAEQDQPTAAVQPVDREQIAAAAEAARGVEVEARLAVRT
AEERANAVRGKADSLRRAAAAEREARVRAEQARAARALAATTAAAVADAG
SALARRLQLVVAAASRIRDGLAGERQQRAAAMATVRDEVNSLSTRITALT
ESLHRDEVAKAQAALRIEQLEQTVLEQFGMSSQDLIAEYGPDVPLPPTEL
EMAEFEQARERGEQVTAPAPMPFDRPTQERRAKRAERELAELGRVNPLAL
EEFAALEERYNFLSTQLEDVKAARKDLLDVVSDVDARILQVFTDAYADVE
REFREVFAALFPGGEGRLLLTDPTDMLTTGVDVEARPPGKKVKRLSLLSG
GEKSLTAIAMLVAIFRARPSPFYIMDEVEAALDDTNLRRLLALFEMLRAR
SQLIVITHQKPTMEVADALYGVTMQGDGITAVISQRIRGEELVSSPS
333991287YP_004523901.1 cell division protein FtsY [Mycobacterium sp. JDM601]MSEGLWIAIAVAAALVVIAALIFGLVRHRRRRISLSAPQRESLDRSGGYA
ASSGITFSRTEEAPAPVIGDDATVPRDAPRRTITDVDLPEAPPEPQAPPA
EAVQPAVEPVVEPDIEPVEGRMQRLRGRLAKSQNALGRSMLGLLGGGDLD
EDSWQDVEDTLLVADLGPVVTEAVVTQLREKLAGGQVRTEGQARTVLREV
LIGELQPALDRSVKALPHDEHPSVLLVVGVNGTGKTTTVGKLARVLVADG
RRVVLGAADTFRAAAADQLQTWAARVGAEVVRGAEGADPASVAFDAVDKG
VSSGADVVVVDTAGRLHTKTGLMDELGKVKRVVERRASVDEVLLVLDATI
GQNGLAQARVFADVVDITGVVLTKLDGTAKGGIVFRVQQELGVPVKLVGL
GEGPDDLAPFEPAAFVDALLG
333991285YP_004523899.1 hypothetical protein JDM601_2645 [Mycobacterium sp. JDM601]MSIGYDDALRDLIRARLVAHDRRVVTDPSKRHAAVAVVLVDSEIGEDRVD
PAPVDDWIGGRPMPEAGLDGRMVDVSGGAAFLLCRRTSRLTSHAAQWALP
GGRLDPGETAVDAALRELDEEVGIRLPDSAVLGLLDDYPTRSGYVISPVV
VWGGGRLDPRPAPDEVVAVYRVGLHQLQRDDSPRFISIPESPRPVVQIPL
GNDLIHAPTGAVLLQLRWLCLEGRGDPVDELEQPVFAWK
333991283YP_004523897.1 transcriptional regulator [Mycobacterium sp. JDM601]MTTPAAGHQPAESTEDAGAFADRIADALDAASLALLLSLGHQSGLFDTMA
GLLAPATSAQIADAAGLNERYVREWLGGVTVAGVIDYHPATATYRLPEHR
AAVVTRAAGPANLARVAQYIALLGEAEQQVLACFRDGGGLAYSEYPRFHT
VMAERSGEVFDAALVEVVLPLVDGLPQRLRAGADVADFGCGSGHAVNVMA
QEFGNSRFTGIDFSAEGIARASREAEQRGLTNATFESHDLSTFDRSGVYD
LVTAFDAIHDQAQPAPVLENIHRSLRPGGILLMADAKASSHLEDNVGVVT
NTYRYTVSLMHCMPVSLGLDGAGLGTMWGRQLAVSMLVDAGFADVEFTEI
AEDPSNYYYIATKS
333991281YP_004523895.1 PPE family protein PPE28 [Mycobacterium sp. JDM601]MVLGVVVGVSGATSPSAAASSAVAVPPQVQLTASDDVAAAAGGGTAFVMG
GSGIPLPSEGYVNAADIMYLRPNGFTGTAESLFTPQLYFPGNVSEVQGAQ
ILAAAINEQIASGQAGPDNPVYVFGYSQSAAMSSMTMEQLYHQGVPAEDV
HFVLVGNAANPNGGIVEMLNFWGGNLSFWNGMTLGHPTPDYFTTDVYTME
YDGYADFPRYPLNLLSTLNAIAGMFLTHIGYFGLSEDDIANAIALETTDP
DSLTNYYMIPAETLPLLDLLRLNPVWGSPLAALLEPSMRVLVNLGYGSLT
EGWNQGPANVPTTISWDLLPSNISWADINAALANAWTEGVQDAIKELQDP
TTYFPGGFMAEEPFSTIWNAAQRVYFDIQDPTSLFGGSAMATDPAGTSDF
TDFLGSLVDGNPDLSWITDIFGLDMISPA
333991279YP_004523893.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MTESLYQRLVAEGDDPEAPERVRVEHRGDRAVVTLHEPDRLNVLSAPLVR
QLRRALTTLDDDPQVRAVVVTGADPGFSAGGDLKMMSAITERRADPAPEG
VADVWRWIRREFGGVARLIATSDTIFIAALNGAAAGVGLAWALTCDLAIA
GDRAVIVPAFGRLGLLPEVGTSWALTRRLGYQGALAYYLRGEPIDAHTAQ
RLGLVHEVVAHDQLLAAADDWCSRVAAMPAHATAMAKPLLRAAADASWHE
AMALEEFAEPVCFSTAAFADNVRTMLAGHRDPPRRPD
333991277YP_004523891.1 hypothetical protein JDM601_2637 [Mycobacterium sp. JDM601]MLRQGDGGGQSVGSAAHHYCRAHAEAADFITVANQGADMVSGAYPAACAG
EQERRPSRTSEDSSV
333991275YP_004523889.1 signal recognition particle protein Ffh [Mycobacterium sp. JDM601]MFESLSDRLTGALQGLRSKGRLTDADIDATAREIRLALLEADVSLPVVRE
FIGRIKDRAKGAEVSGALNPAQQVVKIVNEELIGILGGQTRTLTFAKTPP
TVIMLAGLQGAGKTTLAGKLATWLRGQGHTPLLVACDLQRPGAVNQLQVV
GERAGVAVFAPHPGTSAHAHEAQIGPGDPVSVAAAGLAEAKAKHFDVVVV
DTAGRLGIDEEMMAQAAAIRDAVQPDEVLFVLDAMIGQDAVTTADAFREG
VGFTGVVLTKLDGDARGGAALSVREVTGAPILFASTGEKLEDFDVFHPDR
MASRILGMGDVLSLIEQAEQVFDAQKAEEAAAKIGTGELTLEDFLEQMLA
IRKMGPIGNLLGMLPGAGQMKDALAAVDDSQLDRLQAIIRGMTPAERADP
KIINASRRLRIANGSGVSVSEVNQLVDRFFEARKMMSSMMGGMGLPGLGR
KSATRKAKGGKNKAGKKGKRRGPTPPKAPGLFGPGGPGGMPAGFPDLSQL
PEGLNELPPGLADFDLSKLNFPGQK
333991273YP_004523887.1 D-alanyl-D-alanine carboxypeptidase DacB [Mycobacterium sp. JDM601]MRKILACWAMAATVLALLATTAAPASADVAQPLGSAPIPAGPAPNWLIAD
LDSGEVLAEQNGYAATPPASTIKVLLALVALDELNLDDTVVATPADTAVE
CNCLGIKPGRSYTARQLLEGLLLVSGNDAANALADMLGGPEAAVAKMNAK
AAAVGAAATHATTPSGLDGPGGSGATTPHDLAVIFRAAMANPVFAEITAQ
HAAMFPTESGERPIVNMNELLTRYPGAFGGKTGFTDAARKTYVGAAARDG
RRLVVAMMYGLIREGGPTYWDQAGALLDWGFAQGPMSGVGSL
333991271YP_004523885.1 30S ribosomal protein S16 [Mycobacterium sp. JDM601]MAVKIKLTRLGKIRNPQYRISVADARTRRDGRSIEVIGRYHPKEEPSLIE
IDSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAEGKLKVKPAKP
SKLELFNAALAEAEGGPTTEATTAKKKKAPKATEGKKAKDDAGEAKDDAK
AETPAEDTTAEAAAAEAAEPATES
333991269YP_004523883.1 16S rRNA-processing protein RimM [Mycobacterium sp. JDM601]MELTVGRVVKAHGITGEVVVDVRTDDPDERFTPGAVLCARKRGEQPRDVV
VDAVRPHGSRLLVRLAGVSDRDAADALRGSLLVIDSADLPPIDEDDTYYD
HQLEGLRVRTEAGEDIGTVTEVLHTGAGELLAVRRTDGAELLVPFVSAIV
TSVSLAEQLVWIDPPDGLLELSS
333991267YP_004523881.1 hypothetical protein JDM601_2628 [Mycobacterium sp. JDM601]MRPSMLLLTVVMVISTVVFGCDEKVYGAAATRPPQYRAPEVAPVATAIEA
PRAPAIPPVAVVDGLAARMQDATEEAAKAGANISVAVLDRISHQLVTNGN
THSIATASVAKLFIADDLLHDADGALSADDQAALDVMLRSSDDGAAETFW
NRRGGNAIVTRVAGRYGLAGTGPPSNGAWWNTISTAPDLARYYDMLLNGS
GGLPADRANMIISELAQSTPTGIDGYPQRFGIPEGLYNEPVAVKQGWMCC
IGNNWMHLSTGVVGADRRYVVVIESLQPSDDATARDTITQAVKTIFPGGR
I
333991265YP_004523879.1 signal peptidase I LepB [Mycobacterium sp. JDM601]MTETAGSSPENTPEADQPEADHVEADAAEAAAPDDRKRTTLRESAVLVAT
ALVLYYLVLTFVARPYLIPSESMEPTLHGCHGCVGDRIMVDKVTYRFSAP
RPGDVVVFKGPPSWNVGYKSIRSDNTAIRWVQNALSFIGFVPPDENDLVK
RVIAVGGQTVQCRNDTGLTVDGKALDEPYLNPATLMVDPMVYPCLGNEFG
PVTVPDGRLWVMGDNRTHSSDSRSHCDTVAVQPDLRHRVLCTGEDLDAGT
VPVSNVIGKTRFIAWPPSRWGPVKAINPQQGP
333991263YP_004523877.1 hypothetical protein JDM601_2623 [Mycobacterium sp. JDM601]MSAEDLEKYETEMELSLYREYKDIVGQFSYVVETERRFYLANSVEMVPRN
ADGEVYFELRLADAWVWDMYRPARFVKQVRVVTFKDVNIEEVEKPELRLP
E
333991261YP_004523875.1 PE family protein [Mycobacterium sp. JDM601]MDAVTTPQSFWPLTGVMNLTTNESIARGGQILAANIENQIAAGTVDAANP
LVVFGYSQGANVETTAMQQIHAAGVPSDAVHFVMVGNPANPDGGFLSRFA
VDIDGAMPTYPALGITFSGATPTDLYPTDIYTYEYDGFADFPRYPINLLA
DLNAILGMAFNHGGYLSPAAVDSAFLLGTDGLTSYYMIPSETLPLLAPLQ
FIPFIGKPLYSLLEPATAVLVNLGYGCIDNSWCEVPLPDGEPATFASYGP
FPSLDVDEVLNALWNGLQLGVSNAIADLQDPSYGPSIMDVPVLRPMLESA
YNVVGADPSGDPSAIGDLTGDQLWLGIVSQLGADGQAFELLQGAFPGMIP
DPPTSLMGIVNDIAVNIGNDFATLIPIANTVASLFTTIPSLAISFIAQEA
QSGNLFEGLGNAFSALVGLAPIALGVGTVVPVIEALAINALNFVELFDPN
ALQDLAALLVDVP
333991259YP_004523873.1 hypothetical protein JDM601_2619 [Mycobacterium sp. JDM601]MTTMTRAELGALGEQLAVDHLLGQGWTILARNWRCRYGELDVIADDPAAG
AVVFVEVKTRTGDGFGGLAYAVPPEKVRRVRRLAGLWLAGQQSHWVEVRV
DVIGVRIGRCRTPEITHLRGVV
333991257YP_004523871.1 hypothetical protein JDM601_2617 [Mycobacterium sp. JDM601]MSADEATLRAWAYLSRVAEPPRPELAALVARAGPVEAAKRIRCGDVEPEL
AKYTEARREIDSAAEDLELVARRGGRLVTPDDDEWPLLAFAAFGGAAAAR
KPDCRAPLVLWAVGPARLDEIAERATAIVGTRAATAYGELVAADLAAGLV
ERDMAVVSGGAYGIDGAAHRATLAADGTTVAVLAGGIDISYPAGHSALLH
RIGGNGLLVTEYPPGVRPVRHRFLTRNRLVAALAGATVVVEAGVRSGAAN
TAAWARLLGRPVAAVPGPITSAASAGCHVLLRAGAELVTRPDEVVELAGR
VGELADVPPHPVTPLDGLSAAGRQVYEALPGRGVATVDQVAIASGLAPAQ
VFGPLAMLEVAGLVERRDGSWAIVRRSR
333991255YP_004523869.1 L-lactate dehydrogenase (cytochrome) LldD1 [Mycobacterium sp. JDM60MAFGDYQFEIYLQGLAGVVPALPMTYSELEAKAAAALSPSVWSYVAGGAG
DERTQRANVTAFDGWGLIPRMFVGATERDLSIELFGLRLPSPVFMAPIGV
IGICAQDGHGDLASARAAAATGVPLMVSTLTADPLEDVAAEFGDTPGFFQ
LYTPKNRELAASLVRRAEAAGYRAIVVTLDTWVPGWRPRDLATSNFPQLR
GHCLSNYFSDPVFRAGLAQPPEENPQAAVLSWVQTFGNPLTWDDLGWLRS
LTDLPLIVKGICHPDDVRRAKDGGVDGIYCSTHGGRQANGGLPALDCLPD
VVAAADGLPVLFDSGVRTGADIIKALALGATAVGIGRPYAYGLALGGVDG
IVHVLRSLLAEADLIMAVDGYPSRLDLTPDTLRRVT
333991253YP_004523867.1 2-hydroxy-6-oxo-6-phenylhexa-2-4-dienoate hydrolase [Mycobacterium MTVRATLELPSGPVSYLDFRPDDAVRAVVLLHGGGVDSATLSWGEIGPRL
AAAGNRVIAPDHPGFGHSPPAPWPLTQQRLVSYVGRFVDALALDRYVIGG
LSLGGGMALGHVLQRPERTAGVMLLGSYGLMPRASDGALAGLRQAVTWAM
LRSGALALVGRWTARSPALLAWSVKTALIRDPARRTPELMAEITAAVEQD
SGVFEQWQRDEVRWNRLKTDYTARLPSLRCPALIIHGDKDTGVPVARARA
AAQLIPDASLSVLAGAGHWVQRERPAEVLAAMTQFLSRM
333991251YP_004523865.1 30S ribosomal protein S2 [Mycobacterium sp. JDM601]MAVVTMKQLLDSGTHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTFI
DKAYEFVKETVAHGGSIMFVGTKKQAQESVAAEATRVGMPYVNQRWLGGM
LTNFSTVHKRLQRLKELEAMEQTGGFEGRTKKEILMLTREKNKLERSLGG
IRDMAKVPSAVWVVDTNKEHIAVGEARKLGIPVIAILDTNCDPDLVDYPI
PGNDDAIRSAALLTKVIASAVAEGLQARAGQGNGEGKAEAEAVEPLAEWE
QELLASATTTATTSAPEAPAATDTTTTDAS
333991249YP_004523863.1 amidase [Mycobacterium sp. JDM601]MQHVHAFGDDALGDCDAVGLVERIRSGDVSPAELVDAAIARTEAVNPQLN
ALAYQAFDRARAEATAPRGGYFAGVPTFVKDNVDVAGMPTMQGTDAWQPR
AATADGDFARLYLATGLIALGKTQLSEFGFSAAAEHPRLGAVRNPWNTDH
TAAASSSGSAAFVAAGVVPIAHANDGGGSIRIPAACNGLIGLKPSRGRLP
LDRDMRAMPLRIVYNGVVTRSVRDTAAFYAEAERIWRNRKLPPVGDVKSP
GAERLRIAVITQSIARETSTEMRELTCKTAALLEELGHHVDYLDRPPVPA
HFADDFLLYWAFLATALVRGGRRMFGPSFDRSRLDSLTLGLDRHATRRLH
KLPLAIARLASVRRHTARMFRDYDVALTPTLAHETPRVGHLDPTAGYEQV
IDRLMDWVAFTPLQNVTGDPAISLPLAESAAGLPVGMMFSAHLGQDARLL
ELAYELEAAQPWPTITGRG
333991247YP_004523861.1 formate hydrogenase HycE [Mycobacterium sp. JDM601]MMAPINHCRPVSDAELPDAAAALLADGFRLALVAAHDDDDSLRVVYLFLA
GRPDRRCELTLTIPAQRPSIPSLARLSFQAGRFEREMQDLYGITPLDHPQ
PRRLIRHAHWPQDWHPMRNDAGPAPDFVAAGRFPFLNVEGAGVYEIPVGP
VHAGLIEPGHFRFSVVGESVLRLKARLWFVHRGIERLFAGRSAVGAVELA
ERISGDTSAGHALAHSLAVEEALGVELPDPAHRLRALLVELERLYNHVAD
LGALANDVGFGLANAHAQRAREQLLRINAQTTGDRLLRKAIRPGGVVLQA
LPDPNRLQALADDVAEIAELTLGHSVIYDRFAGTSVLNRTDAEALGTLGY
VARASGLVTDARLDHPITDLPVTEVTATAGDVLARYTVRRDEFAASVALC
RTLIDGHHGPIDVRAQLPGPAGAGNGVGIVEGWRGSIVHRVETGADGTIT
RAKIVDPSWFNWPALPLAMTDTIVPDFPLTNKSFNLSYAGNDL
333991245YP_004523859.1 hydrogenase HycP [Mycobacterium sp. JDM601]MSYNNMLDLAAGGVLLAAVLAVWRRDLSVTVQRLLVAQGAALAAIPLIRG
VHDHDRALIAVAIAVLAVRAVALPWLLARALGAERRERREATPLVGTAAS
LLVVTVLVVVAFVIAQPVIDLQRNSATTAAAAAIATVLIALFMMATRRHA
ISQAAGLLMLDNGIAATAFLLTAGVPLIVELGASLDVLFVLIVLGVLTGR
LRNTFGGVDLDLLRELRD
333991243YP_004523857.1 oxidoreductase [Mycobacterium sp. JDM601]MSTAAPQLLPRAAFGPLISGAATVGLGAGGLGAGVAGMFGALPTVRIGWL
LPLLGVQLRVEPLGGFFMVLTGAVAVAAGLYWIGYSRHEGFGAVPLTALP
VFVVTLLAVPAAGSVTTFLFAWELMALTSLVLVLTDQQRSEVRSAALIYA
VMTQLGFLTLLLGMVILAATTDDVFARIGAVPDGVRNTVFVLTLIGFGSK
AGLLPLHAWLPRAHPEAPSPVSALLSAAMVNLGVYGIIRIDMQLLGPGPR
WWALTLLAVGGVSAVYGVLQASVATDLKRLLAYSTTENIGLITLGLGAAM
LLAGAGSQPAAAVALTAALLHLIAHSAFKSLGFFAAGSVLAATGLRDLDR
LGGLVRRMPLTTALFGVAALGAAGLPLGAGFVSEWLLIQSLINARPGDDV
TIALVTPLAVAAVALTAGLGVAAMVKAFGFGFLARPRSDAAAAARESPET
MIAAMALPAAACVVLAVVPGAVAPMLNRVIATVPVFGDSPALGVFVRLPG
LDASMAPGLLAAALAAAVLLVAIGSRWRSRRRPAPATVPLWACGADELTP
RMQYTATSFAQPLQQVFDDVLRFDTGVEVSGQAPSTYVVDRIAYRARIAD
VIEDRWYTPVTRAVGAAAQLVRRAHTGSVHLYLAYGAIGVLIALLVAR
333991241YP_004523855.1 transcriptional regulator [Mycobacterium sp. JDM601]MVGAVPNSLHQVKAEFFKTLGHPARIRVLELLAERDRTVGELLPEIGLEA
SNLSQQLGVLRRAGVVTATKEGNTVVYSIASPVITELLAVARKALTGLLS
DQVAILDDLRARR
333991239YP_004523853.1 ribosome recycling factor Frr [Mycobacterium sp. JDM601]MIDEALFDAEEKMEKAVAVAREDLATVRTGRANPGMFSRIVIDYYGSPTP
ITQLCSINVPEARLVVIKPYEASQLGAIETAIRNSDLGLNPSNDGSLIRV
AVPQLTEERRKELVKQAKSKGEDAKVSVRNIRRKAMEELHRIRKDGEAGE
DEVGRAEKDLDRSTQQYVSQIDELVKHKEGELLEV
333991237YP_004523851.1 hypothetical protein JDM601_2597 [Mycobacterium sp. JDM601]MTQQLVFSAPRRALPPRHLADLDAAGRAAAVAELGLPAFRANQLAHQYYG
RLVADPQQMTDLPATVRASVAEALFPALLTAASEIECDAGETRKTLWRAH
DNTKFESVLMRYPRRNTVCISSQAGCGMACPFCATGQAGLTRNLSTAEIL
EQVRAAAVTLRDRDGARSSGVRLSNIVFMGMGEPLANYARVVAAVRRITE
PPPNGFGISARSVTVSTVGLAPAIRKLADEGLGVTLALSLHTPDDELRDT
LVPVNNRWKVDEALDAARYYADVTGRRVSIEYALIRDVNDQPWRADLLGR
KLHRALGQLVHVNVIPLNPTPGSDWDASPKPVEREFVRRVRAQGVECTVR
DTRGREIAAACGQLAAENA
333991235YP_004523849.1 transcriptional regulator [Mycobacterium sp. JDM601]MPDPAPNRSRAEHLGPQRRRPQVLDAALQIAADHGVAGVTMAAIAERIGV
TRPVVYACYDGRGEVLAALLDRETELMLASLLAALPPQRTGSVEDRFVAG
FGAFLSTVRERPASWRIIFTADQDPVLAAAVVSGRARLTDRVATVMRPLL
EQRAQSERTLAALTEVFLAICEAAARMLLDGDREWTPEGLAEVVGRAAYR
TFEIGG
333991233YP_004523847.1 hypothetical protein JDM601_2593 [Mycobacterium sp. JDM601]MNTLRGWLSLPDAEPAEDYGFFGPDSVTWKVWSYPTSLSIGFQRAVVIEE
LDPGLVASVDATQAIYDRPRTRYDRTLRYFAMVAFGESRTTAEAADILVR
IHSKAIGVDPVTGNNYDANDPAAQRWIHLTAWHSILYAYEKFGPGPLSAD
EEASYWADCAKAAELQTLDPADVPRTRAGVRAYFEQMRPDLVDSDIARRA
MAHLLHAEVIMPPSLPRVLWPATLVITAFLRRGTLATMPRWMRKLGGLKA
TDTSRVLDALIVPPLNATFTVLSLSTRVQLMLLRLISPMTLPIGTRVLRS
IRPVNPVTTTPREAQRRFGYAVPAQAHLEFREKQANRVFGEGRAPSDEAL
VESQPILGSIG
333991231YP_004523845.1 hypothetical protein JDM601_2591 [Mycobacterium sp. JDM601]MTLQAHNPIKLIDYYVDTFGFVETARCGVDGDTIAHAELIWPEGCGGIML
GSHKPGNEWCREPGTTGAYVVTADPDGLYQRVVSRDADVVRPLAGTDYGA
REFVVRDPEGNLWSFGDYTGEPRD
333991229YP_004523843.1 transmembrane protein [Mycobacterium sp. JDM601]MFAVGIALFALAILVSVALHECGHMWVARATGMKVRRYFVGFGTTLWSTR
RGDTEYGLKAIPAGGFCDIAGMTAVEELAPDEVERAMYKQQTWKRVAVLF
AGPGMNFVIGLVLVYAIATIWGLPNLHAPTSAVIGETACVAPEVVKGELG
TCSGPGPAALAGVRAGDVVVKVGDTPVSTFEEMAAAVRKQHGTVPIVVER
DGHELTKYVDVTPTQRWIADGRDSEAVPSTVGAIGVGAAQFGPTQYNPIT
AVPATFTFSGDLAVLLGKSLANIPSKVGALMHAIGNPNGERDPETPISVV
GASIIGGDTVDHGLWVAFWFFLAQLNFILGVLNLVPLLPFDGGHIAIALY
EKLRNMVRSARGKVAAAPVNYLKLMPATYVVLIVVVGYMLLTVTADLVNP
IRLF
333991227YP_004523841.1 hypothetical protein JDM601_2587 [Mycobacterium sp. JDM601]MSAPPDFRLDQRRVSVARDVGAVWRVLDADPVGSCMVAARVADHGVDPRS
IGGELWTRGGVDESLCYAGANLIPLRGTPADLTAFADKAVSAIRRCSSLV
GRAELVLPMWQRLVDVWGPARDVRESQPLMALRTMPDCAMDPEVRQVRPD
ELDAYLVAAVDMFIGEVGVDPRLGDGGRAYRRRVANLIAAGRAWARFERG
EVVFKAEVGSQSPAVGQIQGVWVHPERRGQGLGSGGTAMLAAVIVGTGRV
ASLYVNDFNEVARATYERVGFTQTGTFATVLLD
333991225YP_004523839.1 hypothetical protein JDM601_2585 [Mycobacterium sp. JDM601]MTGLDDVALRISDADRNGTLRRLHNAVSLGLIDIGEFEERAAQVSQARMR
SELDTLIGDLPGPRAIVSSAADRVELRGWAGSLKRHGEWIVPTRLALVRR
LGSVDLDLTKARFAGPVVVIELDMRCGSVAIRLPDGASASIDDVEVYFGS
AKDHRRDAPAEGTPHVVLAGRVVCGSVDIKGPQRKLRWRR
333991223YP_004523837.1 hypothetical protein JDM601_2583 [Mycobacterium sp. JDM601]MPGTMMTIDGFPIPIDVAGPHNGPVVVMLAAAQHPLTAYEAVCQRLHTAS
LRTIVIGADSRLTPKAVVGILDSLGVQCGVLVGDRSGGDNAWELAATRPD
RFTGLVVLDRGHPRAPDLGGAIRDERCPPVEINTTVLVSSRAAASVAEAS
QRFVYGEHRLVMLPGRRSASEFTAQLAMEIVLRASTW
333991221YP_004523835.1 glutamine synthetase [Mycobacterium sp. JDM601]MTRPAMLSQIELQQLVGSGDIDTVVVAFTDMQGRLVGKRVAAQHFLDEVA
GHGAECCSYLLAVDVEMNTVPGYPIADWGTGYGDLVLRPDFATLRRIPWL
PGTAHVLADARWPDGSQVAVSPRQILTAQLARLAERGLVAYAATELEFLV
FDDSYRQAWAAGYRGLTAATDYNADYGLVAGARLEPLLRDIRLGMAGAGM
RCEGVKGECHTGQQEITFRYEEALVACDNHSVYKSGAKEIADQHGKSLTF
MAKFDEREGNSCHVHLSLRSADGEAVFADPAAPHGMSGLFRSFLAGQLAT
LAELTLCYAPNINSYKRFVGGSFAPTVIGWGLDNRTCALRVIGGGDSLRV
ECRVPGGDVNPYLAVAALIAAGLHGIDNDLELPDPVDGDAYRAGLPQLPT
TLAEAAAAFAESAVARKAFGDDVVEHYLHGARVEMDAFNTAVTDWERVRG
FERF
333991219YP_004523833.1 NAD dependent aldehyde dehydrogenase [Mycobacterium sp. JDM601]MTTHDLINPATGAAFGSVEHVDAAAVDDAVGRAQAAQRRWARSAPAARAS
ALRDFAAAVDAHVDELAALEVSNAGHPVSAAEWEAGHVRDVLQFYAASPE
RLSGQQIPVAGGLDVTFHEPLGVVGIITPWNFPMPIAAWGFAPALAAGNA
VLIKPAEWTPLTTIRLAELAVHAGLDPDLLQVLPGPGAEVGERLVTHPGV
AKIVFTGSTVTGTRVLAAAAPGVKRVTLELGGKSANIVFADCDLEQAAAT
APYGVFDNAGQDCCARSRILVQASVYDRFMELLEPAVAGVVVGDPASRDT
EMGPLVSRPHWEKVASYVPDDAPVAFRGRAPDGPGFWFPPTVLTPARDDR
CVTEEIFGPVVTVLPFEDEADAVALANDTVYGLSGSIWTDDLSRALRMSR
AVEAGNLSVNSHSSVRFNTPFGGFKQSGLGRELGPDAPLAFTDTKNVFIA
VKEM
333991217YP_004523831.1 hypothetical protein JDM601_2577 [Mycobacterium sp. JDM601]MRSSDREEIVEAFDALSADLDKALELDFSALTPRECLALLQRCETLRRRL
PAVEHPMVNHVAATDPEELGGKPRWVLADELGITRGQARRRIDEAADLGP
RRTLTGQPLAPVLPAVATAQRKGQLGAERIAVIRALFDYLPDSIDAGTLA
QAEQHLADLAAHHRPDELAKLAQRVADYLRPDGNHTDNEQRAKRRGITLG
PQDRDGMSAIKGHLDPHARAALDAVLAHWAAPGRCNPADETPCRSGTPSQ
AHIDNDRRSAAQRNHDALAAMATNLLASAELGSHHGLPATIVVSLSLAEL
EAAAGKATTAGGTWLPLHDVIALASHAHHYLRIYDGAKQIALFHTKRLAT
PGQRLVLYDTERGCTHPGCTVPAQLTEVHHNHDYAQHPRTDIDDLTLRCG
PHHRLLSNGWRTRKRADGVTETLPLAHLDRGQPRTNSYHHPEKLLRDSAN
DDDGP
333991215YP_004523829.1 tetracycline repressor [Mycobacterium sp. JDM601]MTKNQGVVRARAGLGVHDVVRAAFVVLDGQGIAKLSTRAIATELDVSMNT
VMWHIGTKGRLLELMADAIVGEAEADQLHGDWRRRAAQLLGRLRQAMLRH
RDGAVVVAGTFPALPATLAFGDRLVAVLRSGGVAAKPAAWTAWSLFYFTL
GLVQEEQRAPDALPSGLPDVVTEKDFPNLHAVLDDFLSADYEARFRFGIG
QILASLG
333991213YP_004523827.1 NADPH-dependent mycothiol reductase Mtr [Mycobacterium sp. JDM601]MESYDLAIIGTGSGNSILDERYADKRVAICEQGTFGGTCLNVGCIPTKMF
VYAAEVAATVTRAARYGVDARIEKVRWNDIVSRVFGRIDPIATGGEEYRR
SLPNVDVYDQHTRFAPVGSDGGYVLRTAGGEQFSAAQVVIAAGARSWIPP
VIADSGVHYYTSDDVMRMAELPEHLVIIGGGFIAAEFAHVFSALGVRVTV
VIRGSTLLRHCDETVAERFTRIAAGKWELRSQRNVVAARQETPAHTGVIL
ELDDGSILRADALLVATGRVPNGDLLEAGQAGIDIAGGRVVVDKYQRTTA
RGVFALGDVSSPYELKHVANHEARVVQHNLLCDWDDVDAMRITDHRYVPF
AVFTDPQIAAVGLTENQARAKGLDISVKIQDYGDVAYGWAMEDTTGFVKL
IAERGTGRLLGAHIMGYQASSIVQPLIQAMSFGLTAADMARGQYWIHPAL
PEVVENALLGLE
333991211YP_004523825.1 multifunctional enzyme siroheme synthase CysG [Mycobacterium sp. JDMTENPYLVGLRLAGRKVVVVGAGGVAQRRLPLLVDSGAQVVVIAPGATPS
VEALGERKPGITLVSRAYRDGDLTDAWYAIAATDDPDVNAAVVAEADRRR
IFCVRADLAVEGSAVTPASFSYAGLSVGVLAGGEHSRSAAIRSAIREALQ
SGLIAMDVEATSDVVRGGVALVGGGPGDPELITVRGRRMLSHADVVVADR
LAPPELLAELPPHVEVIDAAKIPYGRAMAQDAINALMIERAAAGKFVVRL
KGGDPFVFARGYEEVLACTDAGIPVTVVPGVTSAIAVPAQAGVPVTHRAV
NHEFVVVSGHIAPDDPESLVNWDALAAMRGTIVLLMAVERIEQFSAVLQK
GGRPADTPVLVVQHGTTPAQHTLRATLADAPEKIRAEGIRPPAIVVIGAV
AGFGV
333991209YP_004523823.1 prolyl-tRNA synthetase [Mycobacterium sp. JDM601]MITRMSELFLRTLRDDPADAEVPSHKLLIRAGYIRPIAPGLYSWLPLGLR
VLRNIEKVVREEMNAIGGQEILFPALLPRAPYETTNRWTEYGEGLFRLKD
RRDNDYLLGPTHEELFTLTVKGEYSSYKDFPVVLYQIQTKYRDEARPRAG
ILRGREFVMKDSYSFDVDDAGLQAAYGAHRVAYQRIFDRLGVRYVIVSAV
SGAMGGSASEEFLAESEVGEDTFVRCPESGYAANVEAVITARPQPQPIEG
LPEPKVHDTGNTPTIATLVDWANGAGLGRSVTAADTLKNVLLKVRLPGGE
WHLLGIGLPGDREVDEKRLGAALDPAEYALLSDDDFAEHPFLVKGYIGPK
ALQDNGIRYLVDPRVVDGTSWITGADAPGKHVVGLVAGRDFTADGTIEAA
EVRDGDPSPDGAGTLVSARGIEIAHIFQLGRKYTDAFAADVLGEDGRPVR
LTMGSYGVGVSRLVAVIAEQQHDELGLRWPAQVAPFDVHLVIANKDDAAR
AGATELAAELDRLGLEVLFDDRQASPGVKFKDAELLGVPWIVVLGRGWAD
GVVELRDRFSGQTRELSIDADLAGQVLAAVRAEAG
333991207YP_004523821.1 hypothetical protein JDM601_2567 [Mycobacterium sp. JDM601]MSGPLTAIDRRRLLSGAGMVALIALAAPACGSAPAPPAVDDLEAQRQLAQ
HDSELATAAAAALTRAPDPDAKALAAALDQVSLERAEHARALAAEIARAA
RRPAPEATASSTPADVPDGPAPTVSEVVSALRAAADSAGRLATTATGYRA
GLLASVAAACTASYAVALVVQS
333991205YP_004523819.1 N utilization substance protein A [Mycobacterium sp. JDM601]MNIDMAALHAIEADKGIPVEVVVETIKSALLTAYRHTEGHQADAVIDVDR
KSGMVRVLARETDADGNIISEYDDTPEGFGRIAATTARQVILQRLRDAEN
EKAYGEFSAREGDIVAGVVQRDARENARGVVVVRLGTEAKGFDGVIRPSE
QAPGEAYEHGDRLRCYVIGVTRGLREPRIELSRTHPNLVRKLFALEVPEI
ADGSVEIVAVAREPGHRSKIAVASGVPGLNAKGACIGPMGQRVRNVMSEL
AGEKIDIIDYDEDPARFVGNALSPAKVMSVTVIDQTARAARVVVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRSDTPEPGANGAEQEVGGGVAQEH
333991203YP_004523817.1 translation initiation factor IF-2 [Mycobacterium sp. JDM601]MAKARVHELAKQLGVTSKEVLARLSEQGEFVKSASSTVEAPVARRLRESF
GGGKAAAKSEEPAKAPAKSAASAPPKAAPAAADGVAVEAVKAPTPAAPAA
KPSAPPAPAAEAPAPAAPPPAPPQPGPPPAPGPRPATPGPKPGARTPRVG
NNPFSSAQPAERAIPRPHPQAPRPGAPRPGMPRPGGGATPGNMPGRTSNF
GAQGRPARPGGPPRPGGGGRPGGPGGRPGGPGGGPGGNYRGGPGGGGGAP
AGAGAGGFRGRPGGGGRPGQRGGAAGAFGRPGGAPKRGRKSKRAKRAEYE
NMQAPVVGGVRLPHGNGETIRLARGASLSDFAEKIDANPAALVQALFNLG
EMVTATQSVGDETLELLGSEMNFVVQVVSPEDEDRELLESFDLSYGEDSG
DEEDLQSRPPVVTVMGHVDHGKTRLLDTIRKANVREAEAGGITQHIGAYQ
VGVDFDGSERLITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQ
TVEAINHAQAADVPIVVAVNKIDKEGADPSKIRGQLTEYGLVPEEFGGET
LFVDISAKQGTNIEALEEAVLLTADAALDLRANPDMEAQGVAIEAHLDRG
RGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEHGDDVEAALPSRPVQ
VIGFTSVPGAGDNLLVVDEDRIARQIADKRNARKRNALAARSRKRISLED
LDSALKETSQLNLILKGDNAGTVEALEEALMGIQIDDEVQLRVIDRGVGG
ITETNVNLASASDAIIIGFNVRAEGKATELANRDGVEIRYYSIIYQAIEE
IESALKGMLKPVFEEKELGRAEIRAIFRSSKVGNIAGCLVTSGIMRRNAK
ARLLRDSVVVAENLTVSSLRREKDDVTEVRDGYECGLTLTYNDIKEGDVV
ETYELVEKARV
333991201YP_004523815.1 hypothetical protein JDM601_2561 [Mycobacterium sp. JDM601]MELLAGANTLAVICHVHPDADTIGAGLALAMVLRRRGKQVQVCFARPACP
SELPQSLQSLPGGELLVSPEALRADADLVVTVDVSSADRLGALQQLAAAC
PELLVVDHHASNELFGTANFVDPSADSTTMLVAELIDAWGEPIDADVAHC
LYAGLATDTGSFRWATARAYRLAARLVGAGVDNAAITRTVMDTHPFDWLT
LLSRVLADARLLPDAVRGRGLVYAVVDNAEWTAARPEEVESIVDIVRTTQ
QAEVAAVFKEVEPGCWAVSMRAKSAVDLSAVAVSFGGGGHRLAAGYTATG
GAQDVVAALVAALA
333991199YP_004523813.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MSDDILLVQTQDRVRTLTLNRPQARNALSRALRDAVFSALAEADADADVD
VMILTGADPVFCAGLDLKEFGDSDSTALPDISPQWPPLTKPVIGAINGAA
VTGGLELALYCDLLIASEQARFADTHARVGLMPSWGLSVRLPQRVGVGLA
RRMSLTGDYLNAADALRAGLVTQVVPHAELLATAREVAASIVGNNQAAVR
ALLASYHRIDESQTATGLWIEAMAAKQWLHTLSSADVAANRAAVLERGRA
QVRSDRSNDPAGLPHRDHPRRDVAGHHAAGADDGVGPDRHARADDDAGCQ
PDVIADGDRRR
333991197YP_004523811.1 hypothetical protein JDM601_2557 [Mycobacterium sp. JDM601]MMSAASDPLDNRGLGVQAPDWSPARETGMKPTEPIPLRQTRTRRTVDLSP
AQHRGLDLWQREAADRVGCARITGQEVMTALIDQLLADPDLSAQIIRTLR
SRR
333991195YP_004523809.1 hypothetical protein JDM601_2554 [Mycobacterium sp. JDM601]MASLVVVVTAKSAAPNADGGRRGSARHGVALMTVLGVAAILAGCDRSVES
APAGSAAPRPAAAQSTQDAAAYDISRVDAVKDDFPEGFTAQAHPAKTLGQ
QDIAGSGVVAFTDAQFDPPQCRSVVIPPYVDPTVGTEAAGVIGQGDQGNM
YVVAMRSPKPVATADDPVGCDRISLSGSPQATGTVERIPAPAIPGVSTTG
VKLTVADPEEDPDYLYTAALNDRTSIVVMGSADQQLDPQRLMSDLLVKAV
AAVRGQ
333991193YP_004523807.1 hydrolase [Mycobacterium sp. JDM601]MKTARRLTGPRFTDVVLNRAALRRLPAPTTGYTVHREAIPMRDGVVLRAE
RYQPTGDAVGTLLVRCPYGRGFPFSLVFARMYAARGYRVILQSVRGTFGS
GGVFEPMVNEAADGADTVAWLRTQPWFTGTFGTIGLSYLGFTQWALLADP
PPELAAAVITVGPHDLYQSTWGAGSFALNDFLGWSHMMAHQEDRPRIRAG
INQLTAQRKVRRAAARLPLGAAGRALLGNGSPWYESWVEHPERDDPFWDR
LRHPAALENSRVPVLLLGGWQDLFLDQTLAQYRALRDRNVDVAMTIGPWT
HTQMLTSGLGRVTAESLQWLETHLRGSTTSVRPSRVRIFRTGKGWEDRPD
WESADATDAWYLQPGGRLAPRRMSPAAPAVSFRFDPADPPPTIGGRLLSP
AAGYRNDSRLHRRDDVLGFTGEALTEDLDVSGVPVLELDHSSDVPDVDLF
VRVSEVDRKGRSVNVTDGYRRLQHHTGRVCIELDAIAHRFAAGSRIRVLI
AGGSHPRYAANLGTGEAPISGVRVQPATHTVRFGDSRLLLPRDP
333991191YP_004523805.1 hypothetical protein JDM601_2551 [Mycobacterium sp. JDM601]MTIPEPRTSHGPTLWAISDLHTGHLGNKPVTESLHPATPDDWLIVAGDVA
ERTDEIRWSLDLLRKRFAKVIWVPGNHELWTTTKDPMQVFGRSRYDYLVD
MCDQMGVITPEHPFPLWTEEGGPATIVPMFLLYDYTFLPAGATTKAEGLA
VARENNVVATDEFLLSPEPYGTRDAWCRDRVAVTRKRLEDLDWMTPTVLV
NHFPMVRQPCDALFYPEFSLWCGTVETADWHTRYNATCSVYGHLHIPRTT
FYDGVRFEEVSVGYPREWRVRKPHRWLRQVLPDPQYPPGYLNEFGGHFVI
TDEMRAARAKFAERLRQRQSR
333991189YP_004523803.1 tRNA pseudouridine synthase B TruB [Mycobacterium sp. JDM601]MQPGLVVVDKPAGITSHDVVARCRRFFGTRKVGHAGTLDPMATGVLVVGI
ERATKILGLLTTSSKSYAATIRLGQTTSTEDAEGEVLQTVSADHLTDSQI
AEAIAGLRGDIAQVPSAVSAIKVSGKRSYQLAREGNAVELPARPVRIERF
ELLDARRAGDFIDLDVEVDCSAGTYIRALARDLGDELGVGGHLTALRRTR
AGSFGLDQARTLEELGENPRLSYSLDEACLQTFPRRALSADEALDVSHGR
PLTPAGIDGVYAAAAPDGRVIALLEDSGKRTKSVVVIRPATL
333991187YP_004523801.1 transcriptional regulator [Mycobacterium sp. JDM601]MRRTQAERSAAMRERLLDATIECLVAYGYAGTTTPRIAELAGVTRGAQIH
HFKSKEDLVVAAVEHLAQQRTRAAIRELGQVRSIPDPVATALDFLWEAHQ
GPMFIATVELWVAARTDRVLAQHIERVEAVVNGTLVAAIAQLMPEHPAQK
EIRNVVYTAMDVLRGILVSNFVDDDPQRARRRWERACVHLRQVAAGVLPQ
PD
333991185YP_004523799.1 hypothetical protein JDM601_2545 [Mycobacterium sp. JDM601]MGHIEATKQLSVSPDALWATVADPSTWDQWFTIHEKWLQEPPATLTEGTT
LVAKIVMLGMANKVEWKVDHVDAPTSLTMSGTGMAGVKCQFQFSVTPSGD
GSEFKVAGDFEGALIKGALGKAVEKDGAKQLDKTLTQLEALASAAA
333991183YP_004523797.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MAALEGRVAVITGAGRGIGREHALLFAAEGASVVVNDLGGSNAGEGSDAG
PAQQVVEEITAAGGKAVANTENISSWDGAKGLVQQAIDEFGRLDVLVNNA
GILRDAFIPGMAESQWDAVINVHLKGHFAMLHHAAAYWKAQSKAGDQPNA
AVINTASGSGVTLPNAGQANYGAAKAGIAALTLIAAEELDRYGVRVNAIA
PIARTRLTLATPGMGALMAEPEEGEVDLFSPANISPLVAYLATDKCPVTG
KVYAVQGGAISALAGWHDTETIETDGVWQIDDIAARLPQ
333991181YP_004523795.1 hypothetical protein JDM601_2541 [Mycobacterium sp. JDM601]MSNLAELGDWLSLHQGWRSALPDELAVGTTLVGVAGAKGMRNRVSWTVRK
YEPPALLEISGEGVGGTKYGLALAIAPAASGSRFTLRLDMGGRPLFGPIG
ATAVRAVKGDIERSIKQFETLYA
333991179YP_004523793.1 transcriptional repressor SirR [Mycobacterium sp. JDM601]MSPWEQSDGLTTVAQDYLKVIWTAQEWSPDKVSTKMLAEKIGVSASTASE
SIRKLADAGLVDHEKYGAVSLTEDGRRAALAMVRRHRLIETFLVRELGYS
WDEVHDEAEVLEHAVSDLMIARIDAKLGFPQRDPHGDPIPAADGKVPTPP
ARQLWECADGDSGTVARISDDDPEMLRYFDGVGISLDARVQVLTRREFAG
IISVALELPEGELATIDLGSPAAQAIWVV
333991177YP_004523791.1 30S ribosomal protein S15 [Mycobacterium sp. JDM601]MALTAEQKKEILGSYGLHETDTGSPEAQVALLTKRITDLTEHLKTHKHDH
HSRRGLLLLVGRRRRLLKYLAQVDVARYRSLIERLGLRR
333991175YP_004523789.1 bifunctional polyribonucleotide nucleotidyltransferase GpsI [MycobaMSAIEIEEGVFESTATLDNGSFGTRTIRFETGRLAQQAAGSVVAYLDDET
MLLSATTASKAPKDHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLTDRPLRPSFVEGLRNEVQVVVTVLSLDPKDLYDVVAINAASAST
QLAGLPFSGPVGAARVALIDGSWVAFPTIEQLERATFDMVLAGRAVEATG
GGTDVAIMMVEAEATDNVIELIEAGAQAPTEAVVAEGLEAAKPFIAALCK
AQQELADAAARPTAEYPLFPPYGDDVYYSVASVATDELAKALTIAGKAER
DERTEEIKAEVVARLAETYEGREKEISAAYRSLTKKLVRQRILTDHFRID
GRGITDIRALSAEVAVIPRAHGSALFERGETQIMGVTTLDMMKMAQQIDS
LGPETSKRYMHHYNFPPYSTGETGRVGSPKRREIGHGALAERALVPVLPS
VEEFPYAIRQVSEALSSNGSTSMGSVCASTLALLNAGVPLKAPVAGIAMG
LVSDDVEVDGKTERRFVALTDILGAEDAFGDMDFKVAGTKDFVTALQLDT
KLDGIPSQVLAGALAQAKDARLTILEVMAEAIDAPDEMSPYAPRVTTIKV
PVDKIGEVIGPKGKMINSITEETGAQISIEDDGTVFVGATDGPSAQAAID
KINAIANPQLPKIGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGKGK
RVAKVEDVVKVGDKLRVEIADIDNRGKISLVPVEDSAESADSGQGSAQPV
DAAATES
333991173YP_004523787.1 oxidoreductase [Mycobacterium sp. JDM601]MVFSFSELAIPLVGAPMAGGPSTPALAAAVSAAGGLGFVAGGYRTPQQLA
DEITAARDATTGPIGANLLVPQPSGADVVLLDDYADLLDPLAEHYGVELG
RPRFGDDDCWPEKLEVIADLRPTAVSFTFGTPSPDQLERLRALRILTMVT
VTSAYEAGIAVAHGAEVLVVQGPDAGGHRGTFAPDMQPGNDSLEDLLAEI
GHAHSDVPLVAAGGLGTAAAVAGVLGRGAVAAQIGTALLLADEAGTNPTH
RAALTNPEFGNTTVTCAFSGRYARSLENDFTRAFDNVAPVGYPEINHMTT
PIRAAAVAMDDPHGTSLWAGTAYRAARSGPAADIVAGLASG
333991171YP_004523785.1 PE-PGRS family protein [Mycobacterium sp. JDM601]MSFLTADPEALRAAADCLSSTGGALASQNTAAQVPTTGVLPPAADEISAM
LAARFTTQAQHYQQVSAQAAAIHEMFVATLNGSASTYAAAEAANAVAAG
333991169YP_004523783.1 epoxide hydrolase [Mycobacterium sp. JDM601]MTATDGVALAVHAYTDVDPRRPTILAIHGYPDNHHVWDGVAHKLLENHPG
KYNVVAYDVRGAGASSPPADRSGYRLPQLIADVGAVIAHLGVDDVHLLGH
DWGSIQGWAAVTDPVVGPKVASYTSISGPHLDYAGKFLRSPRNPRTLLAV
ARQVLESAYIWLFLTPRLPEAIFRSGFGGRLIAALERIGRSGASPWETLR
GQNDYLNGLNLYRANMPRPLFKPATPLPTTDVAVQVLAPRLDLFVSPAVQ
RFTGAIPPRHRVLDIDGGHWVVTDRPEIVARLTDEWVEQNMTGSADTPDS
DMRQS
333991167YP_004523781.1 lipase [Mycobacterium sp. JDM601]MSGAGPIHSASLPAKLIFAVANAVTPRLVRRLVLHAGSGTVAGRMTKMGR
RINTIARLQRVRPFFGVGFTRGAGADVPVEVVRRVERSRPLGQAFAGGAI
LYFHGGGFITGGLDTHLHVVAKLARRTRLPVVHADYRQFPQVTVDGSVDD
CVGAYRWLLSQGADPAKTVLAGDSAGGFLAFATALTGQQRGLPAPAGVIG
ISALLELDGVARDTHTNQSADAFGIPAVLPDLIDLVCPSAKLRHELSPIN
GRLDTMPPALLIAAESEILRCDAERLHTALQQLGRSSRLELWARQLHAFP
ALFPFLPESRAAFDLMCRFVAERLAEADRPGETRREVS
333991165YP_004523779.1 transmembrane protein [Mycobacterium sp. JDM601]MVKVSAAARTKALIAFMCLALLMYLVFLGRTAVLLIASGSAPAIGMGLAL
LIMPFIGLWAMIATLRDGFTHQRLSRLIAADGMELDAGALPRRPSGRIER
DAADALFRTVRDELDAEPDDWRRWYRLARAYEFAGDRRRAREAMKTAVRL
QESR
333991163YP_004523777.1 hypothetical protein JDM601_2523 [Mycobacterium sp. JDM601]MTRYLTGVLAAMMVATGMMAGLGIGSAPHAHAGCQDNPLLFFSTAQKCDG
PIQPDGSWQRCVIYYYEPPKSPPSQQDCHQMGPLGRQYPFHSFYQPETHI
GP
333991161YP_004523775.1 hypothetical protein JDM601_2521 [Mycobacterium sp. JDM601]MTLGAAPVFGGALLTAAAGQLRGPDPRNLIKQDLDLLDRIPAEQAERRAG
LQRTIDERIDDLVAAFDRSRALRAAAISYQGNWRDVVLFVCSVLFSYVWW
HVDHERGNWLPLFVVLILACVMTAVYALRGTMRALASARRRRS
333991159YP_004523773.1 bifunctional acetyl-/propionyl-coenzyme A carboxylase subunit alphaMSASHAPPKAVLVANRGEIALRIIRTAAESGYRTVAVYAPDDADSPHVRA
ADDAIGLPGTGPAGYLDQAAILAAAEESGTVLIHPGYGFLSENPTFARAV
AGAGRIFVGPDPGLLDTFGDKSAARAAAITAGLPVPAATDGTGGLEQIRD
FLRAHPGGIMLKALAGGGGRGIRTVREAGQLEDAYRWCTEEARLGFGAAA
VFAEEFVAEARHIEVQIVGDGVRALAVGDRDCSIQRRYQKLIEVAPAPAV
SDGLRTALHRAAARLCAAVRYRGLATVEFLVTGDDFVFLEVNPRIQVEHP
VTEAVSGLDLVAVQFRIAEGAALGELDLPAGVVAADGRETGEPARCHGIA
VECRVNAETVAADGAVQPCVGTLTAFTPPSGPGIRVDTYARPGLTISPRC
DSLLAKVITHVHGTSLAAALHKARTALSELIVAGVGTNAGLLAAVLSEAE
PATGAVTTGWLGRRLPALVGAASPTSAGHRLPTTDLGPGEHVLYAPMAGT
VAEVEPGGVVLEAMKMQHVLAAPGAMVRALVAVGQVVAAGEPLLVFTGTG
DETGEGPDGGPDLDSPRADLDEVAHRHRLTRDDGRPEAVARRHRQGRRTA
RENIADLVDPGSFVEYGALALAAQRSRRSEEDLIANTPADGLVAGLATID
SAQVAVASYDYTVLAGTQGMRNHAKTDRLFELAARRRIPLVLFAEGGGGR
PGDTDVAGMAGLDLMTFRALAALNGQVPLVAVVSGRCFAGNAALAGVCDV
IIATPDANIGMGGPAMIEGGGLGVYRPEEIGPIEVQRRNGVVALAATDEA
HAVVLAKRYLSYFGGGVTEWREPDPRLARHVVPQNRLRAYDVRRAIEAIV
DVDSALELRPDYGIGIVTALVRVRGVAYGLLANNSHHLGGAIDAEAADKT
ADFFALCESFRLPVMTLCDTPGFMVGPDAEREATVRRFSRMFIAGARLSV
PMGMIVLRKGYGLGAMAMAGGSFHAPQFTVAWPTGEIGGMGLEGAVRLGF
RKELAEAADADQRQQLFEQLVAAAYRRGRALSAATTFELDDVIDPAESRR
WIAGLSSG
333991157YP_004523771.1 transcriptional regulator [Mycobacterium sp. JDM601]MEAVPAAPTRQPPATVRGARTRAALVAAARKVFERDGYLDAKLTDITKAA
GCATGSFYTYFANKEEIFAAVLEQAQQDMMHPGMGRVGGTDDPYAVLEAS
NRAYLEAYRRNAKLMGLLEQVAQIDPTFRAFRSQRADAFVQRNAAGIADL
QARGIAGADVDPLLASLALSGMVSRLAYGAFVLGEAVDIDFEALVGTVTR
LWANALRFPEGQ
333991155YP_004523769.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MSLFEMSERAAKYRSDLLEFMDALVYPAEPVYETQMAESGNPHFQPPILE
ELKTEARNRGLWNLFHPHPDVGPGLSNLEYAPLAEIMGRSPHLAPEATNC
SAPDTGNMEVFTLFGSDEHKEKYLKPLLEGKIRSAFAMTEPAVASSDATN
VQLSMVKDGGEYVLNGRKWFASNALHQNCRVMIVMGKTDPDAATHRQQSM
MVVPIDAPGVTVMRGVSVFGYQDREGHAEIDFNDVRVPAKDVLKGEGEGF
AIAQARLGPGRIHHCMRCIGMAERALELLCRRAQSRVTFGKPVSDNANIR
DWIAEARIDIEMIRLLTLKAAYLMDTVGNKAAQVEIAAIKVAAPEIALKI
VDRAIQVHGAGGVTEDFPLAGFWAHLRTLRLADGPDEVHKRAIARQELKK
YREAAQ
333991153YP_004523767.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MVAEVLGVDPPMIARWIAQLGIPVSRPVKFERIGIGQSNLTYLVSDAADH
RWVLRRPPLGELLASAHDVAREARILAALEDTEVPTPRVYGMTRDSEGTP
LLLMEYVDGVVADRMSVAESLTPQRRRQIGLSMPKTLAKIHAVDIKAVGL
DDLASHKPYAQRQLKRWAGQWEKSKTRELPALDDLTRRLVAAAPPQQELT
LVHGDFHLRNVITSPQNGQVVAVLDWELSTLGDPLADMGSLLAYWPEPGE
EDIAGEFVLSTLEGFPDRAELARVYLEQTGRDAATLQYWHALGLWKVAII
AEGIVRRVLDNPANKAAAGTPITGWIDALVRKAREVADEAGI
333991151YP_004523765.1 hydrolase [Mycobacterium sp. JDM601]MPTITDTITTADGDCPVRLFTPDGAGPWPGVVMYPDAGGVRQTFVEMAAE
LAGSGYAVLLPDVYYRHPGWAPFDMATAFSDAKERGRIMSMLGSVTFDRM
TTDAEAFFDYLAGRPEVRGEKFGVCGYCMGGRISVVVAGRVPDRVAAAAS
FHGGGLVTDAADSPHLLAEQMSATVYVAGAANDASFTKAQAATLEQALAA
AGVEHTVEFYPAAHGFAVPDNPPYDADAAARHWAAMREVFAAALTG
333991149YP_004523763.1 dihydrofolate reductase DfrA [Mycobacterium sp. JDM601]MTALGLIWAQSTSGVIGRDGGIPWRLPEDQARFKELTLGHRVVMGRLTWE
SLPAGVRPLPGRANVVVSRRSDYRAVGAEVVPTLDAALTDAETWVIGGAQ
IYALALPLADRCEVTEVEIDLPRQDEDAVAPVLDESWRGTAGPWLTSARG
LRYRFCSYHR
333991147YP_004523761.1 hypothetical protein JDM601_2507 [Mycobacterium sp. JDM601]MLMRRIARPLLAAAFIGQGVEALRRPQQAGQTARPAFDGLQHLPDEISAK
VPSDVETFAKANALVQIGGGLLLASGRLPRVAAAALACTVIPGSAGGHMF
WMEPDIGRRAQQRQAFLTDVSLIGGLMIAAADTEGRPSLGWRARRAARHA
YQRAATAMPAMHTTSGDAVLETVGDRLSAGLQAGAEHGRELAELVGERAG
PLLEAAGERGAQFAEVAADRGTELAQAARESASTLAESARRHLHRPDNHR
GR
333991145YP_004523759.1 hypothetical protein JDM601_2505 [Mycobacterium sp. JDM601]MRGSVSYGFVVVGCLAVAGCGGSGGAAKTTTTVAATPTTTTVAVAPVGED
GLRALLLTPEEINPIMGVADMKAHAPHDVLPDDSATMQPRECLAVDGVAQ
EQVYARSGFSAVREQSVSDGEDNAHFVDQAVVLFPTAEQAEAFFEASAKQ
WPECHEYTHTQSGSEWTAGRISNIEGVLSTVATQQNAGESAWQACGRALT
VANNVVVDVNTCSTDPKDSAVVIARQIAAKVPKG
333991143YP_004523757.1 dihydrodipicolinate synthase DapA [Mycobacterium sp. JDM601]MSSTVFDAKAQLGTVLTAMVTPFGADGSVDTDAAVRLANRLVDAGCDGLV
LSGTTGESPTTADYEKLTLLRAVVEAVGDRARIIAGAGSNDTEHSVRLAE
ACAGVGAHGLLVVTPYYSRPSQAGLLAHFTAVADASGLPVMLYDIPARSA
VPIAPDTIFELAEHPNIVAIKDAKGDLHAAAQIMAETDVAYYSGDDALNL
PWLAMGATGFVSVIGHFAAGQLRDMLAAYESGDVETARKINVSIAPLSNA
MGRTGGVTFAKAGLRLQGFDAGEPRLPMVPATGAEVDELAIDMRAASVLE
333991141YP_004523755.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MGALDGKVAFITGAARGQGRAHALRLAGEGADIIAVDLCQQISSVPYPLA
TADDLAETVKLVEETGARIVARAADVRDRTALGTALQAGIDELGRLDFVI
ANAGIAPMAGEDAWQDVIDVNLTGIYHTVDVAMKPMIAQGDGGSIILVSS
VAGLVGLAAPAAGSLGYAAAKHGIVGLMRVYANLLAPHSIRVNSVHPAGV
QTPMIDNEFTRKWLEGLEDTDTQGGPDMGNALPVQVLQPEDVANAVFWLV
SDAARYITGVTLPVDAGYVNKR
333991139YP_004523753.1 DNA translocase FtsK [Mycobacterium sp. JDM601]MVAKAAGGTARSVGRAHDIDPGHRRDGIALALLGLAVVTAASCWLDAARP
VGAWIDTGLRAVIGGAVVLLPVLAGVGAVALMRTEPVPENRPRLILGSAM
VALPILGLWHLWAGSPPTPEGRLHGAGFVGFAIGGPLADGLTAWIAAPLL
CIGVLFGVLLLTGTTLREAPEALRTMFVARDYDDGYDDGYYDDDYVGEDD
YYDEDGGGFEGGAAADGAEDTPDWQSRTPLDNYPLSETDVAPAEPPAPAP
KPARRKAPKTAKPTDTTVVLDRVVEGPYTLPPLSLLTAGDPPKTRTAANE
AMTDAITSVLEQFKVDAAVTGCTRGPTVTRYEVELGPGVKVEKITALQRN
IAYAVATESVRMLAPIPGKSAVGIEVPNTDREMVRLADVLTAPSTRRDHH
PLVIGLGKDIEGDFISANLAKMPHLLVAGSTGSGKSSFVNSMLVSLLARA
TPEEVRMILIDPKMVELTPYEGIPHLITPIITSPKKAAAALAWLVEEMEQ
RYQDMQASRVRHIDVFNEKVRSGEITTPLGSEREYRPYPYILAIVDELAD
LMMTAPRDVEDAIVRITQKARAAGIHLVLATQRPSVDVVTGLIKTNVPSR
LAFATSSLTDSRVILDQAGAEKLIGMGDGLFLPMGANKPVRLQGAFITDE
EIHAVVTACKDQAEPEYTDGVTTAKPTGERTDVDPDIGDDMEVFLQAVEL
VVSSQFGSTSMLQRKLRVGFAKAGRLMDLMETRSIVGPSEGSKARQVLVK
PDELAATLMAIRGGADTDAADDDDDG
333991137YP_004523751.1 hypothetical protein JDM601_2497 [Mycobacterium sp. JDM601]MDWARLFAFDTPPSEIIVRGTVIYIAIYALLRVVLKREAGTNGITDLIVV
VLIADAAQNGMAGGYRSISDGILLVGVIIGWSYLLNWMAHRWPTVARLLR
PGPLLVIHEGELLHGNMRKEMITEQHVREQARKQGIADLAMVREGRMESD
GQFSFLVGSTRRTAGLVMD
333991135YP_004523749.1 PGP synthase PgsA3 [Mycobacterium sp. JDM601]MVNLANAVTVMRLLLVPVFLLALFAADGHDAKTRIAAFVIFAVAIITDRL
DGALARNYGLVTEFGTLADPIADKALIGAALIGLSMLGDLWWWVTVLVLV
REIGITVLRFAVLHRGVIPASRGGKLKTLVQAVGIGLLILPLSGPWLVTA
WAVMAAAVVLTVVTGVDYVMSAIADLRDRS
333991133YP_004523747.1 hypothetical protein JDM601_2493 [Mycobacterium sp. JDM601]MANPFVKAWKYLMALFNSKIDEHADPKVQIQQAIEEAQRQHQALTQQAAQ
VIGNQRQLEMRLNRQLADIEKLQVNVRQALTLADQAEAAGDAAKKTEYEN
AAEAFAAQLVTAEQSVEDLKALHDQALTAAGQAKKAVEQNAMMLQQKIAE
RTKLLSQLEQAKMQEQVSASLRSMSEIAAPGTTPSLDEVRDKIERRYANA
LGEAELAKGSVQGRMIEVEQAGVQMAGHSRLEQIRASMRGESLPAGGATP
PVTPAAPQSGADPNPENPLGR
333991131YP_004523745.1 hypothetical protein JDM601_2492 [Mycobacterium sp. JDM601]MTRQHHEADPLTGYEENNGDYGRYLAELGAVAAQCARLLAPAGFAVWNVA
DIHHLSSTTHLISDCARVLEHHLTRLGTTEVVWDRYPHDLIADALLVFQR
IPAY
333991129YP_004523743.1 hypothetical protein JDM601_2489 [Mycobacterium sp. JDM601]MQDWVRNDLAGPGATTRIIMRAVVPTTLILIPFWFLPTDFMTHVSMTFPI
WFMAILFSHALNKVWRKHMLRMHGLDPDLADAQKRQRDAHLHRAYIERYG
PRPESADQRSDDI
333991127YP_004523741.1 glycosyl transferase [Mycobacterium sp. JDM601]MRIVVVAGPDPGHAFPAMALCRRFAAAGDAPTLLTGVQWLDTARVAGVDA
AELIGLDPAAGDDDGDAGAKIHRRAARMARQNLDQLRELAPDLVVSDVIT
ACGGMAAELLGVPWVELSPHPLYLPSKGLPPIGSGLAPGTGLRGRLRDVV
MRSLTARSVRTGLRQRAEARAGIGLPERDPGPLRRLIATLPALEVPRPDW
PAEAVVVGPLHFEPTDELLAVPPGSGPLIVVAPSTALTGAAGLTELVLEQ
LVPGVGLPAGARVAVSRLNGPELTLPEWAVAGLGRQDELLTRADLVICGG
GHGMVAKSLLAGLPLVVVPGGGDQWEIANRVVRQGSGRLVRPLSPAALTE
AVSAVLASPSYRAAARRAADGAAQVADPVRVCHEALSGG
333991125YP_004523739.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MVRDYGGISAVDRRAERRGKLLSAGRRIWGESGLGEVTVRGVCTAAGLIP
RYFYEQFANRDALLFAVSDDVRDQLLEAMVTAGVGDPGTLSDKLRSALTA
FLELIAVDPYIHRIATCDLSAVPGLSEHRARILDMITDAVVEQAPGVIEG
ELPAPADLRRGALFIVGGVNQIIEAWLDDPTETPAELAATCSDLAVALVR
SIMATPDHAHH
333991123YP_004523737.1 RecA protein [Mycobacterium sp. JDM601]MAQAPDREKALELAMAQIDKNYGKGSVMRLGDEVRQPISVIPTGSIALDV
ALGIGGLPRGRVVEVYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHAL
DPEYAKKLGVDTDSLLVSQPDTGEQALEIADTLIRSGALDILVIDSVAAL
VPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKI
GVMFGCMNYSTRVTLADGTTEKIGKIVNNKMDVEVLSYDVDTDQLVPRKV
VNWFDNGPTEKFLQFTVEKSGGNGKSQFAATPNHLIRTPGGWTEAGELIA
GDRVLTAEPHLLSGQQFQIVLGSLMGDGNLSPNRRDRNGARFRLGHGAKQ
VEYLQWKTALMGNIGHSVRENAQGATFVDFTPLPELGELQRAVYLGDGKK
FLSEDYLKALTPLALAIWYMDDGSFTLRSKGLQERTAGGSGRIEICVEAM
TDGTRARLRDYLRDTHGLDVRLRSSGLAGKAVLTFSTAATAQFQEMVAPY
MAPSMEYKLLPRFRGQSTVTPQFVEPTQRLVPSRVLDVHVKPRTRSMHRF
DIEVEGNHNYFVDGVMVHNSPETTTGGKALKFYASVRLDVRRIETLKDGT
DAVGNRTRVKVVKNKVSPPFKQAEFDILYGRGISREGSLIDMGVDQGFIR
KSGSWFTYDGEQLGQGKENARNYLLTNVDVANEIEKKIKEKLGIGAVLTD
GLADDVLPAPVDF
333991121YP_004523735.1 hypothetical protein JDM601_2481 [Mycobacterium sp. JDM601]MAITPKDAFNAARDIATHAVEKASDIVEDAGDIIRGDVSGGVNAIVQDSM
EIATHAVERTKEVFTDRDGADEVDEV
333991119YP_004523733.1 hypothetical protein JDM601_2479 [Mycobacterium sp. JDM601]MIFAEYRGQIVEAFTVTVELALLSGGLALLLGTGLAAMRLAPVPALRWLG
AAYVHLLRNTPLTLLLLLCSFGLAQTLGVTLTDPHSPTSVDDSNFRLAVL
GLGVYTASFVCEALRSGVNTVGIGQAEAARSLGLSFSQNLRIILLPQAFR
AVIIPLGSVLIALTKNTTLASAIGVAEAALLMKSMTENTAALMAVGGIFA
AGFVVLTLPLGLLFGYLGRRWAVSQ
333991117YP_004523731.1 glutamine ABC transporter ATP-binding protein [Mycobacterium sp. JDMTSGGPDPVPMIAIRDVNKYFGDLHVLCDINLDVARGEVVAILGPSGSGK
STLCRTINRLETIDSGTITVDGEPLPAEGASLARLRAQVGMVFQSFNLFP
HKTVLDNVTLAPMKVHKTPRAQAQRRAMALLERVGVADQARKHPAQLSGG
QQQRVAIARSLAMNPKVMLFDEPTSALDPEMINEVLAVMSSLADDGMTMV
VVTHEMGFARRAADRVVFMADGTIVEDAPPAEFFGEPKSARAKDFLARVL
DH
333991115YP_004523729.1 transmembrane protein [Mycobacterium sp. JDM601]MSGHGGNPDDFEAYRADIEAAERRVASEIDPGGRGLVVSIAVFVLLASFL
LPHTGTVRGWDVLFAANGSDEALVTLPSRLFMWLALVFGVGFSMLALMTR
RWTVAWVALAGSAVASVAGLLAVWSRQTVMQGHPGPGFGLILCWLTVIVL
TFHWARLVWSRTAVQLAAEEERRRRTAQRQPRGLLDDIKRPDDRPPGE
333991113YP_004523727.1 hypothetical protein JDM601_2473 [Mycobacterium sp. JDM601]MASNITAALDVERPIRTVYNQWTQFESFPQFMEGVERVEQRDDTHLHWTI
KVGPATREFDATITEQHPEERVAWRSDTGPRHGGVVTFHKIDEGTTRVTT
QMDIDPEGVVENVADKLNILDHRVHSDLRRFKDFIENQPAETGAWRGDVP
RR
333991111YP_004523725.1 hypothetical protein JDM601_2471 [Mycobacterium sp. JDM601]MSTGNVIAALLALCAALASAIGDVIRQRSAQEITDQQVGHLQLFWLSLRD
ARWWGGGAAAVANYALQALALAVGSVILVTGLQVTALLFALPMYAWLTHR
RVTNWEWMWAVLLAAALAVVVIVGDPTEGKQHAPARTWIAVSVVVVTLLL
ACAVAARRLRGRPAAAVLLAVVAGTSLAVFALLTKVLVELIKAEGLEDAL
ESPVVVPWLAATLAGMIFQQSAFRAGALTASMPTMIVAKPLVASALGVLL
LNEHIQAGGVEDAAVIIGVVLIVIATAALARGEAATIVAEAGGADRETPV
ASPTT
333991109YP_004523723.1 tRNA delta(2)-isopentenylpyrophosphate transferase MiaA [MycobacterMRPIAVVGPTGTGKSQLALELAEGLEKSGRSAEIVNADAMQLYRGMDIGT
AKLSPGERRGIPHHQLDVLDVTATATVARYQQAAAADVEAIMNRGAVPII
VGGSMLYLQALLDDWSFPATDPAVRARYEQRLADIGVAALHAELAAADPA
AATAILPTDGRRIVRALEVVALTGRPFAASAPTIGVPRWDTAIIGLDCDT
VLLDERLAARTATMFDCGLVAEVVGLLKTGLRDGVTAARALGYAQVIADL
DAGGNGDGAREPTFIGTRRYVRRQRSWFRRDHRIEWLDGAGGGLLDAALA
AWRHVS
333991107YP_004523721.1 GTP-binding protein HflX [Mycobacterium sp. JDM601]MSHPELPSTGELALDDRTALRRVAGLSTELADVSEVEYRQLRLERVVLVG
VWTEGSAAEADASMVELAALAETAGSQVLEGLIQRRDRPDPSTYIGSGKA
VELREVVLATGADTVICDGELSPAQLTALEKAVKVKVIDRTALILDIFAQ
HATSAEGKAQVALAQMAYMLPRLRGWGESMSRQAGGRAGGSGGGVGLRGP
GETKIETDRRRIRERMAKLRREIKAMKQVRDTQRSRRLHSDVPSVAIVGY
TNAGKSSLLNALTGAGVLVQDALFATLEPTTRRGLFEDDRPFVLTDTVGF
VRHLPTQLVEAFRSTLEEVADADLLLHVVDGADPAPLAQISAVRQVISEV
IAERDAKPAPELLVVNKIDAAGDLALAQLRRALPDAVFVSAHTGDGIESL
RRRMGQLVAPADTAVDVVIPYERGDLVARVHEQGRLTQAEHGEGGTRIRA
RVPAALAASLREFGQA
333991105YP_004523719.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MSAAVKYQRTLFEPEHELFRESYRGFLDRHVAPHHEEWEKAKIVDRGVWL
EAGKQGFLGMAVPEEYGGGGNPDFRYNTIITEETTAGRYSGIGFSLHNDV
CAPYLLELCNEEQKQRWLPKFCTGELITAIAMTEPGTGSDLQGIKTRAVK
QGDHYVLNGSKTFITNGIHSDLVIVVAQTDPEKGAQGFSLLVVERGMAGF
ERGRHLDKVGLDAQDTAELSFTDVHVPVENLLGQEGMGFIYLMQNLPQER
ISIAIMAAAAMEATLEQTITYTKERKAFGKPIGSFQNSRFLLAELATEST
VVRMMVDEFIRLHLDKQLTVEQAAMAKWYSTEKQVHLIDRCLQLHGGYGY
MREYPIARAYLDARVQTIYGGTTEIMKEIIGRSLGV
333991103YP_004523717.1 hypothetical protein JDM601_2463 [Mycobacterium sp. JDM601]MFGPCPPFDAESARRKVRAAEDAWNTRDPERVAQAYTDDSVWRNRDEFVT
GRAEIVAFLRRKWARERDYALRKELWCHHDNRIAVRYQYESRDATGQWWR
SYGNELWEFADDGRMSRRESSIDDVAITEDQRRIFGPRTDSDEHTPLPLR
333991101YP_004523715.1 transcriptional regulator [Mycobacterium sp. JDM601]MSYPRRGHPDPLTGLSSLDDPVRQRLYHYVASCDEPVAREQAATAAGISR
TLAAYHLDKLAEAGILSVSYARPAGRSGPGAGRPAKRYARTRDELSVSVP
PRNYRLLADLLVTAMADDDAGAVRSAVSAAARRVGRAGATEHGVLEVLRE
FGYEPVVNDAGDIELRNCPFERLARRYTEAVCGLNLQLIEGMLEGTGEPP
RRATLTPSERRCCVTVRAPGRGHR
333991099YP_004523713.1 repressor LexA [Mycobacterium sp. JDM601]MSDSSKTAPAPDSTLTARQRTILSVIRASVSERGYPPSIREIGDAVGLTS
TSSVAHQLRTLERKGYLRRDPNRPRAVDVRGPEESTGSDAAPRSDVAGSD
ALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGELFLLKVVGE
SMVDAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRTGGQVWLM
PHNPVFDPIPGNDAVVLGKVVTVIRKV
333991097YP_004523711.1 membrane-associated regulatory protein [Mycobacterium sp. JDM601]METAVLAVVKRSGVTEPFSREKVISGVRRACQGRQVDDDALNLLAQQVED
AVRAAGSPEIPSHEVGLAILGPLRELDEVAYLRFASVYRSFSSAADFERE
IEALREHRQVPTTG
333991095YP_004523709.1 hypothetical protein JDM601_2455 [Mycobacterium sp. JDM601]MAEHPDTGSDRDRHYQAQQGGMYELEVPAPQLTSPDGEGPVLIHALEGFS
DAGHAIRLAAGHLKTALDSELVASFAIDDLLDYRSRRPVMTFKTDHFTHY
AEPELSLYALRDSAGTPFLLLAGMEPDLKWERFITAVRLLAERLGVRRTI
GLGTIPMAVPHTRPVTLTAHSNNRELIADFTPWIAEVQVPGSASNLLEYR
MAQHGHEVVGFTVHVPHYVSQTDYPEAAEALLRQAAQTGSLQLPLTELSR
AAADIRAKINEQVEASAEVAQVVTALERQYDAFIAAQENRSLLARDEELP
SADELGAEFERFLAQEARKDRGDDGTA
333991093YP_004523707.1 iron-dependent repressor and activator IdeR [Mycobacterium sp. JDM6MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLEQSGPTVSQTVSRMER
DGLLRVAGDRHLELTEKGRALAVSVMRKHRLAERLLVDIIGLPLEEVHAE
ACRWEHVMSEDVERRLVKVLDNPTTSPFGNPIPGLPDLGFGSDAGPRETD
LVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVEAD
AEDGVTIVMPGHTDVSLPYAMAHAVKVQKV
333991091YP_004523705.1 transmembrane protein [Mycobacterium sp. JDM601]MMKHGPELGFDDDGRPVLITAAAPSFEQQHRERVRKYLTLMAFRVPALIL
AAVAYGIWHNGWISLAILIASIPLPWIAVLIANDRPPRSADEPRRYDAAP
TRTPLFPTAPRRELGPRSPQPESAGREPGSEPEFGPGPSGGDRAGEPPQG
TGS
333991089YP_004523703.1 hypothetical protein JDM601_2450 [Mycobacterium sp. JDM601]MADQIPKPSRHHLLRIARRTLVKSWDDSIFAESAQAGFWSVLSLPPLLLG
MLGSLSYVAPLFGPDTLATIQDRLIGMASSFFSQNVVVEIIEPTVRDIVS
NARGEVVSLGFVISLWAGSSAISAFVDSVVEAHDQTPLRHPVRQRFFALG
LYVAMLVIAVAGAPFAALGPHAIAEHLPARWTDLLRFGYYPTLVLGLLLA
VTVLYRVSLPKPLPSHRLVIGALLATTVFVVATLGLRVYLRYITSTGYTY
GALATPIAFLLFAFLLGFAIMLGAELNAAIQEEWPAEATHLRQLRVWLVS
RTGRSDPGDEPVNEPVSSS
333991087YP_004523701.1 hypothetical protein JDM601_2446 [Mycobacterium sp. JDM601]MEHDILVHLCGTRDWAAAQAAGALRPESLDSAGFVHLSTPQQVHLPANRL
YRGRTDLVLLQVDPAKVASPVRWEPGVPGDPEAMLFPHLYGPLPVDAVIG
VTAYRPGPDGAFGPAD
333991085YP_004523699.1 methyltransferase/methylase [Mycobacterium sp. JDM601]MAKPPPAALLAALTAMRGGLQRLRHAAVPAGVAVMELGFGAWLAQAMHVA
VRLGIPDALRTGPLTADETARRVGTDPAATYRLMRALASQSVLKLRRDGR
FALTRIGRALVSDDPASVAPMIAFIGDPAHREHWSHLEHSVRTGETAVDK
VRGMSFFSYLDTEPELAQVFNNAMTGASAVAIESAVPAYDFSASKLIVDV
GGGHGALLAAVLRAAPGARGVLFDQPAVVAGAEATLAAAGVTSRCDVAGG
SFFESVPAGGDTYLLKTVIHDWDDERSCTILRNVRSAIAPDGTLLLLEMV
LPEGAPAHLGLLLDLEMLAAAGGLERTRREYAELLSRAGFRLQRVVPTVS
PMSIIVAAPV
333991083YP_004523697.1 polyphosphate glucokinase PpgK [Mycobacterium sp. JDM601]MTGTDPTDSPPVAPAAATGDGRPQRRGFGVDVGGSGIKGGVVDLDTGALI
GERYKLPTPSPATPAAVAETVAQVVRKFGWTGPLGVTYPGVVIDGVVRTA
ANVDKSWIGVNAQAAIQAALDGQPVVILNDADAAGLAEERFGAGKDNTGV
VVLLTFGTGIGSAVIHNGKLLPNTELGHIDVAGKEAEHRAAASVKERKNW
SMKKWSKQVTKVLVAIEDALCPDLIIAGGGISRKADEWVPLLRNRTPVVA
ATLQNTAGIVGAAMAATADVTR
333991081YP_004523695.1 hypothetical protein JDM601_2441 [Mycobacterium sp. JDM601]MATDYDAPRRTETDDVSEDSLEELKARRNEAQSAVVDVDESESAESFELP
GADLSGEELSVRVVPKQADEFTCSSCFLVQHRSRLASEKNGVMICTDCAA
333991079YP_004523693.1 deoxyuridine 5'-triphosphate nucleotidohydrolase DutT [MycobacteriuMSPSLAVVRLDPDLPLPSRAHAGDAGVDLYSAVDVELAPGQRALVPTGIA
VAIPFGMVGLVHPRSGLAARVGLSIVNSPGTIDAGYRGEVKVALINLDPA
TPIDIHRGDRIAQLVVQRVELPELVEVTSFDEAGLAGTTRGGDGHGSSGG
HASL
333991077YP_004523691.1 hypothetical protein JDM601_2437 [Mycobacterium sp. JDM601]MTAVLLPGTGSDDDYIHRVFSGPLQQVGAELVVHRPQPDGLVEGYLAALD
SAASRGVPIIAGGVSIGAAVAAAWALRHPGRVRGVLAALPAWTGAPDGAP
AAHAARLSAEELRRDGLPAVVARMRASSPAWLADELTRSWTAQWPLLPDA
LEQAAAYTAPTRAELATLTAPLGVTAAVDDPVHPLHTATEWVSAAPQAAL
RTVTLAQLGADPAALGAACLTALIAAAG
333991075YP_004523689.1 hypothetical protein JDM601_2434 [Mycobacterium sp. JDM601]MTAGDRQAGVTMTGEFGAQGPQRLLDQIGGVSGLIYSSLPIVVFVPTSSL
FGLRAAVVAALTVAAAVLAWRLIRRESTQPAVSGFFGVAVCALIAYLMGD
SKGYFLLGIWTSLAWALVFAGSILIRRPAVGYIWSWASGQSRAWRGVRAA
VYAYDVATLTWVLVFGSRFAVQRLLYDADQTGWLGVARIAMGWPLTALAA
VVTYLAVKYVQRALDEQPVSHPADDRGPRSGRR
333991073YP_004523687.1 TRK system potassium uptake protein CeoB [Mycobacterium sp. JDM601]MGASVADGLSRIGHEVAIIDRDTTAFNRLSPEFNGERVLGMGFDRDVLLR
AGIEEAGAFAAVSSGDNSNIIAARLARETFGVARVVARIYDAKRAAVYER
LGIPTIATVPWTTDRLLDALTRESETTKWRDPTGTVAVAEVVLHEDWIGR
PVTDLEAAVGARVAFLIRFGTGILPEPKTVIQASDQVYIVAVSGRVAEAI
AIAALPPSEDLDK
333991071YP_004523685.1 SAM-dependent methyltransferase [Mycobacterium sp. JDM601]MTELILRVGPPANGGSCVARHDGRVVFVRYALPGERVRARITAERGSYWH
AECVEVLEAADGRIASLCPIAGVDGAGCCDLAFAEPAAARALKAEVVANQ
LRRLGGYDWHGEAEPLGEDGPTGWRSRVRLEVGADGRAGFHRYHSDKLVT
DLRCGQLPAGMTKGLAEQTWRPGDQLHVVTDDDGVRHVVSTSRNHRPQVL
EGDYHATQWVGRRRWRIPVTAFWQAHRRAAALYSALISDWAQPEAGMTAW
DLYGGAGIFAAALADGVGTSGEVVSIDTSRAATAAARAALVDLPQVSVRT
DSVRRALAAQPRAADVAVLDPPRAGAGREVIEALAAAKVPRLVHIGCEVA
AFARDIGLYRDHGYAVEQIRVFDAFPLTHHVECVALLTRA
333991069YP_004523683.1 hypothetical protein JDM601_2429 [Mycobacterium sp. JDM601]MRAEEIAEEFPVVAIDSDAVDAARLLAEHRLPGIVVVDAAGQPHAVLPAS
QVVRFIVPGYVQDDPSLAGVLSESAADRAAEKLRGKAVRDVLPEHLPELP
TAGATHTLIEVASTMARLRSPLIAVVKDGKLLGVITASRLLAAALKV
333991067YP_004523681.1 transmembrane pair domain-containing protein [Mycobacterium sp. JDMMSPVVRRVSYVISYEIVAIVLTALGLVLLGFGGGSSGVMAVTASTVAVLW
NYIWNTVFEAWERRQRSPARTLRRRVAHAIGFEGGLVVFLLPIVAWILHV
SLPQAFALEAGLLVFFLIYTFVFTWVFDKVWPPIGARPNPAAR
333991065YP_004523679.1 hypothetical protein JDM601_2425 [Mycobacterium sp. JDM601]MHAATVRSEIELGPIRPPQRLAPYSYALGAEVKHPEADFVPQDSDGDAFG
RLILLYDPDGTDAWDGTMRLVAFIQADLDPQEAIDPLLPEVAWSWLVEAL
GSRTEHMTALGGTVTATTSVRYGDISGPPRGHQLELRASWTATTPELGTH
VQAFCEVLEHAAGLPPVGITDLSSRTRV
333991063YP_004523677.1 protoporphyrinogen oxidase [Mycobacterium sp. JDM601]MTSTYCVVGGGISGLAAAYRLRATLGAAPTITVFDPADRLGGVLRTETLG
GIGVDVGAEAFVARRPEVPALLSELGLADRERTTTGVRPLLYNRRRLHPL
PPGTLSGIPSSPGAMAGLVDEETIARIAGEPNRRLTFEPGSDPALGTLVG
DRFGEQVVAASVDPLIGGVYAGSAATVGLRSAVPGLAAALDAGAPSLTAA
VARALPRATGTPVFGAIAGGYQVLIDALVRRSGLRWVQAAVTQIDPVADG
WLLRDAAGGFHHADRVVMAVPANTLARLATGFAPRTAAAASGIVSASSVV
VALAVPAGAAFPDNSGVLVATGERLHAKALTLTSRKWGNWGYGGKVELLR
LSFGRFGDARTHATEAELVGWAVQDLETLFGVMVDPVEVRVQRWPAAMPQ
YRPGHAALVGELRAGLPPTVAVAGNYLDGIGVPACIAAADRAVAAVISAT
PAP
333991061YP_004523675.1 hypothetical protein JDM601_2421 [Mycobacterium sp. JDM601]MTGASGPSAGDAERFEEIYRAAAGLPAATPWDIGGAQPVVRRLVALGAIK
GAVLDPGTGPGHHAVHFAEHGFAATGVDVSETAIEGARANARLRRPGSGR
SHSGWRSSNRCWTASWRTPRSGKSTPPGWISFSTRRACR
333991059YP_004523673.1 transmembrane protein [Mycobacterium sp. JDM601]MLWPVAIMSLIHRAIVLPLNGNITDDFKPVYRAVLNFRHGLDIYNEHFDY
VDPHYLYSPGGTLLMSPFGYLPETLSRYTFITTNTVAILIAAYLLLRMFG
FGLTSVAAPALLAAMFLTESVSSTLVFTNINGVILLAEVLFLRWLLDGRP
SRQWWAGVAIGLTLVVKPVLAPLLLLPLLSRQWRPFVGAVAVPVAFNAVA
FPLSSDPTSYFTQTVPYIMGTRDYFNSSILGNGVFFGLPPGLILFLRVLF
TVIAAVSLWLLYRYYRTRDPRFWMLTSSGVLLTASFLVLSLGQGYYSIVL
FPFLMTVVLPNSVLRNWPAWLGVYGFMTLDKWLIFRWMNVGRPLDYLKIT
YGWSLLLIVVCAVLCYRYLDAREQDRLDDGIDPAWLANGHQRASVEA
333991057YP_004523671.1 bifunctional riboflavin biosynthesis protein RibD [Mycobacterium spMSDLSAEPGFTRLDSTEPVDDAELARLYAYPESDDGPRSWLRANFIGSID
GGATMAGKSGGLGSPGDRALFMLLRALADVVLVGAGTVRVENYGGARLNV
TERLRRRDRGQSEVPGLAIVSRSGQLDRDARVFTDTELPPLVLTSASAAE
ATRRRLDGRAEVLNCSAGDRDRVDEAAVLAALAGRGHHRVLTEGGPTLLG
SFVERDLLDELCLTVAPYLVGGLARRIATGPGEVATPMRCAHLLVDESGY
LYGRYVKSARL
333991055YP_004523669.1 hypothetical protein JDM601_2415 [Mycobacterium sp. JDM601]MHRWILAVVTSLVTTLALLVPAAGNATPTTTPEAPIGRLGDTLRIHYQDE
AFGKIIADVTLHDVVPSEIPPGWGQNGSPRWRAQGGPWRANLTIHPISVP
NSYIMAASVTFSGVTPGGDAYVSKHTDDPTALDAVLTNAPEGSTVTGGVY
WDVYRGLVTHVVMLSRNTGLRLAQWNL
333991053YP_004523667.1 hypothetical protein JDM601_2413 [Mycobacterium sp. JDM601]MSSGTTAPGTAASKPGHTGDTLTLTRADGSTITVTLERVINPATVTPGKG
DPAVTYIATELKIANQGTATMNGNANTNVWVLGSDDHSYEPDLNNVSECT
NFDSGMFHVSPGDAATGCVVFALPHGVSPAKVKYAPSSGFADDFGEWLVS
333991051YP_004523665.1 hypothetical protein JDM601_2411 [Mycobacterium sp. JDM601]MFARATTIHAHPSFLDEGITHVRGVVMPTLADMDGCAGMSMLVDRDAGRC
IVTSSWLDEDTLRASEAGAQQLCDRATEIFHATAEITRWEIAAVRRDHRS
RRHAGVRVTWLRTDPASCERLIDTYKLALIPQLADLHGFCSTTLLVDRSS
GRAVSSISFEDRAAMVASRAGEQTIWARAINDVGADVLEVAEFDLAIAHL
NAPEMV
333991049YP_004523663.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MEFNLAQVFSAVAAAIPDRDCVVFGDRRLTYAHIEDRARRLARALHERGL
GLRRERPELTAHESGQSHLALYLANGNEYLEGMLGAYNARVAPFNVNYRY
VADELVYVLTDAAAEAVMYHARYAATLADALGRAGNRLPPLTLIHVDDDS
GNEPLPGAVRYEELLAATSADPLELTPSPDDLYLLYTGGTTGMPKGVLWR
QHDIFINAMGGREFGTGAVPTSLAEVVDRSRAGGPGSMTVAPLMHGAAQW
AAFITLLGGRPFVMSATTDRFDPVATWELAAEERVISLSIVGDAFARPLA
DALEAGGPELADALSGLFVLASGGAPLTVPIKQRILELLPQLSILDAGGS
SETGAQMGQTTSRGQASTGRFTPNPGAVVVSGDLTRILAPGDDEIGWLAQ
QGYVPLGYLGDPEKSARTFPVIEGIRHSVPGDRARWHADGGIELLGRDSV
TINSGGEKIFAEEVEAAVSRHPAVYDVVVVGRPSQRWGHEVVAVVQLAAG
ADAEAGDIVAEAARHIARYKLPKDVVFCERVQRSPSGKADYRWAKAQAIG
VDT
333991047YP_004523661.1 hypothetical protein JDM601_2407 [Mycobacterium sp. JDM601]MSEAELDARVLPRSEKHKTIFATFAELAAGESFVLLNDHEPEPLRLEFER
EHPGSYGWEYLEKGAGRGALWRTRISRLSSTAVPWILTDTTTTGDGTEPD
PAGVVWKLEVASREIDADVTSLSAGQDTGMHVGPEIDALTHVLSGGGVLT
TELGTIELTAGALLWMPKRSPRQFVAGPDGLRYLTIHQKRQFLNLMAAG
333991045YP_004523659.1 transcriptional regulator [Mycobacterium sp. JDM601]MQAADEPLSIAQIADELGVHPNTVRFHLDTLVEEGRVEHTEPDHKGRGRP
ALMFRAIRQMDRGGTRRFRLLAEILTIGLAADSDPSGKALAAGRAWGQRL
RPLNRPAHRVGADESTDQLVDMLDELGFQPEQLEPDDAGEKQLGLRHCPF
LELAETSTDVVCPIHLGLMQGALEAWDAPVTVDRLDSFAQPDLCVAHLKS
MEFDGAEPVPNGVRIEQSSADPVPVEGTTG
333991043YP_004523657.1 hypothetical protein JDM601_2403 [Mycobacterium sp. JDM601]MESTSLTALADEKLAEARQHHSGRSAHTVYGGSVHHLRQTLVALRAGEAL
AEHDSPGESTLQVLRGRVRLTAGDDAWEGSAGEFVVLPRTRHALEAPEDS
VVLLTVAKSASH
333991041YP_004523655.1 transcriptional regulator [Mycobacterium sp. JDM601]MANLDRNMTGIGALADPVRRELYRFVASQAAPVSRDDAAAATGIARHQAK
FHLDRLEADGLLVSDYARLTGRSGPGAGRPSKRYRRSPSEIAVSLPPREY
ELAGRLMADAIAESARTGTPAIQALDRLARDYGRELGEAATAERPPTDTA
AALELATDVLTEHGYEPRDDGGGDVYLANCPFHGLAQSQTELACTMNLAL
ISGVADALMPYCPRARLAPDPSRCCVVLTAGGCPAPG
333991039YP_004523653.1 hypothetical protein JDM601_2399 [Mycobacterium sp. JDM601]MDLSRLRDLPLTYAEVGATAGALPAGYQHLEHAAPIGRGRQRFEQAAEAV
LHWGMQRGAGLGVRTDSDVATVGATVVVRMGLLSAPCRVVYVVSEPDRRG
FAYGTLPGHPESGEELFSVRYDPADDTVHAQVRAFSRPATWWIRAAGPVA
SAAQRVIARRYLRAI
333991037YP_004523651.1 threonyl-tRNA synthetase [Mycobacterium sp. JDM601]MSAPAPIRVPAGTTAADAVRAAGLPSRGAPDAIVVVRDADGKLRDLSWIP
DTDAEATPVAADTEDGRSVIRHSCAHVLAQAVQDLFPAAKLGIGPPITDG
FYYDFDVPEAFTPEDLEKLEKRMRAIIKDGQLFARRVYESKEAARAELAS
EPYKLELVDDKSGSTDNMAEIMEIGGDELTAYDNLNPRTRERVWGDLCRG
PHIPTTRFIPAFKLTRSSAAYWRGDQNNASLQRVYGTAWESREALERHLE
LIEEAQRRDHRKLGVELDLFSFPDEIGSGLPVFHPRGGIIRRELEDYSRR
KHIEAGYQFVNTPHITKSALYETSGHLQWYSEGMYPPMHIDAEFAEDGTV
RKPGQDYYLKPMNCPMHHLIFRSRGRSYRELPLRLFEFGSVYRYERSGVV
HGLTRVRGMTQDDAHIYCTRETMREELASLLRFVLDLLADYGLDDYYLEL
STKDPEKYVGSDEVWEEATETLREVAEASGLTLVPDPGGAAFYGPKISVQ
VKDALGRSWQMSTIQLDFNMPDRFELEYTAADGTRQRPVLIHRALFGSIE
RFFGVLTEHYAGAFPAWLAPVQVVGIPVADQHVGYLEEIAAQLRSHGIRV
EVDASDDRMPKKIVNHTNAKVPFMLLAGDRDVDAGAVSFRFGDRTQINGV
PRDDAVAAIAGWIAARDNTAPTAETVKTGLKAGEAT
333991035YP_004523649.1 pi synthase PgsA1 [Mycobacterium sp. JDM601]MSRLPFLSRARFARVTTPVARAFLRAGLTADVVTIMGTAGAVLAALTLFP
TGQLFAGTLVVWFFVHFDMLDGAMARLRGGGSAFGAVLDATCDRISDGAV
FCGLAWWAAFGLDSAPLVVATLICLVTSQVISYIKARAEASGLRGDGGYI
ERPERLIIVLVGAGLSDLPGYPLPWALHVAMWLLAVASLITCAQRLHTVR
TSPGAVEPLPEADGEETAGS
333991033YP_004523647.1 alpha-mannosyltransferase [Mycobacterium sp. JDM601]MRIGMVCPYSFDVPGGVQAHVLQLAEVLRGRGHEVSVLAPASPHVELPDY
VVSAGKAVGIPYNGSVARLQFSPAAHRKVKKWLMRGDFDVLHLHEPNAPS
LSMLALNVAEGPIVATFHTSTTKSLTLSVAQGLLRPMHEKIIGRIAVSDL
ARRWQMEALGSDAVEIPNGVDVAAFARAQPLPGYPRTGRTVLFLGRYDEP
RKGMAVLLAALPALVETFADVELLIVGRGDEAELRSNAGTLAKHLRFLGQ
VDDAEKASALRSADVYCAPNTGGESFGIVLAEAMAAGAAVVASDLDAFRR
VLRDGQAGRLVPVDDHAALAAALIEVLGDDALRASYVAAGSEAVRRFDWS
VVADQIIRVYETVAGVGRKVSVGD
333991031YP_004523645.1 NADP-dependent alcohol dehydrogenase AdhC [Mycobacterium sp. JDM601MPSAGAPLSLVDVDTAAPGPDQVRIDVAACGVCGTDQGIVGGGFPGVSWP
LTPGHEIAGRIAELGSAVTGWAVGDRVAVGWFGGHCNHCIPCRKGDFIHC
DNGQVPSLHYPGGYGESVTVPANALARIPDGLSFVEAAPMGCAGVTTYNA
LRSTRALPGDRVAVLGVGGLGHLGVQFAAAMGFETIAVARGAGKGADARA
LGAHHYIDSTAGDVAAALRALGGVSVVLATAANSQAMADTLGGLAPRGEL
VIIGVSADPLPIAPVQLIGPGLRVSGHPSGTARDVEETMAFAVLSGVRAR
IEERPLAQAAEAYAAMQQGRARYRMVLTM
333991029YP_004523643.1 transcriptional regulator [Mycobacterium sp. JDM601]MSTKTTRGRGRPPGGGNPPEHARELLLDAAERSFAHRGYRASTMQVIARD
AGYTRAVIYRHFGSRDQLLDALVVRVAVRKMVAIAARLETTTDPGDLVTE
SLVIVATEVGQDPLLRVISEHTDEGNVAAMIARSATLSEVLAGQFEMGFR
QAGDKLRAGLRPGDAARFVLSVALGLLLGLVPGADDAEQVRRYVQVFVLP
ALVADPSPAGPVFTASG
333991027YP_004523641.1 acyl-CoA thioesterase [Mycobacterium sp. JDM601]MAIEEILDLEQLEVNIYRGSVFSPFSADNQRTFGGHVAGQALVSAVRTVS
PKFRVHSLHGYFLRPGDAKAPTVFLVERVRDGGSFCTRRVNAVQHGETIF
NMSASFQSEQRGIEHQNAMPGAPDPQDLPDIAAMKAFDDAGFKAFAEWDL
RRVPRKSLPHIPGKVAEQQVWFRHRDRLPDDPVLHICALAYMSDLTLLGS
AWSIHAGDRDHLQVASLDHAMWFMRPFRADEWLLYDQSSPSAGAGRALTQ
GKIYNQDGDMVAAVMQEGLTRYPSGYTPAGQ
333991025YP_004523639.1 endoglycoceramidase [Mycobacterium sp. JDM601]MSSDPPTTTGTFQFSYSTERADGLGSFDGGSTTTISTPVVEYPNGYQVSV
TGGHVVPEPNAAVLTIASNDGADTVTVTVRPAG
333991023YP_004523637.1 hypothetical protein JDM601_2383 [Mycobacterium sp. JDM601]MKSKNARHRVTGAGTAVGAFLAVGIASLTTAPQACAEDFDIGAWFADPDM
FAAAAEASFQQWVI
333991021YP_004523635.1 hypothetical protein JDM601_2381 [Mycobacterium sp. JDM601]MATIHFISGLPRSGSTLLAALLRQNPRFEAGMSGPLAGLFGALLGEMSAR
NEFSVFIDDAKRERILHGLFDSFYADCPADVVFDTNRGWCGWMAAVSRLF
PDAKVIACVRELPWVVDSIERLIQRNVFTPSSIFGFNPGGTVYTRANGVV
GQDGMVGAAYDMLKQACFGAQRDRLLVVQYETLTAEPARTMRAIYDFIGE
PMFEHSFDHIDYDVTDFDERAGTPGLHTVHSEVRAQPRETILPPDLFNRF
VNDAFWRDPAAVPAGLRVV
333991019YP_004523633.1 Holliday junction DNA helicase RuvA [Mycobacterium sp. JDM601]MIASVRGEVIDIALDHVVIEAAGVGYKVMATPATLSTLRRGTESRLIIAM
IVREDSMTLYGFPDADARDLFLTLIGVSGIGPKIALAALAVYDATALRRV
LADGDVTALTRVPGIGKRGAERLVLELRDKIGPVAAPDGAVFNGHVVRAP
VVEALVGLGFAAKQAEDAIDKVLAESPDASTSDALRTALSRLGKIK
333991017YP_004523631.1 4-aminobutyrate aminotransferase [Mycobacterium sp. JDM601]MSVSPLQQSRHLATEIPGPGSVRLASRRAAAVARGVASTLPVYAARAGGG
IVEDVDGNRLIDLGSGIAVTTVGNAAPRVVEGVREQAGEFTHTCFMVTPY
EGYVAVAEALNRLTPGAHEKRSLLLNSGAEALENAVKIARSYTRKSAVVA
FDHGYHGRTNLTMALTAKSMPYKSGFGPFAPDIYRAPTSYPYRDALIDKE
LGSDGERAAERTIAVLENQIGAHNLAALVIEPIQGEGGFIVPAPGFLPAL
LSWCRDNDVVFIADEVQTGFARTGAMFACEHEPIEPDLICTAKGIGGGLP
LAAVTGRAEIMDAPHVSGLGGTFGGNPLACAAALGAFATVAADDLVGRAR
QIERLVFERLGRLQADDDRVADVRGRGAMIAVELVRRDSTEPDAELTKAL
ASACHRAGVIVLTCGTFGNVLRLLPPLTISDELLAEGLDVLAGELGKL
333991015YP_004523629.1 hypothetical protein JDM601_2375 [Mycobacterium sp. JDM601]MVAFLPLLIVMGAFMFFASRRQKRAMQATIDLHESLRVGDRVHTTSGMEA
TITGITDDNVDLEIAPGVVTTWMKLAIRDKIEPEDFTADAAVEQATEDA
333991013YP_004523627.1 protein-export membrane protein SecF [Mycobacterium sp. JDM601]MAKPSTSSGAKRATKSAKDEAGAVELTETGTAVEETARKTTGAPRPPQHG
FLSRLYTGTGAFEVIGKRRMWYAISGAMVAIAILSILIRGFTFGIDFAGG
TKVSFPRGDTSVTQVEQVFRDTVGSSPESVVVVGNGSSATVQVRAETLTN
EQTDKLRDALFDAFQPVGPDGQPSKLAISDSAVSETWGGQITQKAVIALV
VFLLLASLYITVRYEWYMTLAAMISMVFDVVVTAGVYSLVGFEVTPATVI
GLLTILGFSIYDTVIVFDKVEENTHGFEHKTRRTFAEEANLAVNQTFMRS
INTSLISALPIMSLMVVAVWLLGVGTLQDLALVQLVGVVVGTYSSIYLAT
PLLVTLRERTELVQNHNRRVMRRRKAVAGSKTAPADDAADVDEGETTENA
AVSTAATPAAPAPGAKPVRPTSRRTQRPTGKPGAGR
333991011YP_004523625.1 adenine phosphoribosyltransferase [Mycobacterium sp. JDM601]MKAAGRPADDVAGIIASLTREVADFPTPGIAFKDLTPVFADAAGLAAVTA
ALAQVAAGVDLVAGIDARGFLLAGAIADRLHVGALAVRKGGKLPPPVLSE
AYQLEYGQAVLEIPADGIDLAGRRVVIVDDVLATGGTLAAAQRLLRRAGA
EVAAAAVVLELADMGGRAAVAPLPLHSLLAL
333991009YP_004523623.1 peptidyl-prolyl cis-trans isomerase B PpiB [Mycobacterium sp. JDM60MSTNEERRAQAKRKLDEQVQQRAEAARKQRRILMIAGAVVAVALLAGVVF
VVLRDDGDTGNINALPTSETSDAPAPSPGEPGQLPKFTASPTLGADCQYP
KARPASKPVEPPRSGKVPTEPAEVSVSMMTDQGPIGLMLDNAQSPCTVNS
FISLGAKDFFADTQCHRLTTSPMLSVLQCGDPAGDGTGGPGYEFANEYPT
DQYAPNDPAAQQPVRYPRGTLAMANAGPGTNGSQFFLVYQDSMLPPQYTV
FGTIQQDGLDTLDKIAAGGVQGGGTDGPPATKVTIKSIRAD
333991007YP_004523621.1 histidyl-tRNA synthetase [Mycobacterium sp. JDM601]MSTFAAPKGVPDYVPPASAGFVAVRDGLLTAARRAGYGDIELPIFEDTAL
FARGVGESTDVVSKEMYTFADRGNRSVTLRPEGTAGVVRAVIEHGLDRGQ
LPVKLCYAGPFFRYERPQAGRYRQLQQVGVEAIGVDDPALDAEVIAVADA
GFRSLGLDGFRLEITSLGDDTCRPAYRELLQQFLFGLDLDEETRRRAQLN
PLRVLDDKRAEIKEMTADAPLMLDHLSTGAKAHFDTVLAHLNALGVRYEI
NPRMVRGLDYYTKTTFEFVHDGLGAQSGIGGGGRYDGLMRQLGGQDLSGI
GFGLGVDRTLLALAAEGKAVGATARCDVFGVGLSEAAKLRLAVLAGQLRA
AGVRVDLAYGDRGLKGAMRAADRSGAVLALVAGDRDLEAGTVGVKNLATG
EQHDVPIDGVVDEVLRRLPR
333991005YP_004523619.1 hypothetical protein JDM601_2365 [Mycobacterium sp. JDM601]MNTELLFSYGTLRLPEVQRNTFGRELDGRPDAIIGYDLDYVTITDPEVVA
LSGSDRHPILRPSAAPDAAVSGTVFAISTAELAAADDYEVDAYRRISVPL
RSGARAWVYVFAE
333991003YP_004523617.1 L-fuculose-phosphate aldolase [Mycobacterium sp. JDM601]MASTFDDSKSDLMEQAERRFAANVGQDSWSIRQKLALTCRALFDRGHDSG
LAGQITARAEAPGTYYTQRLGLGFDEITQDNLLLVDEDLNVLQGEGMANP
ANRFHSWIYRVRPDVQCIVHTHPFHVAALSMLETPLVISHMDTTPLYDDC
AFLPTWPGVPVGNEEGEIISQALGDKKAILLAHHGQIVAGASVEEACSLA
VLIERAAALQLAAMAAGTIKELPERLAREAHDWTLLPNRSVANFAYYARR
ALAGHPDAIT
333991001YP_004523615.1 membrane glycine rich protein [Mycobacterium sp. JDM601]MTFNEGMQIDTSTTSSGGGGRGIAIGGGVAGLVIMVVALLLGADPGDVLS
QQPVDRGQYTAPGFDLSKCRTGEDANRYVQCRVVATANSVDAVWSELLPG
YSRPQVQLFSGQTSTACGAATSAVGPFYCPGDQTAYFDTDFFQVLVDQFG
SSSGPLAQEYVVAHEFGHHVQNLRGVLGRAQHGAQGATGAGVRTELQADC
YAGVWAHYAAVTKQKSTGVPFLKPLTDDDIRDALSAASSVGDDRIQEAAT
GRVNPESWTHGASAQRQHWFTVGYQTGDPNQCDTFAAADLG
333990999YP_004523613.1 PPE family protein PPE61 [Mycobacterium sp. JDM601]MFPPEINSGLIYTGPGSAPLLEAATAWANLAAELSTSATATHSVVTNLTS
TWTGMGSAAASSSVAPYVAWLQQASANATQNAALASQAAALFEAARSGSV
PPPVIAANRAMLMALISTNFFGQNTPAIAATEAQYEAMWAQDGAAMDTYN
MSAQANNNLLQAQSAPPNSAQATQPGSAADTSTGAPIPGDGGTPPVNPGY
NLSTIGGIMDSMGIPTTGIDETLLATQLSQVMSPINTMSMPAMMAARILP
MLLMQMARMGAMGGTGALAGQTAGAAGTGTLMTQIGDFVNDKLQGAVGVL
AGHFSSATNAISAKLGQAASMGALKVPQAWSMAADGMVRAAPVLPSTTVS
APIQTMSGSSGLPGGPFGNALMGAMAGRGLGAVAAKAPKVMPRSPAGG
333990997YP_004523611.1 EsaT-6 like protein EsxN [Mycobacterium sp. JDM601]MSINYQFGDVNAHGALIRAQAASLEAEHQAIVHDVLAAGDFWGGAGSVAC
QEFVAQLGRNFAVIYEQANAHGQKVQTAGNNMANTDASVGSSWA
333990995YP_004523609.1 aspartyl-tRNA synthetase [Mycobacterium sp. JDM601]MLRSHDAGSLRATDAGRSVTLAGWVARRRDHGGVIFIDLRDASGVAQVVF
RDPAVLEQAHRLRAEFCVAVTGAVEVRPEGNANPDLPTGAIEVNASELTV
LNEAAPLPFQLDEPVGEEARLRHRYLDLRRENGPGAALRLRSRVNAAART
VLGEHGFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQL
LMVAGMERYYQIARCYRDEDFRADRQPEFTQLDLEMSFVDAEDVIGIAEQ
VLTALWALIGYDLPTPLPRMTYADAMRRFGSDKPDLRFGLELVECTAFFK
DTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEWAKQRGAKGLAYVLVGQ
DGELSGPVAKNLTDAERAGLAGHVGAAPGDCIFFAAGLAKPSRALLGAAR
GEIARRLDLIDPDAWAFTWVVDPPLFEPADDATAAGDVAVGSGAWTAVHH
AFTSPKPEHADSVESDPGAVLADAYDVVCNGNEIGGGSIRIHRRDVQQQV
FKVMGIDEAAANEKFGFLLDAFSFGAPPHGGLAFGWDRVVALLAGVDSIR
EVIAFPKSGGGIDPLTDAPAPITAAQRKESGMDVPPQPR
333990993YP_004523607.1 resuscitation-promoting [Mycobacterium sp. JDM601]MGGLLAPAGVARADSNMLMGWDAVAQCESGGNWAADTGNGFYGGLQFKPS
TWRAFGGVGLPSKASREEQIAVANRVLDEQGPYAWPKCGPGKVFPSSVKG
WVPPAMRQLLKPFW
333990991YP_004523605.1 zinc-containing alcohol dehydrogenase NAD- dependent AdhD [MycobactMAHAPNQPFEIMELDLDGPGPGEVLIKFTAAGLCHSDLHLADGDWPARFP
IVGGHEGSGIIEDVGPGVTKVAPGDHVVCCFIPSCGTCRYCSTGRQNLCD
MGATILEGCMPDGTFRFHSGGTDYGGFCMLGTFAERATVSQHSVVKVDDW
LPLQTAVLVGCGVPTGWASANYDGGVRAGDTVVVYGVGGVGINAVQGAAH
AGAKYVVAVDPVEFKRETALKLGATHAFATAEEAMVTVAELTWGQMADQA
LITVGDLDEAVTTAAFNTIGKGGTVVIAALAKLESLDVHISGSQLALFGK
TIKGTLFGGANPQYDIVRLLRLYDAGKLKLDELVTRRYTLEQVNEGYQDL
RDGKNIRGVIVHR
333990989YP_004523603.1 transposase mutator type IS256 family [Mycobacterium sp. JDM601]MTQNHSALLAQLDTLKSADSGAVFAELIRAGLQALIEAEATEAIGADRYE
RTGARSVHRNGHRPKTVSTTSGDVEIQIPKLRAGSFFPSLLERRRRIDKA
LHAVIMEAYVHGVSTRSVDDLVTAMGVGSGVSKSEVSRICAGLDTEIEAF
RTRSLAHTQFPYVFCDATFCKVRVGAHVVSQALVVATGVSIDGTREVLGT
AVGDSESFEFWREFLASLKARGLTGVHLVISDAHAGLKTAVAQQFAGSSW
QRCRVHFMRNLHTAVSAKHAPAVTAAVKTIFAHTDPEEVSAQWDRVADTL
ADSFPKVAAMMAEAQTDVLAFTAFPKAHWQKIWSNNPIERLNKEIKRRAD
VVEIFPNPAAFLRLATAVVIEAHDEWQVTRRYLSDVSMDELRAVIAKKEA
AAALAKQHQIP
333990987YP_004523601.1 recombination factor protein RarA [Mycobacterium sp. JDM601]MSDGLFDLTGAPAPEFSGPGAGTPTPLAVRMRPASLDEVVGQDHLLGPGS
PLRRLVDGSGAASVILYGPPGTGKTTLASLISGATGRRFEALSALSAGVK
EVRAVIDTARRAAAYGEQTVLFIDEVHRFSKTQQDALLAAVENRVVLLVA
ATTENPSFSVVAPLLSRSLILQLRPLGPEDIAAVVGRAIADERGLGGRVE
VAPEAVDLLVRLAAGDARRALTALEVAAEGVAEGHQVTVETVEASLDQAA
VRYDRDGDQHYDVISAFIKSVRGSDVDAALHYLARMLTAGEDPRFIARRL
MILASEDIGMADPTALPTAVAAAQTVALIGMPEAQLTLAHATVHLATAPK
SNAVTTALGAAMADIKAGKAGAVPAHLRDGHYSGAQALGNAVGYRYAHDH
PDGVVPQQYPPDDLVGADYYQPTARGVEREIGGRLQKLRAIIRRRG
333990985YP_004523599.1 FMNH2-utilizing oxygenase [Mycobacterium sp. JDM601]MTSRTDQMALVAFMQAGNASVYAGSWRHPATEHGYLDASYYAKIGRQLEE
GCFDLMFFDDRLAMPAIYGGAVADAVRYGARPVKLDLSTVLGVLAQATSR
IGLGATYSTTYYAPFHVARTFATLDHLSAGRAAWNVVTSVNDGEAQNHGL
TSHLSHDERYDRADEFLDVVAGLWDTWEDDAIVADRARGFYADPDKVHEL
RHEGEYFSVRGPLTVPRTPQGRPVIIQAGSSGRGREFASRWADLIFTGDP
GLEVARSHYADQKQRIADAGRDPASVKLCPMAYAVVGESEDHAKHREQVF
LNDLVDPMASLTLLSELMNYDFAEHHLDEPITDDLITSVSGIRGLVQNLR
AHIGDDITLRDLAGHRATLLQGPRFVGTGTQVADQMEEWFHGGACDGFVL
AATHSPGAYEDVVRMVVPELQRRGLFRTEYRGATLREHLGLARPGLTAA
333990983YP_004523597.1 citrate (pro-3s)-lyase subunit beta CitE [Mycobacterium sp. JDM601]MLLRRSELAVPAANDNMFAKAAASDADLVFLDLEDATAPAHKVAARAKVI
TALNELDWGRTARAIRINGLDTVWCHDDIIEVVTAAGRNLDTIVVPKACT
ARDVWWVDLLLAQLEAKLGLERKIRLEVLIEEVEGLANAEEIATASPRID
ALIFGVGDFSLSQGARVDTNFVPLGDYPGDFWHYARNKVLVAARIAGIEA
IDSPYPDYADLAGYETEARRSSLYGYTGKWAIHPDQIPVANAVFAPTADE
IALAERNMAAYREGEAKGLGAVGVEGVLVDAAHVKMAQRTLDRVALINGG
SPA
333990981YP_004523595.1 alanyl-tRNA synthetase [Mycobacterium sp. JDM601]MQTHEIRKRFLDHFVKAGHTEVPSASVILDDPNLLFINAGMVQFVPYFLG
QQTPPYATATSIQKCIRTPDIDEVGITTRHNTFFQMAGNFSFGDYFKRGA
IELAWTLLTNSVEQGGYGLDPERIWATVYFDDDEAMELWQEIAGLPAERI
QRRGMADNYWSMGIPGPCGPSSEIYFDRGPEFGVGGGPIANEDRYIEIWN
LVFMQNERGEGTGKEDFEILGPLPRKNIDTGMGVERVAFLLQGVHNVYET
DLLRPVIDVVAERAPRPYGNPDAPQDDVRYRVIADHSRTAAILIGDGVSP
GNDGRGYVLRRLLRRVIRSAKLLGIEGPIVGELMVTVRDAMGPSYPELVT
DFDRISRIAVAEETAFNRTLASGSRLFDDAAQATKSSGTTVLSGTDAFTL
HDTYGFPIELTLEMAAEAGLTVDEIGFRELMAQQRARAKADAAARKHAHA
DLSAYRELVDAGPTEFTGFEELSSEARILGIFVDGKRVPVVARAGRGEVP
DRVELVLDRTPLYAESGGQIADVGTISGGAAKAAVTDVQKIAQTLFVHRV
NVESGEFVEGDTVTAAVDPAWRKGATQGHSGTHMVHAALRQVLGPNAVQA
GSLNRPGYLRFDFNWQGPLSDEQRREVEEVTNEAVQADFEVHTFNEDLEK
AKAMGAMAMFGEKYPDRVRVVEIGGPFSLELCGGTHVHNSAQIGPVTLLG
ESSVGSGVRRVEAYVGLDSFRHLAKERALMAGLASSLKVPSEEVPARVAN
LVERLRAAEKELERARLAGARAAALNAASGAERVGNVRLVAQRMSGGIGG
GDLRSMAGDIRGKLGEEPAVVVLIADPAQDSPGSVPYVVATNSAAQELGL
RADDLVKDLAAAVAGRGGGKADLAQGSGKDSAGIDAALAAVRSAVARSAP
A
333990979YP_004523593.1 hypothetical protein JDM601_2339 [Mycobacterium sp. JDM601]MSDDYSAAKAKPVAVGPPRRRMSRTERARDHRQRRRRNRRRRVVGAVGVA
LVTMMLIAAVFLGSKLWHSRGPVVDYTGEGGQQVLIEVHEGDFTTAIAET
MLGAGVIANVKTFLDAAQGNAAIAAIQPGFYRLRAEIPAVTAVQQLTDPA
NRVGKLVIPEGRQLDDTTDMKTNAVTPGVFTLIAQASCLDLNGDRHCLTP
QELRRAAETETPEALSVPDWAFGPVTRMGRDHRRIEGLITAGTWNVDPTA
PAPVVLSKVIGQSAAELAKTGLPAIAEQLGMTPYELLIVASLVQREALPH
DFAKVARVIDNRLNEPQRLEFDSTVNYPLDRQEVATTDADRAKLTPWNTY
AAEGLPATPICSPGVEALRAAEHPEPGDWLYFVTIDKDGTTLFTHNYQQH
LNNIEMALGNGVLDSSR
333990977YP_004523591.1 hypothetical protein JDM601_2337 [Mycobacterium sp. JDM601]MEQAAAVVVLAWLALLSGYDIAARRLPNWLTLPAAVLVPAVAAGAGRGSA
ALAGAAALALVYLAVHLISPAGLGAGDVKLAVGLGALTGSFGADVWLLAA
LSAPLLTGLCGLIAACARRGPTVPHGPSMCLASAVAAGLGMF
333990975YP_004523589.1 chorismate synthase [Mycobacterium sp. JDM601]MLRWITAGESHGRALVAVVEGMVAGVAVTSADISTQLARRRLGYGRGARM
KFEADAVTVLSGVRHGVTLGGPIAVEIGNTEWPKWETVMSTDPVDPAVLD
SEGGARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVTAG
TIARAFLDQALGVQVISHVISIGASDPYDGPVPQPEDLAAIDASPVRAYD
RQAQESMIAEIEAAKADGDTLGGVVEVVVSGLPIGLGSFISGDDRLDGQL
AAAIMGIQAIKGVEIGDGFTTARRRGSAAHDEMHPGPDGVVRSTNRAGGL
EGGMTNGQPLRVRAAMKPISTVPRALATVDMATGDEAVAIHQRSDVCAVP
AAGVVAEAMVALVLARAALAKFGGDSLTETRRNIEAYRRSVAERGSVGGQ
ARASG
333990973YP_004523587.1 3-dehydroquinate synthase [Mycobacterium sp. JDM601]MTQIPEPITVTVATDPPYPVVIGKGLLGDLADLLAGRNKVAILHQPTLEQ
TAEGIRTYLSDKGIEAHRIEIPDAEDGKSLQVLGFIWDVLGRIGLDRRDA
LVSLGGGAATDVAGFAAASWLRGVSIVHVPTTLLAMVDAAVGGKTGINTE
AGKNLVGAFHQPAAVVVDLATLETLPQREIVAGMPEIVKAGFIADPVILD
LIEADPKAAMDPAGEVLGELIRRAITVKAEVVAADERESGLREILNYGHT
LAHAIEALEHYQWRHGDAVSVGLVFAAELARVTGRLDDETADRHRSILQS
LGLPVSYYESALPALLEYMMGDKKNRAGVLRFVVLDGLAKPGRLEGPDPM
LLAAAYDEVGRRFRLERR
333990971YP_004523585.1 transmembrane protein [Mycobacterium sp. JDM601]MVVIRMIQGVLINAFEAQAGLISLILMILFAIAVMVWGYSDGRADARANP
DPDRRDDLAMTWLGAGLVAGLVSGLVSWIIGLVDKALYVSSLFNELTSFA
AFTALLVFVTAVAAVTLGRRRVDKEYEKAPHRHHGLAAQGEAAPTDVFAT
VGAPAVAAEQTDTIQTEAAPHADTAAPQADAPATQADAGATLAGPAAGFT
TEEFPAVEDQADATTEIPAVDEGGPSAQSDDSAK
333990969YP_004523583.1 elongation factor P Efp [Mycobacterium sp. JDM601]MASTADFKNGLVLVIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVV
DKTYNAGVKVETATVDRRDATFLYRDGADFVFMDSADYEQHPLPEAMVGD
SANYLLESMPVQIAFHNGVPLYLEMPVSVELEVTHTEPGLQGDRSSAGTK
PATMETGAQINVPLFINTGDKLKVDTRDGSYLGRVNS
333990967YP_004523581.1 hypothetical protein JDM601_2327 [Mycobacterium sp. JDM601]MGDIANIDAYTAALAGAQTAEEACERLSAADCVAATQGESVVIGDGEATA
RPFEGVNKIGDAFFLWCLHDRDGEIVRCVARGPQGSCPPRH
333990965YP_004523579.1 GntR family transcriptional regulator [Mycobacterium sp. JDM601]MAEARVAVQPIRRADRARQVADVLRHQIHAGAYAGGLPGETELADEFVVS
RNIIREALSALKAEGLISRGPRTGTRVAQHKHDHGLDLLLGLQETFDGHG
QVRNEVRVATVVCAPPSIARRLLLDAGAPLVFIERLRYLGDVPLSLDQTY
LPADIGDAVLAHPLEDSDLFPLIEQISGQRLGDATLALEAIPADPHSAAI
LQLADGAALLMLERLTSFEDGRPVDLEYIRMRGDRVTMRGSLTRSNP
333990963YP_004523577.1 ABC transporter substrate-binding protein [Mycobacterium sp. JDM601MKKTLILLACSLVFAGCSLDSAPAGDSVDVVVGYQSKTINTATAGTLLRA
RGYLERRLADITARTGTRYRVDWQDYDTGAPITAQMLAEKIDIGSMGDYP
MLVNGVRTRDSEQARTAIVSVTGYHPAGALNMVVVAPDSHADTLADLAGA
RVSASVGSAGHGTLLRALAGTGAQVEVLNQQPQVGASSLESGQVQGLSQF
VAWPGLLVYQDRARLLYDGAELNHPTLHGVVVRRGYARSHPEVLNAFLQA
QLDATDFLNRKPLEAARIVAEGSGLPQEVVYLYNGPGGTSFDTTVKPALV
KALKNDVPYLKSIGDFTGLDGFDIDRFIDDGPLRAAFAERKLDYNKAVAA
LDKPATTGGELWLQGSETTVGMADPDQLLQAVRAATARGDRIRAAYVHDA
ELGTRWFADKSAWVRDGGHHLAFDTVAGARRYAAAHPGSTVVDYQQALAA
AA
333990961YP_004523575.1 hypothetical protein JDM601_2321 [Mycobacterium sp. JDM601]MTAGMSLTLERIRLSYTDSPVIDELSLAVRPGEILVLTGPSGCGKSTVLR
ALAGLLTPDRGRVLADGATVATTSGDRAMVFQDNALLPWRSVRSNIELAL
RLRGVPRSGRRAQADRWITELGLSGFGDYLPKSLSGGMRQRVQLARGLAG
APRAVMMDEPFGALDSATRAAMQALLIETWRTHPTTIVFVTHDVDEALAL
GDRVAVLGRAGQPLRALADVPEPRSARPEPALRAELLSALDYS
333990959YP_004523573.1 transcriptional regulatory protein [Mycobacterium sp. JDM601]MQDWVQAGFRILAEDGVKALTIDRLCRRLGVTKGSFYWHFSDMKTYRQAL
VETWAAVRDEDRGDFDALSALPPRERLSRMMTSLVGPRHWMLERAMREWA
RSEDSVAEAVRSSDRRVLKAVRQVFLDDGFDPDAADMRANATFAAGIGFL
HLAGSRPSPRAVGRREQFLDVMLRH
333990957YP_004523571.1 beta-lactamase [Mycobacterium sp. JDM601]MNLDPNRAPLSEACDTGLLAGAVTVVWQRGKLLQVNEIGYRDVGAQLPMT
RDTVFRIASMTKPVTVAAAMSLVDEGRLRLNDPIAHWLPEFAAPSVLVDP
AGPLDRTAPARRALTIEDLMTHRCGIGYGFSTLGPIAREYQRLPFGRGPD
PWLTALAALPLVDQPGERVTYGHGTDVLGVLLARVEGKPLPQVLDERILG
PLGMADTGFCVSPALRGRSATMYRIDGDTLRDDAMGPMPITMPAFPNAGG
GLMSTADDYLAFARMLLADGVFDGTRVLSAESVQAMRTDKLTAAQKRHPF
LGAPFWVGRGFGLNLSVVTDAAKSQPIFGPGGAGTFSWPGAYGTWWQADP
AADLILLYLIQNAPTLSTEAAVAVAGNTSVGKLRVAQPKFVRRTYRALGI
333990955YP_004523569.1 aspartate carbamoyltransferase [Mycobacterium sp. JDM601]MTARHLLAAGDLSRDEATAILDDADRFAQALVGREVKKLPTLRGRTVITM
FYENSTRTRVSFEVAGKWMSADVVNVSASGSSVGKGESLRDTALTLRAAG
ADALVIRHPASGAAQLLAEWTAGAEGGGPRVINAGDGTHEHPTQALLDAL
TLRQRLGAIDGRRVVIVGDIVHSRVARSNVRLLATLGAEVVLVAPPTLLP
VGVADWPVTVSHDFDAELPAADAVLMLRVQAERMTGGFFPSAREYSVRYG
LSEKRRTMLADDAVVLHPGPMLRGMEIASSVADSSQSAVLQQVSNGVHVR
MAVLFHLLVGSRSAAGPGAAGSTGEDEGP
333990953YP_004523567.1 hypothetical protein JDM601_2313 [Mycobacterium sp. JDM601]MNTPTMVASLIFAVVLVLVIGWLIRLMMRGWRRRGQLQETLIGTLPAVPD
MVGPPIVAATRGQYLGCTLAPKWNDRVVAGDLGYRTKAVLTRYPEGIMVQ
RSGARPIWIPQDAILAVRTERGIAGRAIPTRAHDGVLAIRWRLPSGTEID
TGFRADDRSEHTRWLEGDNT
333990951YP_004523565.1 carbamoyl-phosphate synthase large subunit CarB [Mycobacterium sp. MPRRTDLRHVLVIGSGPIVIGQACEFDYSGTQACRVLKAEGLQVSLVNSN
PATIMTDPEYADHTYVEPITWEFVEKVLAQQAERGNKIDALLATLGGQTA
LNTAVALHEHGVLERYGVELIGADFEAIQRGEDRQQFKDIVARVGGESAR
SRVCYTMAEVEETVAELGLPVVVRPSFTMGGLGSGLAASLDEVARMAGDG
LAASPTANVLIEESIYGWKEFELELMRDGNDNVVVVCSIENVDPMGVHTG
DSVTVAPAMTLTDREYQRMRDLGIAILREVGVDTGGCNIQFAVDPEDGRL
IVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDEIVNDITGETPA
CFEPALDYVVVKAPRFAFEKFPGADPRLTTTMKSVGEAMSLGRNFIESLG
KVMRSLESDRAGFWTQPDPEEDSADDALQRLRVPTEGRLYDIELALRLGA
TVEQVAEASGVDPWFVDQINGLVALRAEVVDTPVLDADLLRRCKYNGLSD
HQIAALRPELAGEDGVRLLRSRLGIHPVFKTVDTCAAEFESKTPYHYSTF
ELDPAAETEVAPQDVKPKVLILGSGPNRIGQGIEFDYSCVHAAITLSQAG
FETVMVNCNPETVSTDYDTADRLYFEPLTFEDVLEVYYAEQQSGLGGPGV
VGVIVQLGGQTPLRLAQRLADAGVPIVGTTPEAIDLAEDRGAFGDVLTAA
GLPAPRYGTATTFEQAKRIAADIGYPVLVRPSYVLGGRGMEIVYDEETLR
GYITRAALLTPEHPVLVDRFLEDAIEIDVDALCDGTEVYIGGIMEHIEEA
GIHSGDSACALPPVTLGRSDIEKVRRATEAIAHGVGVVGLLNVQFALKDD
VLYVLEANPRASRTVPFVSKATAVPLAKACARVMLGATIAGLRTEGLLAA
SGDGASVGPHAPIAVKEAVLPFHRFRRADGSGIDSLLGPEMKSTGEVMGI
DRDFGTAFAKSQTAAYGSLPADGTVFVSVANHDKRSLVFPVKRLADLGFR
VLATEGTAEMLRRNGIPCDVVRKNFEEPSPQRPELTAVDAIRAGEVDLVI
NTPYGNSGPRVDGYEIRSAAVGVNIPCVTTVQGAAAAVQGIEAGIRGDIG
VRSLQELHSTLGGH
333990949YP_004523563.1 hypothetical protein JDM601_2309 [Mycobacterium sp. JDM601]MTGVVALAVGTIGAGLAAADPGEGVTAGNGGGAETNSGPFGGDLNDGSFK
LWPSDHAADNVNLGPFSGGFDAGTAGEFDQGAAGGDGPAGDGRSGDNAGG
MPFLW
333990947YP_004523561.1 guanylate kinase [Mycobacterium sp. JDM601]MVVLSGPSAVGKSSLVRCLRERVPELYFSVSATTRAPRPGEVDGVDYRFV
TPGEFDRLIETDALLEWADIHGGLQRSGTPSAPVAEATRAGRPVLIEVDL
AGARAIKKALPEAVTVFLAPPDWDTLQARLVGRGTESAEVMERRLATART
ELAAQGDFDAVVVNARLETACSELVSLLVDTAPGAV
333990945YP_004523559.1 DNA/pantothenate metabolism flavoprotein Dfp [Mycobacterium sp. JDMMEHKRIVVGVSGGIAAYKACTVVRQLAEAGHSVQVVPTESALRFVGAATF
EALSGLPVHTGVFDDVPQVPHVAIGQQADLVVVAPATADLLARAVAGRAD
DLLTATLLTARCPVLFAPAMHTEMWQHPATVANVATLRERGAVVLEPASG
RLTGADTGPGRLPEAEEINTVVSLLLERSDALPYDLAGRKVLVTAGGTRE
PIDPVRFIGNRSSGKQGYAVARVAAQRGAEVTLIAAHAAGLIDPAGVHVV
RVSSAQQLQDAVTKHAPEAQVLVMAAAVADFRPARTAQAKIKKGPDNQGE
PTIELIRNDDVLAGAVRARADGQLPNMRAIVGFAAETGDENGDVLFHARA
KLQRKGCDLLVVNAVGEGRAFEVDHNDGWLLAADGTESALEPGSKTLMAS
RIVDAVVAFLGGRD
333990943YP_004523557.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MSAQPASPRRRMSGQARRAQLLDRARDIVATEGFAAVTIERVARAAGVTR
TVVYQNFGDLAGLMSALLDRESEIAFAGMRSVDRPPDDDPDAVGRGILAY
LHAAPTSWRIILSPPAAAPPQLQARTELGRRYARRIAADRLSGLTGHPVD
ADGATARLLLSALEELALLHLTDPDAYPDELVLRYLRSLVGWAVRLETAT
PPTP
333990941YP_004523555.1 monooxygenase [Mycobacterium sp. JDM601]MTEKPDHEVLIVGAGFSGIGAAIGLDRAGMPDYRIIEAGDGVGGTWHWNT
YPGIAVDIPSFSYQFSFEQSTEWSRTYAPGRELKNYAEHCVDKYGLRSRI
QFGTKVLSAEFDDERDVWRVQLERPHGASGWVTARFLINASGVLTTPQLP
DIDGVDTFAGVAIHTARWDHSQDLTGKRVAVIGTGASAVQVIPEIAPTVS
SLTVFQRTPIWCFPKLDLPLPAPIRWAMRVPGGMAVQRLASQAYVEATFP
IAAQYFTVFPLAKQMESAGRAYLRRQVHDPVVRDQLTPRYAVGCKRPGFH
NTYLSTFNRDNVHLVVDPIDRITPTGVVTAGGSSHDVDVLILATGFKVMD
SDNIPTFAVTGAGGQSLSRFWDEHRLQAYEGVSIPGFPNLFSVFGPYGYV
GSSYFALVEAQTHHIVRCLTSARGRGATRIEISEAANARYFDEMMSKRHR
QVFWQDSCKSANSYYFDKNGDVPLRPTTTVEAYWRSRHFDLDDYRFTA
333990939YP_004523553.1 hypothetical protein JDM601_2299 [Mycobacterium sp. JDM601]MLALRSPPGDALTGHWVGQPAFKAAMAVLLAVAAAAHPILREARWLIPAL
ILSAAGDWLLAIPWWEPSFVAGLTAFLLAHLCFLGALLQLAVVSRGGLIG
AGLVGVSCLALLVWFWPGLSREGMTVPVTVYVLVLGAMVCAALLAKLPTR
WTALGAVFFAVSDAMIGAGKFVLGNEMLAVPIWWAYAAAQLLITAGFFFG
RSGGEQPALD
333990937YP_004523551.1 primosomal protein N' PriA [Mycobacterium sp. JDM601]MVSVERLESEPAEPGGPIARVLPMLTVPHLDREFDYLVTPEQAEHALPGT
RVRVRFHGRLVDAFIWERRADTDHTGRLGRLERVFSAEPVLTAEVRRLVE
AVAARYAGSRADVLRLAIPPRHARVEREAVELPEAPVLEPVNPAGWQRYP
AGGAYLAALEEGRAARAVWQVLPGDSWTDRFAEAAVAAIRAGRTAVAIVP
DQRDVDALWNAATARIGESAVAALSAGLGPATRYRRWLSVLRGGARLVIG
TRSAVFAPLPELGLVMVWDDGDDSLAEPRAPYPHAREVAMLRAHLSGCAA
LIGGYARTAEAHALVNAGWAHDVVASRAVVRAAAPRVVALDDSGYADERD
AAARTARLPAVALQSARTALAAGAPVLVQVPRRGYVPSLACGRCRTIARC
RHCTGPLSLPERGGAAVCRWCGRVDPALRCGRCGSDSVRAVVIGARRTAE
ELGRAFPGTPVITSAGDTIVDRTDDGPALVIATPGAEPRTPNGYGAGLLL
DSWALLGRQDLRAAEDTLRRWMAAAALVRDRDAGGVVTVVAESSIPTVQA
LIRWDPVGHADAELGTRAEVGLPPAVHIATVDGDVESVTALLEQARLPDG
AEPLGPVPLPPGVRRPAGIGDESAVIRMLVRVGRDHGLVLAAALRDSIGV
LSARGSHRPVRVQIDPLHIG
333990935YP_004523549.1 hypothetical protein JDM601_2295 [Mycobacterium sp. JDM601]MVGVDGSAESDAAVAWATHEAAMRNLPLTLLHVVTPLETGWPPDPRSDGM
PSWQADAARGVLERARSVVESRGSAAPRVHTEIAYSQVIATLIGATKGSW
MTVVGSTGLGAIGRLLLGSVSTSLIHHGHGPVAVIRTDRAVAEDAPVVVG
IDGSPASETAAALAFDEASRRGVPLVALHAWSDVGVMPLLNIDRSDYEEQ
AHEILAERLAGYQEQYPDVTVHRKVVSDQPARWLIHAAEQAQLVVVGSRG
RGGFASQLLGSVSSAVAQAAGIPVIVVRPRPAAK
333990933YP_004523547.1 hypothetical protein JDM601_2293 [Mycobacterium sp. JDM601]MAHLQGPAGAPAEPVIVMRRYHDEERLASMVKRAEPVERVLDRIAGLLAD
FHDHGERSPTISRQGDPEAVRQRWDDNFPTLHQHAGTAVPSETVRRVQGL
GAEYLSGRAGLFTRRVEQGCIVDGHADLLADDIFWVDDRPVLLDCLEFSD
ELRYVDRIDDAAFLAMDLEFLGRKDLGDHFLERYAACSGDTAARSLRDFY
IAYRAVVRAKVDCVRLTQGKRGSAAAAADHLDIALRHLEDGAVRLVLVGG
GPGTGKSTLAGALAERVGAVVVSTDDVRRELRSSGQLSGETGNLGAGLYA
PANVAAVYHAVLQRAGRHLGDGVSVVLDGTWRDAETRAEARRLADDKHAA
FGEIRCVVPIEVAAERVRTRAAGNSDATPQIAGVLGADDFRWDTAHHVDT
SKPLDECVREAHEQWRAAIQPPYWDGAAR
333990931YP_004523545.1 Fmu protein [Mycobacterium sp. JDM601]MTRPPRRPQRGPHKRERKPLDPARRAAFDVLRAVSQRDAYANLMLPPLLR
ERGITGRDAAFATELAYGTCRARGLLDAIIGAAAQRSADAINPVLLDLLR
LGSYQLLRTRVDAHAAVSTTVDQAAIEFDSARAGFVNGVLRTISGRDEQS
WTGELAPDAATDPIGHAAFVRAHPRWIAQAFADALGVDAGELGAVLAADD
ERPQVHLAARPGMLTAAELAAAVEGTVGRYSPYAVYLSGGDPGRLEPVQA
GAALIQDEGSQLVARALALAPVAGDDTGRWLDLCAGPGGKTALLAALGAA
TGARVTAVEQSPQRADLVTENTRGLDVAVLTVDGRDSGLPPGFDRVLVDA
PCTGLGALRRRPEARWRRQPADVPVLAKLQRELLAAAIALTRPGGVVLYA
TCSPHLAETVGVVADALRRHPVTALDTRPLFAPLDGLGLLGEGPHVQLWP
HRHGTDAMFAAALQVG
333990929YP_004523543.1 bifunctional riboflavin biosynthesis protein RibG [Mycobacterium spMSTAPAATDAAGFDAAMLLAIDQSQQVKGNTYPNPPVGAVVLDRDGQVVG
VGGTRPTGEAHAEVVALRRAGELAAGGTVVVTLAPCNHHGRTPPCVEAVL
AAGVARVVYAVEDPNPEAAGGPARLAAAGIEVLSGVQAAAVTVGPLREWL
HKQRTGLPHVTWKYATSIDGRSAAADGSSQWITSEAARADLHRRRAAADA
IVVGTGTVLVDDPTLTARLPDGTLAERQPLRVVVGEREISADAQVLNDDS
RTMVIRTHDPAEVLRALSDRTDVLLEGGPTLAGAFLRAGAIDRILAYVAP
ILLGGPITAVDDVGVSSIARALRWRFDTVEPIGPDLLLSLVPH
333990927YP_004523541.1 hypothetical protein JDM601_2287 [Mycobacterium sp. JDM601]MIALATATTAAALFAGCSSKDAGGPLPDATTLVKESATTTADLKSAHLAL
SVTGQIKNLPVKTLEGDLTNEPTTAAKGNATITMLGSDVDAKFVVIDGDL
YAAITGDDYDNYGAADKIYDVAAILSPDKGLANMLAKLKDPKAQARDTIN
GQKAVRVTGDAPADAVNALAPQLKATASTPATVWIQEDGDHQLVQAQLDP
SAGNSIQMTLSNWNDPVTVEKPAGA
333990925YP_004523539.1 riboflavin biosynthesis protein RibA2 [Mycobacterium sp. JDM601]MTKLDTVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMV
RYTSGYLCVPLDGAICDRLGLLPMYALNQDKHGTAYTVTVDAKNNVGTGI
SASDRATTMRLLADPAAAADEFTRPGHVVPLRAKDGGVLRRPGHTEAAVD
LARMAGLQPAGAICEIVSQKDEGAMAKTDELRVFADEHGLAMISIADMIE
WRRKHEKHIERVAEARIPTRHGEFRAVGYTSIYEDVEHVALVRGEIAGPH
NDGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAHEGRGVVLYMR
GHEGRGIGLLHKLQAYQLQDAGDDTVDANLKLGLPADARDYGIGAQILVD
LGVRSMRLLTNNPAKRVGLDGYGLHIIERVPLPVRANAENIRYLMTKRDR
MGHDLTGLEEFDDSSHLPGEFGGAL
333990923YP_004523537.1 hypothetical protein JDM601_2283 [Mycobacterium sp. JDM601]MMARSGSAQWDLEVRPRLMRIGLWSAAILIVAIHVVVSFLLTIRSSGVIF
RTYDRVAVVVLGIIVAGSLLVWTRARVRAGESGVSVRNGLGDRLIPWSDV
LGVSFPPGKRWARLELPDDEYIPLVAIQSADKEAAVEAMRTLRILVARYR
PPGEKSPATGRSPQ
333990921YP_004523535.1 hypothetical protein JDM601_2281 [Mycobacterium sp. JDM601]MNSELPKGVRERDVGGPGDGAGIDVVLVTGLSGAGRGTAAKVLEDLGWYV
ADNLPPELIARMVDLGLAAGSRITQLAVVMDVRSAGFTGDLDSVRTELAT
RGINPRVLFMEAGDDVLIRRYEHNRRSHPLQGQQTLTEGITAERVMLAPV
RAVADLVIDTSVLSVRELRESIEEMFGGDAVSAPTSVTVESFGYKYGLPM
DADMVMDVRFLPNPHWVDELRPHTGQHPAVRDYVLSQRGADEFLDAYHRL
LSLVVGGYRREGKRYMTVAIGCTGGKHRSVAIAEALALRLDTEDALDELS
VRVLHRDLGRE
333990919YP_004523533.1 transcriptional regulator [Mycobacterium sp. JDM601]MAMTAEVKDELSRLVVSSVTARRAEVAALLRFAGGLHIVAGRVVVEAEVD
LGVIARRLRKDIFDLYGYSAIVHVLTASGMRKNTRYVLRVTKDGEALARQ
TGLLDLRGRPVRGLPAQVVGGSVADAEAAWRGAFLAHGSLTEPGRSSALE
VGCPGPEAALALVGAARRLGVSAKAREVRGADRVVVRDGEAIGALLTRMG
AQDTRLVWEERRIRREVRATANRLANFDDANLRRSARAAVAAAARVERAL
DILGDTVPEHLASAGRLRVEHRQASLEELGRLADPPMTKDAVAGRIRRLL
SMADRKAKQDGIPDTESAVTPELLEDA
333990917YP_004523531.1 hypothetical protein JDM601_2277 [Mycobacterium sp. JDM601]MGFIKPSVPDVDPEGWRSTGWAARIQICSRHWAEHGFGTPSGVYLIYLLK
VVAYAVGAAAVIALTPGLGGLSRIGDWWTQPIAYQKLVVFSLLFEILGLG
CGSGPLTARFWPPIGGALYWLRPNTIRLPPWPGKVPFSSGDTRTVIDVAL
YAGVLASGIWVLLSPGRGEPGPVGLLDPMLVVPMIAALVLLGLRDKTIFL
AARAEHYGLTLLVFFFPYVDQMAAFKLIILGLWWGAATSKLNHHFPYVVA
VMTTNNALLRSKIFTGVKHLMYRDHVNDLRPTRIPQLMAHVGGTTAEFVV
PALLVLVAGDHPWRWFLIAFMVVFHLNILSNLPMGVPLEWNVFVLFSLFF
LFGQHPEISVYDLRSPWLLAILLVGLVVIPVAGNMFPQQISFLPAMRYYA
GNWAASFWCFRAGTEDTLETNIVKSSALVINQLAKFYDQATADLVADKVP
GAFRAMHLHGRALNGLVYRAVENLADYSIRDGEIIAGPLIGWNFGEGHLH
NEQLLAAVQRRCHFAEGDLRVIVLEGQPIHRQEQAYRIVDAKSGLIEAGY
VAVADMLSRQPWPEPGDEFPVRITAQ
333990915YP_004523529.1 phosphoglycerate kinase Pgk [Mycobacterium sp. JDM601]MLVRSDLNVPLDEGKITDPGRITASVPTLRALVDAGAKVVVAAHLGRPKN
GPDPKLSLAPVAAALGEQLGRHVQLAGDVVGTDALARAEGLTDGDVLLLE
NIRFDARETSKDDQERLALARALAELVAAPDGSPGAFVSDGFGVVHRKQA
SVYDIATLLPSYAGTLVAAEIQVLRQLTESTERPYAVVLGGSKVSDKLGV
IKSLATKADSIVIGGGMCFTFLAAQGLQVGTSLLEADMVDTCRQLLDDYA
DVLRLPVDIVVADKFDAGATPETVAADEIPEGKMGLDIGPGSVQRFAALL
ANAKTIFWNGPMGVFEFPAFAAGTKGVAEAIATATGKGAFSVVGGGDSAA
AVRALGLPEDGFSHISTGGGASLEYLEGKPLPGLQVLETGGAQ
333990913YP_004523527.1 protein-export membrane protein (translocase subunit) SecG [MycobacMILTLQILLVITSLLVMLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTYFVIAIWLVSIIAVGLLIKYA
333990911YP_004523525.1 6-phosphogluconolactonase [Mycobacterium sp. JDM601]MTVAIYPGADDLIAAAGDRLADAIEAALAARGRALIVLTGGGTGIGLLRR
LGEHAARIDWERVHVYFGDDRFVPGDDDERNEKQAREALLDHVGIPADNI
HAMAASDGAFGNDLDVAALAYEQLLADHAEPGERTPDFDVHLLGMGGEGH
VNSLFPDTPAVIESARLVLPVYDSPKPPPRRITLTLPAVRRSRQVWLVVS
GAAKAEAVAAAVGGADPVSVPAAGAVGREETIWLLDEAAAAGLSTS
333990909YP_004523523.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium sp. JDM601]MVSAATARHTAGGWRNPLRDKRDKRLPRIAGPCGVVIFGVTGDLARRKLM
PAIYDLANRGLLPPTFALVGFARREWADEDFADVVYQAVKQHARTPFRQV
VWDRLAEGFRFVQGTFDDDAAFAELAETLDKLDAERGTGGNHAFYLSVPP
DAFPVVCEKLHASGLARPRDGRWSRVVIEKPFGHDLDSARELNSVVNRVF
PEESVFRIDHYLGKETVQNILALRFANQLFDPIWNAHYVDHVQITMAEDI
GLGGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPVSFSPAELQAEKIKV
LSATRLAQPLDETTSRGQYAAGWQGGEHVVGLLDEEGFAHDSRTETYAAI
TLEVDTRRWAGVPFYLRSGKRLGRRVTEIALVFKQAPHLPFDATMTDELG
KNALVIRVQPDEGITLRFGSKVPGHLMEVRDVNMDFSYGSAFAEDSPEAY
ERLILDVLLGEPSLFPVNAEVELSWEILDPVLENWAEHGRPEPYAAGTWG
PRSSFEMLARSGREWRRP
333990907YP_004523521.1 transketolase Tkt [Mycobacterium sp. JDM601]MTTATEISALTRPHHPADWAEIDSVAVDTARVLAADAVQKCGSGHPGTAM
SLAPLAYTLFQRVMCHDPSDPHWLGRDRFVLSCGHSSLTLYIQLYLGGFG
LELSDLEALRTWGSKTPGHPEFRHTTGVEITTGPLGQGLASAVGMAMAAR
YERGLFDPDAAAGESPFDHYIYVIASDGDIQEGVTSEASSLAGVQQLGNL
IVFYDHNKISIEDDTAIAMCEDTTARYRAYGWHVQEVEGGENVTGIEEAI
ANAKAVTDKPSFISLRTIIGYPAPDKMNTGAAHGAALGDDEVAATKKVLG
FDPDKSFDVREDVITHTRGLVARGKAAHDEWQAQFEAWAAREPERKALLD
RLLAGELPDGWDAELPSWEPGSKAVATRAASGKVLSAVGPKLPELWGGSA
DLAGSNNTTMDGVKSFGPTSISTKDFTADPYGRTLHFGIREHAMGAILSG
IVLHGPTRAYGGTFLQFSDYMRPAVRLAALMDIDPIYVWTHDSIGLGEDG
PTHQPIEHLSALRAIPQLSVVRPADANETAYAWRTVLARGADSGPVGLIL
TRQGVPILEGTDADGVARGGYVLGGAGAEQPDVILIATGSEVQLAVEAQK
LLADKDINARVVSMTCLEWFESQPAEYRDAVLPPAVSARVAVEAGVAQCW
HKLVGDTGEIVSLEHYGESADYKTLFREFGFTAAAVVAAAERALER
333990905YP_004523519.1 cytochrome C oxidase assembly factor CtaB [Mycobacterium sp. JDM601MRSTLLAYLSLTKPRIIELLLVTTIPAMLLADRGTVNPLLIFNTLIGGML
AAAGAHALNCVVDADIDKVMKRTARRPLARDAVPTRNALVFGLVLGAVSF
VWLWRFTNLMSGLLAVATIAFYVLVYSMLLKRHTSQNVVWGGAAGCMPVV
IGWSAVTGTVGWQALVMFAVIFFWTPPHTWALAMRYKDDYAAAGVPMLPV
VASERVVTHRIVVYTWATVIATLALVPAAGWLYASVAFLAGVWFLAMAHQ
LYAGVRRGEPVKPLRLFLQSNNYLAVVFCALAVDSAIGLPTLF
333990903YP_004523517.1 PPE family protein [Mycobacterium sp. JDM601]MGAEYTEAADELMALLGAVQAGAWQGPGAESYVMAHAPYLSWLRGAAADS
AAAAAGHETVAGAYLSALSTMPTLPELAANHVSHGALLATNFFGLNAIPI
ALNEADYVRMWVQAATTMSVYQAVSGAAVASTPQPLPAPPILKADAPRGD
DEGTDPTVNDPLDQLIAQLLQTASNGQVNWDPAHAMVNGIPYDQYVDPNQ
PLFWLVRALELFEDFQQLGVNFQQNPALAFQYLVQLAEFDWPTHIAEIAT
WVGQSPQLFAAVLGVVVAPVGAVGGLAGLTGLAGLPQSGASIPAPPSGPG
GHELPAIGTVPPAPAVSGTVSASAPAPPVPAGVAAGSAPALIGPPPAAGA
TFVPPYLIGGPGIGSGSGMAAAARAARKASEPDSAAAAAAAREAERRRAQ
ARRRRRAAKRGHAGQFMTMGVGVAPEWQLPDDDPAAADRGTGTLGFAGNA
ANGRSTAAGMARLDGAFGNGPRQPMVPGSWDADGDKP
333990901YP_004523515.1 quinone reductase Qor [Mycobacterium sp. JDM601]MHAVEIAATGGPEVLELVDRPQPSPAAGEVVIRSEAIGVNYIDTYFRSGI
YPAELPFVLGNEAAGVVAETGAGVTTLSGGDRVVTAAATDGYAQYCAAPA
ALVAPIPAGVDSDVAAAVLLKGLTAHYLIKSVYPVQPGDTVLLHAGAGGV
GLILTQWATALGARVITTVSTPAKADLSRAAGAAEVLDYPGSDDTAAAAF
GARIRELTDGAGVAAVYDGVGAATFDASLASLAVRGTLALFGAASGPVAP
VDPQRLNAAGSVYLTRPNLAHFTRSEQEFSWRTGELFDAITAGSIEVTVS
RRYPLAEAADAHRDLQARKTTGSIVLIP
333990899YP_004523513.1 antibiotic ABC transporter transmembrane protein [Mycobacterium sp.MARFLMRLVDLLPDPSLRTQRLLAAAVVFTQGFISVSGAIVRVTASGLGC
PTWPQCFPGSYVPVAVSEVPRIHQAIEFGNRMVTFAVVITSALAVLAVIR
ARRRREVLVYAWLMPASTVLQAIIGGITVRTGLAWWTVAVHLLVSMLMVW
LAVLLYVKVGEPDGETVVVRHRVPVPLRRLTALCAVMLAAVLVTGTLVTA
AGPHAGDKSTTRTVARLKVEVVTLAHLHESLLIGFLGLLVGLAFGLAAVR
AAKPVTNRLAWLTALTLAQGLIGVVQYFTGVPAVLVTIHVAGAVLVTGAT
AALWASLRERAQPEPV
333990897YP_004523511.1 antibiotic ABC transporter ATP-binding protein [Mycobacterium sp. JMAVRLRGVRKRYGAGPTATEAVAGLDLEVHTAEVFALLGPNGAGKTTTVE
MCEGFVRPDAGTIEVLGLDPIADNDRLRERIGVMLQGGGGYPAARAGEML
KLVASYSANPLDPQWLLETLGLTDAARTTYRRLSGGQQQRLALACALVGR
PELVFLDEPTAGMDAHARLLVWELIDALRRDGVTVVLTTHHLREAEELAD
RLLIIDHGKVVAAGTPAELTRSGAQGQVRFTAPPRLDLSLLLTALPEDYR
ASELQPGEYLVEGAVDPQVLATVTAWCARLDVLATQLRVEQRSLEDVFLD
LTGRELRP
333990895YP_004523509.1 transcriptional regulator [Mycobacterium sp. JDM601]MKFKAEANAASQTAGQRPGGAVSAAPQPGAELAGSHDSSEGRTRQAVVRL
LMESGSITAGDIGARLGLSAAGVRRHLDALIELGDAEAHAPAAWQQVGRG
RPAKRYQLTDAGRGKLGHRYDDLAVAAMRQLREIGGEDAVVAFARQRIDT
ILSEVAAVAAEGDSDTDGDLEATAERIAAALTEAGYAASTARVDGGVPGV
QILQHHCPVANVAKEFPELCRAERQAMAEVLGTHVQRLATIADGGYVCTT
HVPLTIKSAKSGRAGKTTKAGRTGTAAKKQ
333990893YP_004523507.1 hypothetical protein JDM601_2253 [Mycobacterium sp. JDM601]MASTDLRSASPSNLTEAAEGINKGEQFTSFDVDAFEVPHGRDEIWRFTPL
RRLRGLHDGSAVADASAAIAVTADAAVRVETVARGDDRLGAAGVPADRVA
AQAFSAFQEATVLTVPKEAVVEEPVTITITGPGEGSTAYGHLQLRAEELS
QATVVIDVRGSGTYADNVEFVVGDAATLTVVWLAEAAADLAYVTMHHAAL
GKDAVLRHSAVLLGGELVRLTGRVRFDGPGGDAELLGLYFADDGQHLESR
LLVDHSQPNCRSNVLYKGALQGDPGSGLPDAHTVWVGDVLIRAAGVGTDT
FEVNRNLVLADGARADSIPNLEIETGEIVQAGHASATGRFDDLQLFYLQA
RGIPEDQARRLIVRGFFGEIISKIPVPFVQERLTEAVERELAVTENN
333990891YP_004523505.1 cysteine desulfurase [Mycobacterium sp. JDM601]MTVSDTTVAPGRPAAPDLAAIRADFPILSRVMRGGSRLAYLDSGATSQRP
LPVLDAEREFLLHSNGAVHRGAHQLMEEATDAYEDGRSAIARFVGADPDE
LVLTKNATESLNLVAYGFGDNRFEAAVGPGDVIVTTELEHHANLVPWQEL
ARRTGATLQWYEVTPDGRIDLDSLKLDERVKVVAFTHHSNVTGALAPVAE
LVSRARAVGALTVLDACQSVPHQPVDLHALGVDFAAFSGHKMLGPTGIGV
LYGRRELLAALPPFLTGGSMIETVTMSSSSYAPPPQRFEAGTPMTSQVVG
LAAAARYLDAIGMDVVEAHEHELVAAALEGLAGIDGVRVIGPTTMTDRGS
PVSFVIDGVHAHDVGQVLDDDGVAVRVGHHCAMPLHRRFDVAATARASFA
VYNTHDEVERLLAGIQRAVKFFGRA
333990889YP_004523503.1 hypothetical protein JDM601_2249 [Mycobacterium sp. JDM601]MSETGPDELLAEVEESMHDVIDPEIGINVMDLGLVYDLAIRHDEEGAAAV
VTMTLTSPACPLQDMIAEQVENATVGAGLVKKLDLSWVWEPAWGPDKITD
EGREMMRAVGFTV
333990887YP_004523501.1 metal-dependent hydrolase [Mycobacterium sp. JDM601]MVGMAAAAAGTAVGGLAGCGSRGPGADTIFIGGPVVTAVPGFPEAEALAV
TGGRITQVGSRDDVLRLRGSETTVVDLRGRALLPAFVEPHGHPFEMGTTL
APPAIDVRPFTVSTAGGVFQKLTEAVADTPKGQPILLNGVDPLLQTGLQS
FTRTELDRLAPQNPVVIITNSGHAGYGNTAAFAAAGITKTTPNPPGAQYL
RGPDGQLTGEVREAAALMALTAPFSGAIMANAGDNLRWAYAQLARAGIAT
ATEHSYDARTQSEVFAKLAQQPDCAIRVRAYEIGTPELADDADNMRGKRA
GADVLFDKIGMKIWADGSPWQGNIFTTFPYLTNATTASMGLGRDHRGGMN
YTPEQIQQLAAAFIDQRWQVSCHVQGDAAIDVVLDAFEQARVPPALRPRI
EHVGAMRPDQFARAARLGVTPSMFIEHIYFWGDVLVDKLFGPDHGAHWMS
ARSALDAGLRLSFHNDGTVTPPDPIGNIATAVNRIAKGSGRVLAPEQRIG
VDAAIRAQTLNAAWQLRLDTEIGSLEAGKYADLVVLSQNPRRIPPAELRD
VAVEATYLMGRQTYGKVLG
333990885YP_004523499.1 hypothetical protein JDM601_2245 [Mycobacterium sp. JDM601]MPARPSTSAPAIRTLTGAAALFAAALVLPSPAHAQGDRVIGPVTSVSGNT
FEVGQPAGTAKVTWTDSTRVFESVPAQLGEITAGTCIKAGAATDSSPADS
GAITAKFVSISTAVDGKCPQRPAAAADAPAPPKPHRGVRGAVESVAGNTL
TVAGPEGPVTVTVNDDTTFRRKVAVSAPSISTGKCAAARGDKDAEGVLQA
TKVTVWNSNGGDCPQPGA
333990883YP_004523497.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MPTVESGSDFILVDRPRPQVALITLNRPERMNSMAFDVMVPLREVLAQIG
YDNSVRVVVLTGAGRGFSSGADHKSAGSVPHVAGLTRPSFGLRSMELLDD
IILGFRRLHQPVIAAVNGAAIGGGLCLALAADIRVAATGAYFRAAGINNG
LTASELGLSYLLPRAIGASRAFEIMLTGRDVDAAEAERIGLVSQVVERPA
LLDTCYDMAERIAGFSRPGTELTKRTLWSGLDAGSLEGHMQAEGLGQLYV
RLLTSNFEEAVAARAEKRPPAFTDDVGTDDK
333990881YP_004523495.1 transcriptional regulator [Mycobacterium sp. JDM601]MATTKPDKLRDRQLVELRNAYEGGASIRTLAASTGRSYGSVHSMLRESGV
AMRSRGGPNHRTRSR
333990879YP_004523493.1 aconitate hydratase Acn [Mycobacterium sp. JDM601]MTSKDSLNSFGASDTLKVGDDEYQIYRLDAVPGTEKLPYSLKVLAENLLR
TEDGANITKDHINAIANWDPAAEPSVEIQFTPARVVMQDFTGVPCIVDLA
TMREAVAALGGDPEKVNPLAPAELVIDHSVILDVFGRADAFERNVELEYQ
RNGERYQFLRWGQGAFDDFKVVPPGTGIVHQVNIEYLARTVMVRDGIAYP
DTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPRVVGFKLT
GEIKPGVTATDVVLTVTDMLRRHGVVGKFVEFYGKGVAEVPLANRATLGN
MSPEFGSTAAIFPIDDETINYLRLTGRSEQQLALVEAYAKTQGMWHDPAR
EPAYSEYIELDLGTVVPSIAGPKRPQDRIELSDAKTAFRKDIHNYVGEDS
DAPHSQLDEAVAESFPASDPAVLSFADDDAAVPSAAQDCDGRPSKPVKVS
SAERGDFVLDHGAVVVAGITSCTNTSNPEVMLGAALLARKAVEKGLTSKP
WVKTNMAPGSQVVTDYYNKAGLWPYLEKLGFYLGGYGCTTCIGNTGPLPE
EISKAINDNDLSVTAVLSGNRNFEGRIQPDVKMNYLASPPLVIAYAIAGT
MDFDFETQPLGRDSEGNDVFLKDIWPSTAEIQETIASSIDRDMFTKSYAD
VFSGDERWRSLPTPEGNTFAWDEKSTYVRKAPYFDGMPAEPAPVADITGA
RVLALLGDSVTTDHISPAGAIKKGTPAAQYLEANGVSPRDYNSLGSRRGN
HEVMIRGTFANIRLRNQLLDDVSGGYTRDFTQSDENGESPQAFIFDAAQN
YAAQNIPLVVLGGKEYGSGSSRDWAAKGTALLGVRAVITESFERIHRSNL
IGMGVIPLQFPAGESAASLKLDGTEVFDITGIEELNTGKTPKTVKVTATK
ADGSRTVFDAVVRIDTPGEADYYRNGGILQYVLRNMLKSK
333990877YP_004523491.1 invasion and intracellular persistence protein IipA [Mycobacterium MRRIRCGSDGTVLERVVKLTRPAAASVLMTAMLLGTPGLAAAEPARDPDG
IARLIADVAEANQQLQDLGAQIAQQKEGVNKALVDLQTAREDATAAQQEV
EAGRQAIADADAAIVAAQQRFNTFAASTYVNGPSESYLTARDPSELMATA
AAGQTLVLSSQQALDSLKRARTEQLNKESAARLAKQKADQAVANAQTSQD
DAVATLTDTQRKFGEQQAEIDRLAAQRNEAQAKLAAARGQQTPPAASAPS
ADRWGNPGDAGPAPAKRTDQWDGPWDPTLPMIPSANVPGDPIAVINQVLG
ISQTSAQVTSNLGRQFLQSIGLAKPDDSGINNGRIPRVYGRQASEYVIRR
GMSQRGVPYSWGGGNAAGPSRGIGSGSGTVGFDCSGLILYAFAGVGIKLP
HYSGSQYKMGRQIPTAMARRGDVIFYGPGGSQHVTLYLGNGLMLEAPDVG
QPVKVSPVRKSGMTPFVVRYIEY
333990875YP_004523489.1 transcriptional regulator [Mycobacterium sp. JDM601]MTSSDGTPAGASGFPGPEGASSAGSGLAADVHALERAIFEVKRVIVGQDQ
LVERILVGLLARGHVLLEGVPGVAKTLAVETFAKVVGGSFARIQFTPDLV
PTDIIGTRIYRQGREEFDTELGPVMVNFLLADEINRAPAKVQSALLEVMQ
ERKVSIGGKTFALPNPFLVMATQNPIEHEGVYPLPEAQRDRFLFKINVGY
PSPEEEREIIYRMGVTPPEPKQILGTGDLLRLQGLAANNFVHHALVDYVV
RVITATRVPEQFGMPDVKNWLSFGASPRASLGIIAASRALALVRGRDYVI
PQDVIEVIPDVLRHRLVLSYDALADEITSEIVINRVLQTVPLPQVNAVPQ
QPHSASPGAPTAAAVASGR
333990873YP_004523487.1 hypothetical protein JDM601_2233 [Mycobacterium sp. JDM601]MTLPLLGPMTLSGFAHPWFFLFLFVVMGLVALYILMQVARQRRILRFANM
ELLESVAPKSPTRWRHLSAVLLVSSLLLFTVAMAGPTHDVKIPRNRAVVM
LVIDVSQSMRATDVEPSRLAAAQEAGKQFADELTAGINLGLIAYAGTATV
LTSPTTNREATKAAIDKLQLADRTATGEGIFTALQAIATVGAVIGGGDTP
PPARIVLLSDGKETVPSNPDNPKGSFTAARTAKDQGVPVSTISFGTAYGY
VEINEQRQPVPVDDDSLKKIADLSGGSAYTASSLAQLKEVYATLQDQIGF
ETIRGDASTGWLRLGSFILALAGLAALLLNRRLPA
333990871YP_004523485.1 enoyl-ACP reductase [Mycobacterium sp. JDM601]MAGILEGKRILVTGIITDSSIAFHIAKQAQEAGAQLVCTGFDRLRLIQRI
IDRLPEPAPLLELDVQNTEHLDTLADRITEVIGEGNKLDGVVHSIGFMPQ
TGMGVNPFFDAPYEDVAKGIHISAYSYASLAKATLPIMNPGGSIVGMDFD
PTRAMPAYNWMTVAKSALESVNRFVAREAGPQGVRSNLVAAGPIRTLAMS
AIVGGALGEGAGEQIRLLEEGWDQRAPVGWDMKDPAPVAKTVCALLSDWL
PATTGTVVYADGGAHTQLL
333990869YP_004523483.1 hypothetical protein JDM601_2229 [Mycobacterium sp. JDM601]MQSVAAYDAISIGEAGWAWSGGHDAGAASLLQLVRGAAAPAAGSAIQPVF
PVPGDVRGLPAGTVFAREAVVAGEGVLIGGPDSATAVGLVPLYVEDGDSP
GEPVTELSWTAYPLTVMPVTEHHDLGDAEYALRSAVRTAAGALGSTGSRW
ADYGVEDPRLQVEQMLEAAALHRVPDHAPTRAVRVLQSAAHVEAIVTVSA
DLLTATAYSSSAVQSAVDAVRPLAAVVRSARSAAVTAILQSAWR
333990867YP_004523481.1 hypothetical protein JDM601_2227 [Mycobacterium sp. JDM601]MEGATTGLVLLAVLVIFAAIVVAKSVALIPQAEAAVIERLGRYSRTVSGQ
LTLLVPFIDRVRARIDLRERVVSFPPQPVITEDNLTLNIDTVVYFQVTNP
KAAVYEISNYIVGVEQLTTTTLRNVVGGMTLEQTLTSREVINSQLRGVLD
EATGRWGLRVARVELRSIDPPPSIQASMEKQMKADREKRAMILTAEGQRE
AAIKQAEGEKQAEILTAEGAKQASILAAEGERQSRMLRAQGERAAAYLQA
QGQAKAIEKTFAAIKAGRPTPELLAYQYLQVLPEMARGEANKVWVVPSDF
GSALQGFTKLLGAPDEDGVFRYQPSPVDDTPARPEDDSEEVADWFTTQTD
PAIAQAVAKAEADARKPVEGAILPPQLDPGMA
333990865YP_004523479.1 hypothetical protein JDM601_2225 [Mycobacterium sp. JDM601]MADRNAAVRKYLTEMIGTFVFMFAVIGIVLGGSECVAATALGIGAVLMVM
VYASGHISGGHLNPAVSIAAYLRGALPLGDLGPYIVAQLVGALAAFGVGF
GLWHDKYSTGTLDLSGAVWPAFLAELVFTFALCYVVLHTATSKDSAGNSF
YGLAIGFIVTVGVVAVGAISGAAFNPAITFGLMLSGVFAWKFLWVYLLAQ
VLGAVVAAYAYKATSLDDHTAPRHEHTAARRG
333990863YP_004523477.1 hypothetical protein JDM601_2223 [Mycobacterium sp. JDM601]MKTAATGIPQALRSAWPALVTIARQVAVWRLALTTAVIVTLVAVALLVPV
PTAVQLRDWAQTLGPWFPLAFLTAHTVVTVLPFPRTAFTLAAGLLFGPWL
GIVLAVSASALSAVTALILMRVFGWQLSRVVRHPRMHSLDARLRERGWPA
VVSLRLIPAIPFSVINYAAGASAVRLLPYTVATLIGLLPGTAAVVVLGDA
LTGDVSPQLFAVSACTAAVGVALLVYEVRSHRRHRGACDTSATTEAAEPA
VTC
333990861YP_004523475.1 methylmalonyl-CoA mutase large subunit MutB [Mycobacterium sp. JDM6MTASTSHSTLGSFADVALHGDQHSAPVAEVSATAVAEHVAAAAAAHGYTP
EQLEWHTPEGIAVKPVYTAADRAAVLADGYPLDSFPGEAPFVRGPYPTMY
VNQPWTIRQYAGFSTAADSNAFYRRNLAAGQKGLSVAFDLATHRGYDSDH
PRVQGDVGMAGVAIDSILDMRQLFDGIDLSAVSVSMTMNGAVLPILALYV
VAAEEQGVPPEKLAGTIQNDILKEFMVRNTYIYPPKPSMRIISDIFGYTS
AKMPKFNSISISGYHIQEAGATADLELAYTLADGVDYIKAGLDAGLDIDK
FAPRLSFFWGIGMNFFMEVAKLRAGRLLWSELVAQFNPKNPKSLSLRTHS
QTSGWSLTAQDVYNNVARTCIEAMAATQGHTQSLHTNALDEALALPTDFS
ARIARNTQLLLQQESGTTRPIDPWGGSYYVEWLTHQLAQRARAHIEEVAA
HGGMAQAISDGIPKLRIEEAAARTQARIDSGRQPLIGVNKYQVAEDTEIE
VLKVENSRVRAEQLAKLEQLRAERDETACQAALDELTRAAGTQGAAGEDG
LGNNLLALAIDAARAKATLGEISDALEKVYGRHQAEIRTISGVYRDEVGK
GSNISSATALVEKFAEADGRRPRILIAKMGQDGHDRGQKVIATAFADIGF
DVDVGALFSTPDEVARQAADNDVHVVGVSSLAAGHLTLVPALRDALAEAG
RPDIMIVVGGVIPPGDFDELYAAGATAIFPPGTVIADAAADLLQTLASQR
GYVLDEVLDELGEPDGPVADQK
333990859YP_004523473.1 esterase [Mycobacterium sp. JDM601]MTQHPGARRSALPANVHGAADPNFACAVRAFAAMFPGRRYGGGALAVYLD
GRPVVDVWTGWSDRAGRVPWSVDTGAMVFSATKGAASTVIHRLVDRGLID
YDVPVAQYWPEFGANGKAGITVRQLLGHRVGLTHLQGASRADLLDHATME
ARMAAAAPGREFGKPAYHALTYGWLMSGLARAVTGTGMRELFRAELAAPL
NTDGLHLGRPPAACPTVAAEIIMPQRSRRNPIVDFVAPKAAAMLPYGGFG
AFYFPGVMDTVRGDVPFLDTEAASLNGVATARGLARLYGALANGGQLDGT
RFLSRRLVDGLTGRRTLEWDRTVGVPLAFHLGYHAIPFGQVMPGFGHVGL
GGSMGWADPATGLAFGFVHNRLLTPFVALDHAGFVGVAALVRRAVARGRR
RGIDAVPLLGAPFGDAAAAIG
333990857YP_004523471.1 hypothetical protein JDM601_2217 [Mycobacterium sp. JDM601]MRLSNRHSDDFSLCCQVRGPHLLSSSAPSRVVTCGVRTDGFAARRPCTAE
VCNWIGDIWDASLGSGPVGNVARPAQRSAAASPGAGCPPCRSKRRAGTSG
RRDRAAHAAGTGGSTIDTGTPSGCLEPTQKLLGPRHPRRFPPAEATT
333990855YP_004523469.1 beta-ketoacyl synthase [Mycobacterium sp. JDM601]MEVAWEALEHAGITKEAIRGTQTGVFVGMTTSDYALDMIGNIQAADIDPY
VPFGNAANFAAGRLAYFLGVHGPAIMLDTACSSSLVTIHLACASLRRRES
DQALAAGVNLMLTPQNSIATSRWGMLAPDGQCKTFDAGADGYVRSEGAGV
VVLKRLSDAQRDGDRVLAVVRGSAVNQDGPSSGQTVPSGPAQQKVVRAAL
AASRLSPGDIDYVEAHGTGTALGDPIELDALAAVFGERGAAAPLVLGSVK
TNLGHLESAAGVAGFIKTVLAVQHGFIPRHLNFSALTPNAGVGASKFQVA
ATAMEWPAVSRPRRAGVSSFGVSGTNAHVVVEQAPVSESVSPVAEPVVST
LVVSGKSPARIAATAGVLADWLAGDGADVPLTEVAHTLNHHRTRHQKFAT
VAARDHRQAIAGLSALAAGESAPGVVEPATVLPGPGTVFVFSGQGSHWAG
MGRRLLVDEPVFAAAIDELEPDFVAQVGFSLRDVIASGAEISGDAQVQPV
IMGLQVALAALWRSYGVEPDAVVGHSMGEVSAAVVAGALTPQQGLRVIAA
RSALMSRQAGAGAVALLELDAAAAQELLAGYPQVEVAGYLSPRQTVVAGL
PAEVDAVIAAVAGRERFARRVNMEVASHTAFMDPILAELREQLADLVVSA
PRIPFFSTVVDPAGPVPVLDADYWVANVRQPALVAQAITAAAREHGIFIE
ISPHPLLTHTIDENLEATPHRSVATLVRDGDDTVGFHQHLNSAHPLKPRD
LPHPPEPHPVLPTTPWRHTRHWLEIENSVSAAESAPRPGVLLGTHIKIGS
TPTVHLWQARLAPESKPYPGSHRNNGVELVPASVLLQTLSEAAVEASGQP
AVSDIRFEHPIIIDRPRTVQVVADAESIAILSKAVTDDAGARWVKHLSAR
IAPRGESACDGTKPMHKNGHAGTQFDDDAVTSLWLTWGSEGRPFDWSLRA
GRSTPAELRADIEAAAAAQSGTVALLDAALHVARLVDDANPDLMVPATAH
SIRLGEPPADGRAGVTVHRREGDDGELIVDIAVSTPDGECCVDIRSLRYT
ALETAAPTGDPSSIAHVIDWQPWEAAPQTPEQPGTLAVLGDGDAAEALRG
GLVAAGHRCAGITDAQAVVYVAGSRPGETDLDCASRLVGEVSELVAQLAE
RENHPPALWIITQGVHEAGSDAAVRQSALWGLAGVIRAEQPQLCGGLVDL
PEDPVGIAGGVAPLSAVLRTPAKSILVLRDGQFLAPTFTPISGPPQREPM
VCQPDGAYLITGGMGALGLLMAGWLADRGARRLVLAGRSALPPRRDWDGD
DVAPDLRRRIAAIRALERRGVSVDVAALDIGSREAVAELLARRDAAGAPP
IRGIIHAAGITEGQLLTEVDDDRLRATMWPKIAGAQVLHELFPPASVDFF
FMTAAAGAVFGVPGQGAYASANAYLDGLARARHRRGCHSVSLDWVAWKDL
GFGAEAHVVLHELERMGSRPISPAEAFAAWDHVEHYDVAQAVMVPLPTEG
SVGKPGSAVADAGGPTRDWAQLPADEILSELEIGLRSILARELRMPEADL
ALDRPFAELGLNSVMAMAVRRDIEALVGLELSATMLWNHPTTAALAAHLT
GKLLPQEDSGDDPAAAGAELPESADSVLNELFDSVESAPAGWDGI
333990853YP_004523467.1 phenolpthiocerol synthesis type-I polyketide synthase PpsD [MycobacMEVAWEALEHAGITKEAIRGTQTGVFVGLTTNDYALIAAEKVGPRDVDPY
LSFGNGPNFAAGRLAYFLGVHGPAIMLDTACSSSLVTIHLACASLRRRES
DQALAAGVNLILSPQNSVATSRWGMLAPDGQCKTFDAGADGYVRGEGAGV
VVLKRLSDAQRDGDRVLAVVRGSAVNQDGPSSGQTVPSGPAQQKVVRAAL
AASRLSPGDIDYVEAHGTGTALGDPIELDALAAVFGERGAAAPLVLGSVK
TNLGHLESASGVAGFIKTVLAVQHGFIPRHLNFSALTPNAGVGASKFQVA
ATAMEWPAVSRPRRAGVSSFGVSGTNAHVVVEQAPVSESVSPVAEPAVST
LVVSGKSPARIAATAGVLADWLAGDGADVPLTDVAKTLRDNRSRFKYTAG
VCARDRAAAVAGLAALAAGDSAAGVIEPRPRLAGTRRVFVFSGQGSHWAG
MGRRLLVDEPVFAAAIDELEPDFVAQVGFSLRDVIASGAEISGDAQVQPV
IMGLQVALAALWRSYGVEPDAVVGHSMGEVSAAVVAGALTPQQGLRVIAA
RSALMSRQAGAGAVALLELDAAAAQELLAGYPQVEVAGYLSPRQTVVAGL
PAEVDAVIAAVAGRERFARRVNMEVASHTAFMDPILAELRAELADLVVSA
PRIPFFSTVVDPAGPVPVLDADYWVANVRQPALVAQAITAAAREHGIFIE
ISPHPLLTHSISETVEATAAEPATVISTLRRGDDETVSFHLQLAELGVGA
SSVTAGGFAELPPTPWQHAHHWISAPARIGQAPDVHPLLGPHVEMLTGRD
HIWQTELSAELLPWPAAQVQGQTVLPAAALIEMALAAGSQALGRPVEAIS
VTGLQIEQPLVLDGGMQVTTQLSGADAQTRVEIHARAVGQSWTRYALADI
TAAQQAGDDAVTGDSVLTLPEDVATHPGYQLHPVLLDAALRQLAAAISDG
DSEGLGYAPTAVAAVRVLGRTGHQVRCRTELTSRDDTAAVGRIVLTDDSG
AVLAELTGVELHPIDPGSLRVPLEQKLFTTEWIEARAPEPTGAAAGSWLL
LTEPDAAGDGATERLAAAFAARLAGPDRKVIAGPFADQPALAEAVAQAGA
DPAHPPAGIVVFLGQLGSDGTSPADPQALARARDLIWTASTAARAAVQDW
SGTNGARLWLVGRGGLAVGADEPGDPAVGALKGVVRTWRFPGELARVLAD
EPDLGATLVDLDAADDVDALVGVLLAELQAPVRDDIIGWRAGQRYTERLT
RASLGETPQGCGDGHAKVRADGSYLLTGGLGGLGTVVARWLVSRGAGRIV
LNGRSEPSEQQRAVLDELAAGAEVAYVAGDISSPGVAQRLVAAAEETGRP
LRGVVHAAGVLGDGLVTAVSPESLAGTWSAKALGGALLHTATADRPLDWW
VGFSSMAALLGLPGQLGYATSNAWLDALMTWRRASGLPGTAIDWGQWSDV
GIGRSMTLSVLDPISPEEGVEALDAVLGAASLGPRVGVGRLRIDRAVATS
PEFRDLTFFEDLVGEASAVGAGEQDSGTAAGGGEAGAPDWSQIPADQRRD
ELVVRLQAILARELRTSAAAVDVDQPFPEMGLDSMIAMTVLKETQQLVGV
DLSASMLWNHPSISALATHLVGLLASRYAPQDEAARDDGHLTFDSSGGVL
DELFDQVESASTGSESGSF
333990851YP_004523465.1 phenolpthiocerol synthesis type-I polyketide synthase PpsE [MycobacMSTNNELPPNAIAVVGMAGRFPGARSLTGFWDNLRNGTESIVTLSEDELR
ANGVSDKALANHNYVRRAALLDGIEEFDAGFFGFTPLAARTMDPQHRLFL
QTAWHALEDAGYRPGELEGSVGVYGTSTTSGYLLHNLMSHYDPNLIIGQG
VSFEMVNLSLQNDKDYLATRVAHQLNLRGPALSVQTACSSALVAVHLACQ
SILGGECDMALAGGSSLRVPHHVGYWHEPGSMVSGTGHCRPFDVRADGTI
FASGVGVVVLKALEAAVDDGDHIHAVIRGSALNNDGATKMTYAAPTAAGQ
ADVIAEAHAVAEVDAATISYVESHGTGTPLGDPIEIEGLRQAFAVSEEPR
SGPCYVGSVKSNIGHLESAAGIASLIKTILCLQHRAIPATLHYTSPNPEL
HLDDGPFEIRSEYGPWEADGIRRAGVSSFGVGGTNAHVIVEEWPADEPAG
AAPRPGPEVLLLSARTSEALQQGRKELASALTAGDSEAPALPDVAHSLAT
RHAYNLRLAAVVADRADAAAVLTAEESENVFIGEGVSDDAAATADRVVFL
FPGQGAQHIGMARGLYDTEPVFAEYFDRCVAGFDAELGFDLRAVIFDGTS
RDLERTDRTQPALFTVEYALAKLVESYGVRPAAVVGHSIGEYAAATIAGV
FDLDTAIKVVAMRARLMHAAPRGVMVAVPISADAVGAYLTGEVDLAAVND
PDGCVVAGAEDAIREFSETLKQAGVNARRVRTSHAFHSRLMDSMISEFTA
FLSRQTLNEPRIPVLSNLTGTWLAPSEATNPATWARSVRATVRFADEIDT
LLDEPHRVLVEVGPGATLTASAARNPKFAGGHRAVRLMRHHAQNRDDRDA
FLLALGQLWAAGVEVDWAGLRGDYQPKRVTVPGYPFERQRHWLEHNAGAT
WVSGAATNGTAANGTSGADGAAGSAGPSMDATLQRIWAVCLGVSSVDRNA
NFFDIGGDSLVAISVAMAASHEGLDLTPQDLYDNPTVSALAKALTARYAA
GGLARQSPGDVEHPPVPPNITYFLENGVREHGRWRIPLILRLRPDVSVDD
VRAVLTAVVNHHDALRLRITERAGTWEQRIAEPGEFGEISTHSLPEGLTA
EHDAVRTMLAEHIGEQELSCPPLTALYIRGAAGDVCYLALSLHAIVGDEA
SRDILLTDIFTAFGQQLAGNDIELAPVGVGWAEWSQRCAGLATHPAVLES
REFWLRTTQAATLRLGADVAEPPAAADLAKLTSALAAADVSEIDDARRRL
RLPINEILLAGLSRAVAAAVGEGTVAVDMAGTGRSVLKPDIDLRRTVGSF
TTIYPVALHCATAAPAGARRLLDEIHETLGAVPHYGIGYGLLRYLYAPTA
RLFGSVPPAEIHFAYVGAIPELPAAGDAPVQFDPDTAMPVREAIPGLGHA
LELRAYRSAGVLHLDWWYDSRRIEEPVVRAIAEGFTTAVMDLVREAIAED
ELDSADAADGEMTLVELS
333990849YP_004523463.1 O-methyltransferase [Mycobacterium sp. JDM601]MADKIPVDLHGAAQTMLTTLYLKALDADFDYPVLGDRYAKEAVERIDFDW
DALKAPGRWAPLVTVRTAQYDIWARQFLAAHRRATVIHLGCGLDARVFRI
DPGPEVIWYDVDQPPVIALREQIYPDRPGYHLMATSATDPSWLDEIPADR
PVLLLAEGISMYLTESDGVALLQSVVDRFPAGELQIDFYNWFGIKSQKTH
RLQRQSGATLHWAVNSPDDILDSVDGLRLLAGANLFDAETFGRVPAGFRR
SARVARALPPLRTMLQYHRYAFGPVS
333990847YP_004523461.1 hypothetical protein JDM601_2207 [Mycobacterium sp. JDM601]MPRSFDIVFESPASVEQIQSAFGSRDYWLARNAEFDGGEKTLDSLTVDEQ
GAVRVVVTEDLRHGALPGMLTKVYRGDLNIVTTEVWTPTGDGRVNGDIDV
AVVGAPGRGGGTALLQPAGSGSRMNLTGTIEFKIPLVGGPIERFLAKEFA
EGIPNIQRFTAGWLADHG
333990845YP_004523459.1 hypothetical protein JDM601_2205 [Mycobacterium sp. JDM601]MLAAALVTPVAAVPAGPLVVGRDLVLASAGDSLLNIPLNLFQAIANIPST
ELGAMTVLGNSLIYSGNWWSPSATNIWGEDPGDPGHFMGTIDMAFPFTQI
SGQGSPAPGAPGFDWDEAAAGHLGLGQQFTLLADAEIPTSASSDADYSAP
LLPSSEITGSSFLDHNAWFFAALSGMQPYPLFDNWFGVPLSDLMAGYTFP
TVINPSMGIGVDSEGNPDGSVPGDPVLGFAGTHPATPDDIANLPQDAATQ
SQGIHVVPGTDEVVNGNGNPVHLMPWSNETFKLDLLYPFQNFYDSLLAPV
ELNTYVSGFQIPTFDEVGRALQTLAAGMVIAFDPSSPGDPFCGSTCLAYP
WATPLALVAGLDKMWPGNPYLENWLALANADSPLNAFYGMANGPTPHQVD
VNDAVSQSLQQWFDVGNASPDDPPANVDTPIAFSPSPMMQQLIDFMEQSG
VQQFFADWANLAGYQPVDFDDFTPVLGAGPDPGDIGGAAAGTADGFAGLL
DAVGLADLAALL
333990843YP_004523457.1 hypothetical protein JDM601_2203 [Mycobacterium sp. JDM601]MVSALRSYFSAGLAITAVGLVAVTPMEPPVPVPDATTIAHPAPRLTADES
LLNVPLNLFQDLVNVPANYIHALDTMAKSLFYSGPWFVGSPTNAWGEDPG
DLGHFEFVAQLLVPFPELSGAGHEGDFFHPGLGQQLSMLANVEIPVDLSC
AGLDCLPVMPTSPITGFTWIDQAIWSLLIATGVQKFPLIQNWFQIPFSAM
MNGNAYYFDPNGPGMVNVGFAHDGFYWEGTRTLEELGLNPEDYPDIDPDA
PLQPWAGSYYEMDFDQPFINFFDSLMQPFDVDKFQLPDLVEFGRALQAVI
ASFLVAFNPFIPGSPFCPGPCLLPEPGGDIFNPEDWNTPSYYLLAKLIGD
LWPGNPVIDEWLAAYDGGTANVSTPEIIEHEAWLWRLGTVLLDLKNPLPD
DPAIDTTDFLPTVDQVRDFLGDYLFNIADNIGIIGPFDIQGLWDAVFDVT
AA
333990841YP_004523455.1 ketoacyl reductase [Mycobacterium sp. JDM601]MALPAPGPDRAAIVTGASSGIGAAMARELARRGHQLIVVARSADRLHALA
AELSPHPVHVLPADLSCRTERAALAGRIADLGLVADILINNAGLSVVALA
ANTEPASQLNLVEVDVAAVVDLCCRFVPGMVARGRGAVLNVSSVAGFGPL
PGQASYGAAKAFVASYTESLRSELRGTGVSATALCPGPVDTRLDIDAGFR
EGERKQVLPAVMWKSVDTVARAAVDGMAAGRGRVTPGWANRLLVAAYRIV
PHGPLLPLLARRTPLSTRSAGEGHTGISSTSRDGRSPDRGSSVMLEVIDK
GCVSEAHPAPLLFVHGAWHAAWCWDENFLGYFADLGYRAVAVSFRGHGGS
AIDKPLRRCSVEDYVEDVRSVADSLPAEPVVIGHSMGGLIVQKYLEGRRA
PAGVLMASIPPQGNYGSSLRWLRSHPWQAIKMAVTGKSLRYINTPELARQ
KFFSDQTPEDQVLECAARLQEDSARVSIDCLMLNLPRPARITAPLLVLGA
EQDGAHTRKEVQATARAYGTEAEFFPGMGHNMMLEPGWESVAERIHDWLG
GRGL
333990839YP_004523453.1 dehydrogenase/decarboxylase [Mycobacterium sp. JDM601]MTAQQVALVTGATSGIGEATADRLRAAGYRVIAVGRNPEALQRLAARGLD
ARTLDVTDEAAARRLVAEIDADHGAVNVLVNCAGFPLTSPLEQLPLSDLR
KLFETNVIAALNLSQAVLPAMRERGTGVIVNIGSTGGRFASPGAGGYHVV
KYAMEALSLSLRAELAPFGVRVVLLDPTVVHTPFVTSQQEAQPSYAADDP
YGDFKRRYAENTRQLSAKRGVMIGPDVVARAVERVVRANNPRPRYIVGLS
GKLTVLARALLTDRMWDRILMRGLRD
333990837YP_004523451.1 methyltransferase [Mycobacterium sp. JDM601]MVRSPSETLEKVGADLVYRISAMPMYKKAFKYWYPFMTKRMGHDDVVFLN
WGYEQDPPLGLKLDESDEENRYSIQLYHQTATQIDLAGKKVLEVSSGHGG
GASFLARTLKPASYTGLDFNPDGVAFCQQRHQVPGLEFVQGDALNLPFPD
NSFDAVVNVEASHIYPDFAQFVREVGRVLRPGGHFLHTDFRAKEDIESWQ
QTLAMPPLRLVNERDISREVVRGLAANSPRSNELINERMPFFLRRFAREF
AVVEGSLFYRDLDRGEITYRIFDLVKD
333990835YP_004523449.1 monooxygenase [Mycobacterium sp. JDM601]MGTQQYQHYQAVIVGAGFGGIGAAIQLNRLGYDNILILDREDGLGGTWRV
NHYPGLSVDQPSTTYSYWFEPNPYWSRLFAPGNEVRAYAEHVADKYDVRR
YMRFNACVDGAQWDEESQTWRVALAGGETLTAQFLIVATGFLCQPKIPDI
PGIDTFAGKIIHTAAWDHDYPMAGRRAAVIGTGSTGIQVIPELAKEVAEL
TVYQRTPILVTPKSDVVFPPVVQRMFARVPFTQRIVRWITDNVTDFMMVL
TMWRYRRFKFLNKAMAAQSALHRLMSVRDRELARKMSPDFDFGCKRPSIS
NDYYPTFTKPNVHLETAGIERIEPGGIVSADGTKRDVDTLVLATGYDVWE
GNLPAIEVVGRGGRNLGKWWRETRFQAYQGMTAPQFPNFIHMASPFAWVG
LSWFNTVEYQMRHMNRLFGELQRRQARTFEVTEEANTAFYERMMGLLDSS
VFHRGNCATSNSYWFNHNTGEAPLFRPTSVRSAVKEQDHFPLSDYLIG
333990833YP_004523447.1 OsmC family protein [Mycobacterium sp. JDM601]MSIADRTVQTSWEGPLATGAGALGSGSSGALDGLPVTWAARTEQPGGKTS
PEELAAAAHSSCFAMALSLKLGENDTPPQRLDVTSTVTLAEVDGLPTITT
SKLTVRGEVAGLDAAGFAQIVDAAAALCPVSRLFAGAEVSVDAQLA
333990831YP_004523445.1 hemerythrin HHE cation binding domain-containing protein [MycobacteMAVSAALEREHQQIDAGLEAFLIDLRDGRVDAAGLSAALEGLRKHIYLEE
RILFPPIRQAGMAMPVAVMMTEHGEIWRTMDALVGLLPDGDTAALMAVSR
LLLDQLAVHNSKEEQVIYRAADNGLEPDQAAAVTEFIETGLLPDSWECLE
AG
333990829YP_004523443.1 hypothetical protein JDM601_2189 [Mycobacterium sp. JDM601]MVDMAMNLLHRRCCSSRRWARQVEDQLVPWALTGVDLGDDVLEIGPGYGA
NIKVLIDRAARYTAVEIDPVLAERLQGEYGSRARIINGDGTATGLPAGAF
SAVVCFTMLHHVPTPELQDRLFAEAFRVLRPGGVFAGSDGVPSWHFRLLH
FRDTYNPMPPESLPDRLRHSGFTDVAVATAAGRQRWRAVKR
333990827YP_004523441.1 hypothetical protein JDM601_2187 [Mycobacterium sp. JDM601]MRKVLSLGCAAVLAVGLAPATRAEPPPGAGAVDSYPIATGRYSSPGDFYW
VFFKTPDGRSCGIGPNGGPIGCDAVPMDAPAGANQTVIEVGGVSASYRRA
ETASFTRDVDVLPQGYRLENWGSRCAVGYQGTVTCQGYGSHGFTISAVYG
VLW
333990825YP_004523439.1 lipoprotein signal peptidase [Mycobacterium sp. JDM601]MTEETTDSTEPATEAAPEPAAPRRRLGLLLSVAAVVLLVDVVTKVLAVRL
LTPGQPVPIIGDTVTWTLVRNSGAAFSMATSYTWVLTLIASSVVLGIIWM
SRRLVSPWWAVGLGMILGGALGNLVDRFFRAPGHLQGHVVDFLSIGWWPV
FNVADPAVVGGAILLVTLSVFGFDFDTVGRRRAGDDARRGDAKRDDAGRD
DAGSDDAEEQRA
333990823YP_004523437.1 hypothetical protein JDM601_2183 [Mycobacterium sp. JDM601]MSRSFDDLVVEATAAPVDGWEFSWLDGRATEQRPSWGYQRQLARRLSGVS
AAVDLHTGGGEVLAGIEQFGTFPPTMAATESWPPNAKRATELLHPRGVVV
VAVPDRPPLPFGDEAFDLVSSRHSLETWWSEIARVLRPGGHYFAQQIGPA
TMLELSEFFLGPMPGKGAEYEPEAVRAGATAVGMEILDLRLERLRAEFFD
VGAVIYFLRKVIWTVPDFAVDDHRDRLREMHELIESQGPFVAHATRVLVE
ARKS
333990821YP_004523435.1 hypothetical protein JDM601_2181 [Mycobacterium sp. JDM601]MYKRRSHRSASLWPATDRAGRVAGCVFPAGVSRDSGRRRALR
333990819YP_004523433.1 hypothetical protein JDM601_2179 [Mycobacterium sp. JDM601]MAAPTSVRFDADVAARLARFVAARPGLRASAATNQLVDEALRCQEHPLVV
FRDGPAGRRARLIGGPDVWEVARALPRPLGT
333990817YP_004523431.1 hypothetical protein JDM601_2177 [Mycobacterium sp. JDM601]MARRSGVAATTLRYYEQIGLVAPPARIGGQRRYDEAMLARLEIIGLCKSA
GFALAEIQLLFGDDAPGRPASRALARAKLAEIDAQLESLARAREVIEWGM
RCTCPSIDACSCGVHPPPRPGAS
333990815YP_004523429.1 O-methyltransferase [Mycobacterium sp. JDM601]MPIAVTEFSQVEQTAFLTAYARALDHRAETPILGDAFSDRVIGLIDYDFA
GLRIPASVVRQTALRAKLLDDRVRRYTAANPAAVVVDLGAGLNEPLVRVQ
PPSGVDWYSIDLPRVVALRDKLLPAQPSEHVIAADLTAADWTAGIPAGRP
TMVIADGLFAFLTQAQVTAVLGQLIDHFGSGELAFNDYGRVGPLSSLSMK
LAPRGMFSLLRHVWANPGFTDPHTPERWEPRLRLVEQACLAHAAEVDSFP
PAARRMTRLAGRFKAVAGKARVLRYKF
333990813YP_004523427.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MTGTPPATTLCEAFQRTAATDPDGVALRTVGGGQTLTWREYAAQVRQVAA
GLAGLGVCRGDTVSLMMANRIEFYPLEVGAQHAGATSFSVYNTLPAEQLG
HQFGNAGTKVVICEQPYVETIRSSGAPVEHIVCIDGRPDGTLSLADLLAA
GRPDFDFESSWRAVQPDDVITLIYTSGTTGAPKGVEMTHTNLLFEAAALD
AVLGVRFGDRITSYLPSAHIADRAMGLYNQEIFGVQITVVPDVRAIGAAL
PDVRPTIWGAVPRVWEKLKAAIEFAVDAEPDGDRRAALQWALSVGAKRAA
ALIGGEPVPDAVAAEWSQADELVLSKLRAKLGFGELRWAVSGAAPIPRET
LGFFAGIGIPISEVWGMSELSCVASTTHPRDARLGTVGKLLPGLEGRIAD
DGEFLVRGPLVMRGYRKEPAKTAEAIDADGWLHTGDILEADAEGYLRVVD
RKKELIINAAGKNMSPANIENAILASCPMIGAMVTIGESRPYNTALLVFD
ADSVGPYAAAHGLPEATPAALAADPAVIAQIAAGVAAGNAKLSRVEQIKR
FRVLPTLWEPGGEEVTLTMKLKRGPIAAKYADEIEALYAPEPAPHIHHPA
GAEDARPATAV
333990811YP_004523425.1 hypothetical protein JDM601_2172 [Mycobacterium sp. JDM601]MPIAGVPWPAYKLIALAVGLATLLVVGAATASAAAAVLSAAGVCTALWLA
LGLKLG
333990809YP_004523423.1 threonine dehydratase [Mycobacterium sp. JDM601]MSAELRQNRGSNACPLNAADIDAAAKRIADVVAPTPLQLSDRLSAITGAT
VYLKREDLQSVRSYKLRGAYNLLVQLTADEIAAGVVCSSAGNHAQGFAYA
CRSLGIRGRVYVPAKTPKQKRDRIRYHGGEFIELIVGGATYDMAAEAALA
DVARTGATLVPPYDDLRTMAGQGTIAVELLNQLDTAPDLVVVPVGGGGCI
AGITSYLAERTAESAVLGIEPAGAASMMAALAAGELVTLDHVDQFVDGAA
VKRAGALPYAALAAAGDMVSVTTVDEGAVCTAMLDLYQNEGIIAEPAGAL
SVAGLLEADITPGATVVCLISGGNNDVSRYGEILERSLVHLGLKHYFLVD
FPQEPGALRRFLDEVLGPGDDVTLFEYVKRNNRETGEALVGIQLGSAADL
GGLLARMRASQIHVEPLEPGSPAYRFLL
333990807YP_004523421.1 hypothetical protein JDM601_2166 [Mycobacterium sp. JDM601]MIRWVGALGRDPRHEFWPESLSFADVTLTGVIGHRQVTRSSAAPAQDDQ
333990805YP_004523419.1 hypothetical protein JDM601_2165 [Mycobacterium sp. JDM601]MGTRKAGFYRHDLDGLRGIAIALVAVFHVWFGRVSGGVDVFLALSGFFFG
GKLLRVALNPSSSLSPVPDLIRLVRRLLPALVVVLAACAVLTIWIQPQTR
WETFADQSLASLGYYQNWELARTASDYLRAGEAVSPLQHIWSMSVQGQFY
LSFLLLIFGFAFAFRRLLRTHLRSAFVVLLTALTVASFWYAIAAHQANQA
LAYYNSFARAWELLLGALAGALIPYIRWPMWLRTTVATLALAAILSCGAL
IEGVQEFPGPWALVPVGATVAFILAGANRQAHPSTSDKLPWPNRWLASGP
LVRLGAMAYSLYLWHWPLLIFWLSYTGNRHASVLEGAVILLLSGVLAYLT
TRLVEDPLRYRGPAGAGAPPARRNPWRKPSPGWWKRPTLALGSTVVLLGV
ALTATSFTWREHVTVQRASGKELAKLSKDDYPGARALLKHQRVPKLRMRP
TILEAKKDLPRSTRDGCISTFSNPALINCTYGDPDASRTVALAGGSHAEH
WLPALDILGQRHHFKVVTYLKMGCPLSTEKVPLIMGNNAPYPQCYEWVGK
TMDKLIADHPDYVFTTATRPWNIKPGDVMPGTYIGIWKRLSENKIPILGV
RDTPWLVRDGKPFQPADCLASGGDAESCGIKRSEVLVDRNPTLDFVERFP
LLKPLDLSDAVCDTDICRAVEGNVLIYHDSHHLSATYMRTMTGELGRQMG
AATGWW
333990803YP_004523417.1 adenosylmethionine-8-amino-7-oxononanoate aminotransferase [MycobacMSALSPEQISAIDAAHLWHPYSTIGSETPAPTVAVAARGAYLTLIVDDAP
VEALDAMSSWWTAIHGHGHPTLDAALTAQLGTMNHVMFGGLTHEPAARLA
QLLVDITPAGLDTVFFSDSGSVSVEVAVKMALQYWRARGRPGKHRLMTWR
GGYHGDTFTPMSICDPDGGMHTLWTGTHSVLVRQLFAPQVPRDYDPAYVA
AFEAQLERHRDELAAVVVEPVVQGAGGMRFHDPRYLSDLREACSRHGVLL
IFDEIATGFGRTGELFAAEHAGVSPDIMCVGKALTGGYLSLAATLCSTEI
AHAISGGEAGALMHGPTFMANPLACAVSVASTELLLGQDWRSRVGEIGSG
LTAALQPARDLPGVADVRVCGAIGVIECERPVDLALATPAALAAGVWLRP
FRNLVYAMPPYICTPEEIARIGAAMLGVVRALT
333990801YP_004523415.1 dethiobiotin synthetase BioD [Mycobacterium sp. JDM601]MITGTGTGVGKTIATAALAGCARQAGLEVAVVKPVQTGTADGDDDLAEVG
RLSGVTDLFGTARYPEPLAPVAAAEQAGMALPTGAELLAAIRAADRPGRL
TLVEGAGGLLVELAADGVTLRDLAVDLGAAVLVVVNAELGTLNHTALTLE
SLAGQGLSCAGLVIGSWPGQPGPAAAGNRAALGRLAPVRAVLPEGCGRLD
ASQFSGMSRTAFDTGWVRSLVG
333990799YP_004523413.1 integrase catalytic subunit [Mycobacterium sp. JDM601]MGLTLAERKAVTETIAVRYILASKREKSRILDELCATTGWHRNHARKALK
SALQPKIVTARSPRPVKYGDDVIAALVLCWTVLGMPAGKRLAPMLGELVG
VLRHFRELTIDEGTAELLVSMSAATIDRCLAPERAKRRLRGRAGTKPGSL
LKSQIPVRTWAEWGDARPGFVEIDLVWHDGGIRGGGHAFTLTVTDIATGW
TENRSVPERTSKCVLAALNDIARAMPFPVLGVDSDNGSEFINDDLFRWCQ
RHKITFTRARPGNKNDGCHVEQKNWSVVRSMVGYHRYDTAAEVLLLNEIW
HLQSKLTNYFYPQQKLISKVRKGAKISKKHDKATTPFHRVIDHPTATVER
IVALTRAYSLINPAATQRQAQALTTRLFSLTTTKAGPAAEAQINKRARLR
EATNTPTRAS
333990797YP_004523411.1 biotin synthase BioB [Mycobacterium sp. JDM601]MTDDILALAREQVLERGEALGADQVLEVLRLPDDRLEELLALAHDVRMRW
CGPEIEVEGIISLKTGGCPEDCHFCSQSGLFSSPVRSAWLDIPSLVEAAK
QTAKTGATEFCIVAAVRGPDARLLAQVSAGIEAIRNEVDIQIACSLGMLT
QEQVDQLAAMGVHRYNHNLETARSHFPNVVTTHTWEERWETLRMIGKAGM
EVCCGGILGMGETLEQRAEFAAELAELDPDEVPLNFLNPRPGTPFGDLEV
LPAADALRAVAAFRLALPRTMLRFAGGREITLGDLGAKQGILGGINAIIV
GNYLTTLGRPAETDLELLDDLQMPIKALNATL
333990795YP_004523409.1 hypothetical protein JDM601_2154 [Mycobacterium sp. JDM601]MSIPGAPSGHAAPRLSRRRACLILAAGLGIAGLPVGALWGWIAPPVHGVV
ALTRGGERVQAYLGNEADHFFVAPFLLLGMLGVVAVVAATLAWQWRAHRG
PGMVAGLSVGLTASAALAMLVGGAVVRHRYGVIDVDGAPVSAENRVHYVV
EGPPVFFGHTPLQIAATLLLPAATAALVYGLCATWSTRDDLGGYPPEPAR
RLPPAPAVTVEGGAAPHR
333990793YP_004523407.1 hypothetical protein JDM601_2153 [Mycobacterium sp. JDM601]MLTAVFQVGNGGGQQGPRPRLNVLLWQRAREPQLGRWSLPGGLLRDDEDV
TTSARRLLAEKVDLREIAHLEQLAVFSDPGRVPGARTIASTFLGLVPSPA
DPELPGDTHWHPVDDLPPMAFDHAPMVAHAHSRLVAKMSYTNIGFGLAPT
EFIISTLRDIYSVVLGYQVDATNLQRVLVRRGVITRTGTTARSGRSGGRP
AARYRFTDSELRVTDEFAALRPPGWVGLES
333990791YP_004523405.1 l-aspartate oxidase NadB [Mycobacterium sp. JDM601]MSGGPGWQQRADVVVIGTGVGGLAAARAARRAGREVVVLSKAATGFAVTA
THYAQGGIAVVLPGTDDSVQAHVADTLAAGAGLCDRDAVTSIVADGYRAV
SELAGAGAQFDQDPDGNWALTREGGHSRRRIIHAGGDATGAEVQRALDHA
AAGLDIRHGQLVLQILRDADTVTGVLVANADGIGVIHAPSVVLATGGLGQ
LYRATTNPGGATGDGVALALRAGAAVSDLEFIQFHPTMLYSDAAGSRRPL
VTEAVRGEGAKLIDARGASVTAGVHPMGDLAPRDVVAGAIDARLRETGDA
CVYLDARGIAGFADRFPTVTAACRDAGIDPVAQPIPVVPGAHYSCGGVVT
DVTGRTELAGLFAAGEVARTGMHGANRLASNSLLEGLVVGERAGSAAAAH
AVASGPVQAVAAEPARQVAVERQTLQQAMSRDASVVRDADGLRRLAELLS
DAEERTAAHRKGCEDAALTLVARVVAEAALARTESRGCHHRAEYAGPDAG
QARSTTVRLRDGAVVLEEPVAL
333990789YP_004523403.1 hypothetical protein JDM601_2149 [Mycobacterium sp. JDM601]MAVDKSAGDASKLPVVFPPWLDRLQIKYMNPVVKPLSKFLPGMSVIKHRG
RKSGKPYETVVTTYRKGNVLAIALGHGKADWVKNVLAAGEADVRLFRSEL
HLTNPRILPAGTADASLPWAVRLQNRKVAVLVTDIA
333990787YP_004523401.1 histidinol dehydrogenase [Mycobacterium sp. JDM601]MVGVTTPLMSRIDLRGANLSAASLRAALPRGGVDVEAVLPQVRPIVEAVA
ERGSAAALEFGESFDGIRPAAVRVPEAALEAALAELDPAVRAALEVAISR
ARAVHADQRRTDTTTMLAPGATVSERWIPVERVGLYVPGGNAVYPSSVVM
NVVPAQTAGVDSLVIASPPQADLQGQFQGLPHPTILAAARLLGVAEVWAV
GGAQAVALLAYGGTDTDQAELVPVDMITGPGNIYVTAAKRLCRSQVGIDA
EAGPTEIAILADHTANPAHLAADLISQAEHDELAASVLVTTSPQQADATD
REVTAQLETTVHRQRVVTALTGRQSAIVLVDDLDAGIRVVNAYAAEHLEI
QTADAAAVAARIRSAGAIFVGPYAPVSLGDYCAGSNHVLPTAGSARHSSG
LSVQTFLRGVHVVDYTEAALKDVSGHVIALADAEDLPSHGEAVRRRFEQ
333990785YP_004523399.1 imidazole glycerol-phosphate dehydratase [Mycobacterium sp. JDM601]MTGSRRARITRTTRESDIVVELDLDGTGVVDIDTGVPFYDHMLTALGSHA
SFDLTVRAKGDIEIEAHHTVEDTAIVLGQALGQALGDKKGIRRFGDAFIP
MDETLAHAAVDVSGRPYCVHTGEPDHLVHTTIAGTQAPYHTVINRHVFET
LASNARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVTGVPST
KGAL
333990783YP_004523397.1 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomeMNNALVLLPAVDVVDGRAVRLVQGKAGSETEYGSALDAALGWQRDGAEWI
HLVDLDAAFGRGSNRELLADVVGRLDVKVELSGGIRDDESLTAALATGCA
RVNLGTAALENPQWCARAIAEHGEKVAVGLDVQIEPGHPDGAHRLRGRGW
ETDGGDLWPVLERLDREGCSRYVVTDVTKDGTLGGPNLELLGEVAARTDA
PVIASGGVSSLDDLRAIATLVDRGVEGAIVGKALYAGRFTLPEALAAVRG
333990781YP_004523395.1 cyclase [Mycobacterium sp. JDM601]MHKHSDVAVRVIPCLDVDDGRVVKGVNFANLRDAGDPVELAAAYDAEGAD
ELTFLDVTASSSGRATMLEVVARTADQVFIPLTVGGGVRTVADVDVLLRA
GADKVSVNTAAIARPELLAELARHFGSQCIVLSVDARTVPAGSAPTPSGW
EVTTHGGRRGTGIDAVEWAVRGVELGIGEILLNSMDADGTKAGFDLPMLR
AVRAAVSVPVIASGGAGAAEHFAPAVAAGADAVLAASVFHFRELTIGQVK
AAMAAEGIVVR
333990779YP_004523393.1 M protein [Mycobacterium sp. JDM601]MNSDEPDDWYRLEHQQRPRGLELERLSAQIDAHYAKGTVSDIEAHMPRDG
SRIVALTNQLSESQANLESTSARFNELASEIPGDIVGLSERLSGILNGAV
AEADDIRAEAQRFADEVRSAAENEAAAILQDAEAQRREAAELRAELETQH
KQLRTQAAQLRRQAVMSAAEIMREAENHASAILTEMNQAINSHVADAQQR
LAELIDARAKIVNQIERTTFQVNRRPEVNDANPVNDAVPVSRESTPPPRE
SWFRENRPH
333990777YP_004523391.1 hypothetical protein JDM601_2137 [Mycobacterium sp. JDM601]MALEIPEFETQMRGFDRNEVADYIARLHREIDILQDRNKSLEAAKSQTRF
DREQLSAEVTRLQNDIVRLTAEAESERQRLTGELSQLQSQFEQVTGPVNS
VEGMSDRIARMMRIASEEARRTKELAQQDAESLTGQLREQLEAASHDRAA
ASEALAEFQASTNARRAKILDAATQEAEEILRIAHEERSRIAQEIEEAER
SRREVYQRLAEEDERNRRAAQESLDQQIKLAWEEDERNRREAQHRLDQKM
QAAWEQAEANIAKLDKEARLEASTLIATTKREAKLLTERTQSEVDLLVRE
RSGIVTHLTEIRNWIDTAVGDNLRAPEDVPPAASDEAPEAEQADDNDTAD
DNDTATDE
333990775YP_004523389.1 anthranilate synthase component I TrpE [Mycobacterium sp. JDM601]MHTPSSAGVTSRADFRALAAEHRVVPVLRKVLADAETPLSAYRKLAANRP
GTFLLESAENGRSWSRWSFIGAGTSSALTVRDGEAVWLGPVPQDAPTGGD
PLQALRETLALLETAAIPGLPPLSSGLVGFFAYDMVRRLERLPELAVDDL
QLPDMLLLLATDMAAVDHHEGTITLIANAVNWNGTDERVDEAYDDAIARL
DVMTAALSQPLESSVATFDRPEPVYRRQRTPEEYGTIVERLVGEIEAGEA
FQVVPSQRFEMDTDVDPIDVYRMLRVSNPSPYMYLLQVPDDVGGVAFSIV
GSSPEALVTVQDGRATTHPIAGTRWRGATEEEDQLLGKDLLNDEKERAEH
LMLVDLGRNDLGRVCVPGTVRVSDYSHIERYSHVMHLVSTVTGLLAQDRT
ALDAVTACFPAGTLSGAPKVRAMELIEEVEKTRRGLYGGVVGYLDFAGNA
DFAIAIRTALLAGGTAYVQAGGGVVADSNGPYEYTEASNKARAVLAAIAA
AETLTVPGSDD
333990773YP_004523387.1 indole-3-glycerol phosphate synthase [Mycobacterium sp. JDM601]MSSATVLDSIIEGVCADVAAREAVVSLAEVKAAAEAMPAPRDVMAALREP
GIAVIAEVKRASPSKGQLAPIADPAELACAYAEGGARAISVLTEERRFNG
SLADLDAVRAAVSVPVLRKDFIVRPYQIHEARAHGADMLLLIVAALEQQA
LVSMLDRTESLGMTALVEVHTEEEADRALTAGAKVIGVNARDLHTLEVDR
DCFARIAPGLPTEVVKIAESGVRGTADLLAYAGAGADAVLVGEGLVTSGD
PRAAVADLVSAGKHPSCPKPAR
333990771YP_004523385.1 tryptophan synthase subunit alpha [Mycobacterium sp. JDM601]MTGHTGDRLAPMFAACRAEGRAALIGYLPTGYPDVPGSVAAMTTLVESGC
DLVEVGVPYSDPGMDGPTIARATEVALQGGVRVRDTLTAVEAIAGAGGRA
VVMTYWNLVLRYGVDAFARDLASAGGLGLITPDLIVDEADDWLAASEQHG
LDRIFLVAPSSTPQRLAETAHASSGFVYAASTMGVTGVRDTVSNAAPELV
RRVREVSDIPVGVGLGVRSGAQAAEIGTYTDGVIVGSALVTALADGLGAL
RSLTEELASGVRQRIPQP
333990769YP_004523383.1 hypothetical protein JDM601_2129 [Mycobacterium sp. JDM601]MLQDMTDPSWPPAGPPDGWQHHPHQPGYPPPYPGYPDALAPHGRHPVTGQ
PYSDKSKVIAALLQLLGLFGFLGFGRIYLGQTALGIAQFLGCLLFTAATW
GIGAAVPIIWGIVDAILMLAGRVSDKQGRPLRDGT
333990767YP_004523381.1 acyl-CoA thioesterase [Mycobacterium sp. JDM601]MPAEPNTDFQELLAVLDLEATEPDVFTGSHPSKTPLRTFGGQLMAQSFVA
ASRTVSEHLPPGALSVHFINGGDPGRDIEFRVHRLRDERRFANRRVDALQ
GDTLIATAMVSYLSGGRGLEHGAEAPAVADPETLPRVRKLLEGYEEVVPG
FVNAPHPIDWRYANDPAWVMRDKGGQLAHNRVWMKADGVLPEDPVLHTAL
MVYSSDTTVLDSIITTHGLSWGFDRIFAASANHTLWFHRPVRFDDWVLYA
TSSPVAADSRGLGAGHFFDRSGQVIATVTQEGVLMYFPNAKR
333990765YP_004523379.1 hypothetical protein JDM601_2125 [Mycobacterium sp. JDM601]METTAVPKLLPHLWKSTLVSGVLALVLGVLILARPGNSILVAAILFGVYL
LITGVAQTIFAFSLPVMSVGGRVLLFISGAASLILAVLCFRHFNSDEEAL
AVLLLAIWIAVGFIFRGVATAVAGISDPELPGRGWQIFMGVLSLLAGLVT
LAAPFTSLWILALVVGSWLIVIGIAEIITAISIRRAARNVATALSGP
333990763YP_004523377.1 membrane-anchored adenylyl cyclase Cya [Mycobacterium sp. JDM601]MTVKRFLAVSAESQPSDRHWRCMPARTRHYAARLSQRLRILKVSAGLAAI
ISAGFGLLEIWADPAYWWIGALNLIAAAAFVLTPLLYHYGELIAPLAFVG
IAYLTTFVICWVVGTGSGVQFYFLASASISVLILGVDRIKLAAVVAGIGA
ALTIALQLLVPTYKLDQPAWLRDLSFALVVVSACFIVIATIWYALREIGH
AEAAMEAEYDRSEALLANILPTAVADRLKNPAVDVIADSYPDASVLFADI
ADFTRRASQTDPGQLVEFLNEIYTGLDRLVDRHGLEKIKTSGDSYMVVSG
VPDPRPDHLHALAQLALDIAGTIAELRDPLGRPVSLRIGLAAGPVVAGVV
GNRRFFYDVWGDAVNLASRMESTGVPNRIQVPQDVYERLTSEFVFEERGD
VDVKGKGVMHTWFLVGARPPASRGPASRSLSVPAR
333990761YP_004523375.1 two-component system transcriptional regulator [Mycobacterium sp. JMTASTSEGAPRPARRVLIAEDEALIRLDLAEMLREQGYEVVGEAGDGQEA
VELAELLRPDLVIIDVKMPRRDGIDAASEIAGKRIAPIVMLTAFSQRDLV
ERARDAGAMAYLVKPFSAGDLVPAIELAVSRSEEITALEREVSSLSEQLE
TRKLIERAKGLLQSKQGLSEPDAFRWIQRAAMDKRTTMRQVAEVVLETLD
TAANPPT
333990759YP_004523373.1 hypothetical protein JDM601_2119 [Mycobacterium sp. JDM601]MATAKVERLLNLVIALLSTRGYLTAEMIRATVIGYGDSPSDEAFSRMFER
DKNELRDLGIPLETGKASVFDTVDGYRINPDAYALPAIELTTEEAAAVAV
AVQLWQSPQLRANAQGAVAKLHAAGVEVDPARADVLVAPPAALPGIHRAE
PALGALMDAVQAGQAVQFGHRPSPVDPYVTRTVEPWGVVTHGGRWYLVGH
DRDRDAVRTFRMSRIADEVTPIGSPGSVTRPDGVDLRAIVAEAVGEAPTG
LQARIWVADGRAVALRRAGAVLGRQALAGRDGDIVGVDIGTHDRLARDIA
GHGADAVVLDPPSLRDDVVARLTASARGVLA
333990757YP_004523371.1 hypothetical protein JDM601_2117 [Mycobacterium sp. JDM601]MTAFSAGMLIADVVFLAVVIGVVVGIVFLVKAKSKPAGQSAVPPAWYPDP
ADPELLRYFDGQSWTGATRPRRAPPGS
333990755YP_004523369.1 sec-independent protein translocase transmembrane protein TatC [MycMSLVDHLRELRTRLLISLAAIVVTTIIGFVWYGRPLFGLESLGEWLRHPY
CELPASSRAAIAPDGQCRLLATAPFDQFMLRLKVGLAAGVVLACPVWFYQ
LWAFITPGLYRKERRFAVVFVVSAAVLFVTGAILAYLVLSKALGFLLTVG
SDVQVTALSGDRYFGFLLNLLVVFGISFEFPLLIVMLNQVGVLSYARLKE
WRRGLIFAMFVFAAFFTPGSDPFSMIVLGCTLSLLQEFAIQIARLHDKRK
ARREATTQLPDDAASPLEAPAPVTTPHE
333990753YP_004523367.1 hypothetical protein JDM601_2113 [Mycobacterium sp. JDM601]MSGPQGYDPTQPWQPQQPGQPEEQPGSGQGPAAGAEQQWQPPAYTPSQYP
QSYPSAPQYPGYPQPEQYGQPGGYGQPTQYGQPGGYGQPTQYGQPGQYGQ
PGQYGQPGQYGQYPQQPGQFGQPGSGGKRPTALVGTVLAACLGIAALVVL
VLGFWKPGFFVTTKLDIDKAQQGVQQILADQTNGYGAKNVKDVRCNNGQS
PVVKQGDTFNCEVSIDGTKRQVTVTFQDNSGTYEVGRPK
333990751YP_004523365.1 dipeptidase PepE [Mycobacterium sp. JDM601]MCVTSRFDSSVYAHRLAAAAAATAEAGLAGLVITPGYDLRYLTGSRAQTF
ERLTALVLPASDPPTMVVPRLELAALRESAVADLGVAVRDWVDGEDPYRM
VGEALGGRPATAAVTDAMSALHLLPLIDVLGATPVLATDVLRQLRMIKDP
SEIDALRKAGAAIDRVHARVPEFLVPGRTEADVAADIAEAIVAEGHSEVA
FIIVGSGPHGADPHHECSQRELAAGDIVVVDIGGPVEPGYHSDSTRTYSL
GEPEPEVAQRYSVLQRAQRAAFDSVRPGVTAQQVDAAARDVLAEAGLAEY
FVHRTGHGIGLSVHEEPYIVAGNDLALAAGMAFSIEPGIYFPGEWGARIE
DIVIVTADGAESLNNRPHELAVVEV
333990749YP_004523363.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MNDTVDGPVVVFGGRSEIGGELARRLAPGATVVLAARSADRLDAEAAAVR
NAGAVAVHTVEFDADDLASHGPLVARLIAEHGPIGTAVVAFGMLGDQVRA
EADAAHAVAIVHTDYVAQVSLLTHLATAMRAAGRGRMVVFSSVAGVRVRR
ANYVYGSAKAGLDGFAGGLADALHGSGVGLLIVRPGFVIGRMTDGMKPAP
LASTPAQVAAATARALARGRRTVAVPRRLRMMFVVMRLVPQTLWRRMPR
333990747YP_004523361.1 hypothetical protein JDM601_2107 [Mycobacterium sp. JDM601]MAPTFAEIAKSDYLLLTTFTKDGRAKPTPVWAAPDGDRLLVITQESSWKV
KRIRNSPRVTLAPCDMRGRPKGEAIEAVAAVLDKAHNGAVYAAIAKRYPI
IGRVFNVFSKLRGGMRTNVGLALTPAAG
333990745YP_004523359.1 hypothetical protein JDM601_2105 [Mycobacterium sp. JDM601]MTTIDVATPDGPIEALLDIPEGPGPWPGVVVVHDAIGYAADMKAISERIA
DAGYLAVSPNLYSRGGRARCITRVFRELLTQRGRALDDILAARDHLLGMP
ECSGKVGIAGFCMGGQFSLVLSPKGFGASAPFYGTPLPRHLEETLSGACP
IVASFGGRDPLGRGAPDRLRRVVEHHDIPHDVKTYPGAGHSFANNLPAQP
LLRIAGFGYNEAATADAWARVFAFFGEHLQAAG
333990743YP_004523357.1 hypothetical protein JDM601_2103 [Mycobacterium sp. JDM601]MTVVPGAPTSLLLGGRIHSPSHPDATAMAVRDGVVAWLGSDAVGREQFPQ
ADVTDLDGALVTPGFVDSHVHVTETGLCRTGLDLRPASSQRHCLQLIADY
AAAHPDQPIWGHGWDESGWPDGAAPDTEALDAVVGERPAYLSRVDAHSAL
ASSGLRKRVPKLSADSGIGPLSGSDHHLVRAAARELLTAPQRAAARTAAL
DAAAAVGIVAVHECAGPDVGGSDDWRELRALHHGVEVIGYWGEPVTSAAR
ARELLADTGARGLAGDLFVDGALGSHTAWLHEPYADAAGCTGVCHLDAES
VAAHLWACTEAGVTAGFHVIGDAAVSAVTTALQQVVQHFGVAAVAACGHR
LEHLEMVSVEQAAQLGSWGVIASMQPGFDALWGGDDGMYAQRLGAQRAAG
LNPFALLASRGVPLAFGSDSPVTELDPWAAVRAAAHHRTPGSAVSMRAAF
AAATRGGWRAAGINDGISGTLVPGAPASYAVWEPTRLAVEAPRDTVQRWS
TDPRSRVPALPVLEPGDSPLCRRTVHRGVVLHG
333990741YP_004523355.1 polyprenol-monophosphomannose synthase Ppm1B [Mycobacterium sp. JDMMSDRPSLHTLVVVPTYNELENLPIILGRLQQARPDGHVLVVDDGSPDGTG
KLADELAAADPERIHVMHRTAKAGLGAAYLAGFAWGLARHYEVIVEMDAD
GSHAPEQLYRLLEAIDAGADVAIGSRYVDGGAVRNWPVRRLVLSKTANTY
ARLLLGVGIHDITAGYRAYRRGVLEKIGLDAVDSKGYCFQVDLTWRAVNN
GFTIAEVPITFTERELGVSKMSGSNIREAMVKVARWGIGGRINRLRGRRG
333990739YP_004523353.1 hypothetical protein JDM601_2099 [Mycobacterium sp. JDM601]MLAPDSVVLSAEEATALSDRVYQVRCAAEDIATALAEDAPHDELRQLCEA
LLQAVESADRWR
333990737YP_004523351.1 hypothetical protein JDM601_2097 [Mycobacterium sp. JDM601]MPYPRPRLSRLGRPKAEWAHRRPGIRNGTPPAHPVAGETLHDTGGDAGLH
RVVMHEPNVSEPAGG
333990735YP_004523349.1 RDD domain-containing protein [Mycobacterium sp. JDM601]MASGDFGPNGPGYGQPGPYPPPQGWGQQPTWGHKPGGLGRRFWARLIDGV
LVSIVAFALSLFVFADDYPFLVTGLFSGVLTYGYFVLFEVTQGSSPAKRL
LGLAVRGPDGASKPTLGQSAVRNAFTLLAVLPYLGPLLAFVAYLVIAVTI
SGSATKQGKHDELAGGTRVIRT
333990733YP_004523347.1 hypothetical protein JDM601_2093 [Mycobacterium sp. JDM601]MTDSIAQDLLATVEQSPVAAAAHDRTGWVGLFSADGQVEDPVGSRPHVGA
EQIGRFYDTFIGPRGITFRRDLDIVRGTTVVRDLELEVAMGPSVIMHIPA
ILRYDLTEDDLTANDLTEAGRRWRLRRLRAYWELPAMMRRFLGNGVAATP
AAVQLSRSLLRNQRLAGTAGFTAGFRRPAGRGKRPVRAFLAAVSSGELST
VTAALSPAVTMTYGDDTAIDLAELATRLVGARPTKLLAAGRTVAVSLTAA
QQRGVLFADVDRGGRAITTIRYFAED
333990731YP_004523345.1 hypothetical protein JDM601_2091 [Mycobacterium sp. JDM601]MSVSTLYLATITVTAVITIAIAVADFIPAPFVLANSAQVGVPRSWLPMLG
GLKLAGGAGLLIGLAGVPLIGPAAAAGLVAFFIGAVVTHLRAGVWHNIGF
PAVYLVLSTASLVMLLA
333990729YP_004523343.1 hypothetical protein JDM601_2089 [Mycobacterium sp. JDM601]MAVKARGIAMTGPWGRVFGPLDLDVQAGGVSLLIGPPGSGRTALLMNLAG
RMKPSAGSVTVFGHSKARDIFGVAALAGVEHLDAIFESVTVRDLITEQIR
WNAAWYRLVRRAGDAERDAVCGPVFGELPLPRLDDYVEQLDELTGLLLRI
ALANTARPPLLVVGSIDQVTSDRDRQVLVGRLVELGEHQTVITASANELP
EGSGVAAQIHVEHLEPAEVTGHGRHEKRDS
333990727YP_004523341.1 sugar-binding lipoprotein [Mycobacterium sp. JDM601]MLRGAAALGLAAAAPWPSACGADDDALRFFFAANPEEADARMRIVDAFQH
RHPDIRVRTVLAGGDPTQQISTFCAGGRCPDVLMAWEFNYAELAGRGVLA
DLNALLDADREFAAALRADSIPALYETFGFNGGQYAFPEQWSGAFLFYNT
AIFAEAGVPPPPGRWDEPWSFGEFLDTATALTRRDTNGRIIRWGFVDTWS
PPYSAALFGMNNGTPWAVPRFNPTHLNYDDDAFLAGIQFYADLANVHRVA
PAASDTQAMSTMGLFTAGKAAMALGGHWRYQTFAQAEDLDFDVAVLPTGP
AAAAKGLAARSAIGSTGLAIAAASRHRRQAWEFVKFAAGPVGQSLIGESG
LFVPVLRSAIAAPGFTAAHRGITNLAVLTGGPAHSEGLPISPDWQRVHAL
MDRAIGPVLRGKRPAATLKTGLSPQIDELLAS
333990725YP_004523339.1 sugar ABC transporter [Mycobacterium sp. JDM601]MTGRPVRHRITGLLAVYAGLAGVAACALFPILWALSGSLKRQAEISLPML
LPAHPQWSNYLEVFARMPFWRMFFNTVLYAGCVTVGQVFFCSLAGYAFAR
LPFTGRDTLFVLYLATLMVPLTVTVIPQFILMRVFGWTDTVWAMIIPGLF
GSAFGTYLMRQFFATLPVDLEEAAILDGCSPWGVYWRILLPHAKPAVMVL
AVLTWINVWNDFLWPLLMIQREEIATLTLGLVWMQGEYVAEWPVLMAASM
LMLAPLILIYAVAQRAFVSGIAATGFGGR
333990723YP_004523337.1 hypothetical protein JDM601_2083 [Mycobacterium sp. JDM601]MRTLNPGYFALVMASGMVSMAMYHQDAYWLSVPLLWVTVLSYLVLVAVSA
VRLIAFRHEFRADLSDSGRAFGLFTFVSATNVLGARLVIDGHTGVAVGLL
SVSTLAWLVLGYLIPWTAVLGSSERPVVRRANGTWFIWVVASQSVAVLAA
VLEVEIDEPWRQSLALLAVVSWSIGVFLYGAAGIFVALRLLLYPLLPRDL
IPQYWVAMGAASITVLAGARIVEMAEAPMVTATRGLIAGTSVLFWAFGTW
LIPPLIAAGVWRHVVHRISLRYEAPWWSVIFPLGMYGVGSHYLGQADHLP
IVYYIGSVQSWIALAAWAITFVLMLHHLAVTLVPEAPKWAR
333990721YP_004523335.1 ubiquinone/menaquinone biosynthesis methyltransferase [MycobacteriuMNVSRLWQNRIFAATVGAAYARAIERPAAARVFGRLLFGTDVDRIYQAMD
VVAELPDGSAVLDVPCGGGITIARLAPGKRVRYVAMDISAGMLDHARRRL
RPEQRDTVEFVEASIEAIPFADDEFDLCVSFNGLHCLPDPAAAIREIARC
LKPGGRLVGDFATRGQVPRADAYMVLMRASGTFGPGGTLADARRWFTEAG
LTVDELECSGAITHFAVHK
333990719YP_004523333.1 hypothetical protein JDM601_2078 [Mycobacterium sp. JDM601]MVAVDDSPGGLQLVAAPADYLRQGSPEGVAAASRMRMVSRFLPAGVASER
GLQVKTILAARSISDAFPQIHQIGGVRADALRWHPNGLALDVMIPNPGSA
DGIALGDAIVAYVMENADRFGLQDAIWRGMYYTPGGGAQRGGYGHYDHVH
VTTTGGGYPSGSEVYLR
333990717YP_004523331.1 hypothetical protein JDM601_2077 [Mycobacterium sp. JDM601]MRRVVQFSTGNVGRHSLWAIIGRPDLELVGVHASSPDKIGRDAAELCGRR
EPTGVLATDDIDALLALGADCVVYTAQAETRPLDAIEQMARFLSAGSNVV
ASSMVWMVTPHLADDWLREPLAQACKAGNSSLYVNGVDPGYSGDTEALAA
MSLATRITSVTVQEIFDYGNYDDFEFTGRTMGFGLPRGSDVMPALFLPGV
ITSMWGGPVRNLAHHLGIELDEVRQRADAWYATDRIECAMTTVEPGQMAA
ARFAVEGVINGAPVITMEHITRLTPASAPDWEYPPDGQIGVHRVVVEGEP
RVELNTQLSHPDYDSTDAGCISTAARIVNVIDWVCDAPAGLIAVEDIPPV
AMVKGLIW
333990715YP_004523329.1 HrpA-like helicase [Mycobacterium sp. JDM601]MRSRLDGLTIRDAAHFARRLKQLRDGQSQQLRQLAEQLTAAEAVLAARRA
AVPAISYPDLPVSDRRDEIAAAIRAHQVVVVAGATGSGKTTQLPKICLEL
GRGIRGMIGHTQPRRLAARTVAQRIADELDTPLGDAVGYSVRFTDRVSDR
TCVKLMTDGILLAEIQRDRRLLRYDTVILDEAHERSLNIDFLLGYLRQLL
PRRPDLKLIITSATIEPQRFAAHFGGGTPIIEVSGRTYPVEIRYRPLEVA
VTTSADDDPDDPDREIVRTEMRDEIEAIIDAIGELTAEPPGDILVFLSGE
REIRDTADALQGLRPGGHPLEVLPLYARLPTAEQQKVFARRPASNITRRV
VLATNVAETSLTVPGIRYVIDPGNARISRYSRRLKVQRLPIEPISQASAA
QRSGRCGRTAPGVCIRLYSQADFEARPAYTDPEVLRTNLAAVLLQMAALR
LGEVADFPFLDPPDARSIRDGVALLVELGAFDANGQITDLGRRLARLPVD
PRLGRMILAAGAEGCVRELLVVAAALTIPDPRERPTDRQEAARANHARFA
DDESDFMSYLNLWRYLSEQRKALSASAFRRMCRNEFLHYLRIREWQDLVG
QLRSVARDLGLDESGVDVDEPAGRARVHAALLAGLLSHVGMRRVDGRDYL
GARNSRFVLAPGSVLAKRPPRWVVVAELVETSRLYGRTAARIQPDVIERV
AGELVQRSYSEPHWDAQRGEVLAYERVTLYGLPLVARRRVGYSRVDPTLA
RELFIRHALVEDDWQSRHGFVADNARLRAELDELQDRARRRDLIVDDDEI
YAFYDARIPADVVSARHFDGWWKKQRRQTPDLLTLSRDDLLRADGAVVAG
RPDSWQTGDASLPLSYRFEPDAVDDGVTVHVPIDVLARLGGDAFTWQVPA
LREELVTALIRSLPKELRRNFVPAPDTARAVLPALDPDGGSLLAALQREL
RRRTGVLVPIESFDLSRLPAHLRVTFSVEATDGSELARGEDLGALQERFA
ASARDAVAGVVAGELQRSGLRDWPADLEDLPRVVEHVVSGRVVRGYPAYV
DTGTATDLRVFATAGEQATAMTAGIRRLLRCCVPSPVKAIERQLDPGTRL
ALKANPDGSLTALLDDCADAAVESLMDGPVWTREAFSTLRAAVGTALPAT
TQDIVVRVEKLLAAARDVDLLVPAQPLAAHRDAVADIRDQLHRLLAPGFV
ATAGRARLTDITRYLAAIRRRLDQLPHASTADRQRMDQVHAVQDAYGELL
AELPPARRTAADVRDIGWQIEELRVSLWAQQLGTPRPVSQQRIYRAIDAA
GGSD
333990713YP_004523327.1 hypothetical protein JDM601_2073 [Mycobacterium sp. JDM601]MLTPFDDYPVHQAPVALAHAGNGNPDHYDRFWFNGYTNDFYFAVALGIYP
NRGVIDAALSVVSDGVQRSVFASGRAPLDRTQTAIGPIRIEIVEPMRINR
VVVDAPEYGLGADMTFTARTAGYEEPRQTRYVGARLAIDMTRASQLGRWA
GSLTVDGATNDFDNQTVYGTKDRSWGLRPVGLPASAAPEPSAGQIFFLWA
PLNFDDIALHYLTFEDQTGASWAQSGAVLPILRPGDPVYGPQDGVEHVDV
SHTIDWAPGLRRSRGARLDFRRGDAAESVELQPLLTFRMKGAGYFHPRWS
HGLWHEELAVGGEQTPVSELDNLALDNIHVQQVMRARWGDRTGIGVLEQL
VIGPHAPSGFTGLVDVPAVG
333990711YP_004523325.1 hypothetical protein JDM601_2071 [Mycobacterium sp. JDM601]MPTITAVCGDITEQRVDAVVNPANSAMRGGGGADGAIHRAGGAAILRDCI
KRFPNGLATGDAGWTTAGDLPARWVIHTVGPNFNAGQTDRSLLESCYRRA
LEVADELGARVVAFPLISAGAYGWPQRDAIAAAIETIAAVHTRVDEVRLV
AFDAGMHEHVLAQLAL
333990709YP_004523323.1 isochorismatase [Mycobacterium sp. JDM601]MSAPRRALVVVDAQQEYFDGLLPIQYPPREESISRIGELIDAAKASDIPV
VVVKHEFPAGAPVFAAGSPTCENHPIVAKYEADADNRITKVISDATGAVD
IANDAGSASAQQVHETLMALLHSNWAAVTGTSRWKSAIATGHALDRSDLG
SSAATGRAAHQAG
333990707YP_004523321.1 hypothetical protein JDM601_2066 [Mycobacterium sp. JDM601]MPHREPSQRRQPRAVLAGIGRRGRTTIALQQCRRGTREVPIAVGHHTSIK
RNYRYRYATRSTTSSIHALFSGARATQRGIDH
333990705YP_004523319.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MSSRLEFGHDDGNDDDNIDPRRIRSRNRLLDAAAALLTSGGIEAVTIDAV
TKASKVARTTLYRHFNNSSQLLAATFERLLPQVTPPAPASGTLRERLIEL
LTRQAALFADAPLHVTALAWLALGPTATTDHTSGEHAPRALRARVIDQYR
QPFDAILQSTEARAELGDFDVELVLCQLIGPFAFARMTGLRTMTAHDCTR
IVDDFLTAHRHNDSEPATTQVGDNFTAGQAPNSASGQTRTDTRAGRGRRA
PTSRPNEGD
333990703YP_004523317.1 ATP/GTP-binding protein [Mycobacterium sp. JDM601]MAAVNTIAPVSQLEDRRQPTTTLEGWRRFVDADPPEFILLPDAQWSALSE
AERTNYNEARVAHHSELVVVTTSAIQRITNEGRLLTLLNQREIGARRGLI
ISGAAATGKTTAVKQLGRFHELRIRTRFADKSRIPVVYATAPPKGSPRKL
AMEFARFLGLPMIQPRMNVTDISDAVCQVLIDARTDIVIVDEIHNLNLDT
RAGEELSDHLKYFTEHLPATFVYAGIDVERSGVFTGTRGRQLAGRCGVIN
TSSFPYAGEWKSLVAAMEGTLRLHRHNAGTLVAEAKYLHQRTGGMIGSLA
HLIRAAAIRSMLDETESVTRELMDTVLIDYAAQTSAQRSAS
333990701YP_004523315.1 hypothetical protein JDM601_2061 [Mycobacterium sp. JDM601]MYRPAVAAALEAVFDSARPLMAGVRSVGEAIMVLPVLFHLLWHGRLGVDL
CGAVLAEESIVGPALWR
333990699YP_004523313.1 hypothetical protein JDM601_2059 [Mycobacterium sp. JDM601]MDDMRILAISKMKDKLNEYVDAVAQTQDQITITKNGAPAAVLVGADEWES
LQETLYWLSQPGIKESIAEADADIDAGRTYGEDEIRAEFGAPRRAG
333990697YP_004523311.1 hypothetical protein JDM601_2057 [Mycobacterium sp. JDM601]MCATVAHARDVLADRRHFLLDDANWAEFSALLDRPVQYRPALAKMFDKPS
LFDPEA
333990695YP_004523309.1 isoflavone reductase [Mycobacterium sp. JDM601]MTVLLRSSDTPRHARLRDEFAARGVGIVEADIATVSAAELSTVLRRFHTV
VSCIGFAAGVGTQRKITEAALAARVSRYLPWQFGVDYDAIGRGSPHDLFD
EQLDVRDMLRAQSTTEWVIVSTGMFTSFLFEPGFGVVDLPANTVNALGSW
DTEVTVTTPEDIGVLTAEIVQTRPRIANQVIYVAGDTITYRELAEIVGRT
RGAQVIRNEWTVAHLLHDLDRNPDDGLRKYRAVFAQGKGVAWPKAGTFNV
TRGIPTTTTEEWARKHLSAKH
333990693YP_004523307.1 hypothetical protein JDM601_2053 [Mycobacterium sp. JDM601]MRVRRSDSERLHSLAKDRQAAVVDVVHAAIDALERQEFLRGLNEDYQRLR
KDPDLWEQYLGERHEWDALA
333990691YP_004523305.1 hypothetical protein JDM601_2051 [Mycobacterium sp. JDM601]MVFQQFQGGAIVAKNGEAGTPAYIAEGKIRDAWNVERDQDGVPAVPGNNG
SAGPLGIPTSDQTTVGDQLVSTFEHGKIAYDTKTGQVEVTVNGKAVPSGL
333990689YP_004523303.1 hypothetical protein JDM601_2049 [Mycobacterium sp. JDM601]MRAAGEQVLTDTAELSRIEQADGLRALLRSFANQLGRFEVDRDKPELVPF
NGWRQKFLMDNPDFRYWVADIRADGRYRIRGNRGDAAYVSITVYAGAGGT
DAQASARIDSDALTFDEAGGYQVSLGGQRPTTGDWLDLPAGATVVWVRHF
HNDVHHDAIGWCAIDPAAQPAIPVPIDLERFSRQLIRFATATTYLPQIWA
AATAADLAQPNQMRHWEEMTGGAVYTEPGIHYVRGGWQLAPGEALLIEGE
TVDCRYWNILVYSRFLNSLDHRHRRVSYTGATATVVGDRYRFVLAAEDPG
ASDADWIDTEGRPEGIVVIRFLQPVRTPRLPTVTRVRRSDIRAQR
333990687YP_004523301.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MGKLEGKVAVITGGTSGMALAGAKLFVDEGAQVFISGRRKDALDEAAELI
GRNVTGVPGDSADLDDLDRLFDTVKREKGAIDVLWASAGMGEQATLGEIT
EEQFDATFGLNARGTLFTVQKALPLFNDGGSIFMTGSNASLRGYPNWSVY
AASKAALSAYARVWVSELRDRRIRVNVLIPGQVSSPMLAKVMDEEMKAQF
ESVIPRREMGKPEEIASAALFLASDDSSYVNGMELVVDGGTTVI
333990685YP_004523299.1 reductase [Mycobacterium sp. JDM601]MNSISIIGSGNMASAIGTLAVKGGNAVEIIGRDAAKAAALAGTLGNGATA
GTWGATPTGDIVILAVLFDSAVPIASQFGDALAARPSSTSPTPSTPARPD
WLSPTTPPSRQ
333990683YP_004523297.1 hypothetical protein JDM601_2043 [Mycobacterium sp. JDM601]MTTFAPHRETLEYFVDCIHGGADKDTLANLLAEEVVIYSPFGGEPVTGRE
VAVETIKTVNGLASDDSYLEVLSGETHHAAHFRLQVGDAAVNGIFFVLPD
ADGKIAEVSIFYRTLPDGVALQRNLADAIGMQPWELRTTGE
333990681YP_004523295.1 reductase [Mycobacterium sp. JDM601]MNSISIIGLGNMAGALAGRALAGGNEVEIIGRDPVQTKELAAALGATAGT
AGTAPAGDIVILAVPYASAAAVVSEYGDALRGKVVVDITNPVTPDLTGFV
TPEGSSGAQEIAEAAPAGAHVVKGFNTLFANVVADSPAQGRPADVFIAGD
DASAKARVSDFIESLGLRPLDAGPLSMARALENVGLLELSLLNHSIKHTD
FFVGANVLS
333990679YP_004523293.1 hypothetical protein JDM601_2039 [Mycobacterium sp. JDM601]MSSTAPAGSTKLGPCQRIDVLFDELAELAGQRNAIDGRIVEIVAEIERDQ
LWGATGARSIPALVAWKTGVSPSNAHTISTVAHRLDEFPRCAQGMREGRV
SLDQIGVIAQRGGDGSDEHYAELAGMATVSQLRTAVKLEPRPQPDPRPEP
ARSITKTSDEHGSCWRIKLDHHDAAKFDAALQSHLDALITAWKHDHDNDD
RASGQQLPLPTTADAFMRLIETGWDSEAARRPHGQHTTVVVHLDVEHKAA
ALHLGPVLSEAERRYLLCDATFEAWFERNCEPIGAGRTTRGISRRLRRAL
EHRDRTCVVPGCGATRGLHAHHIVHWENGGETELSNLVLVCPYHHRQHHR
GIITIAGPPEHLVVTDSGGTELHSGSLARPPSGPPPEVAPYPGPTGERAD
WWWYQPYQPQAPPTVN
333990677YP_004523291.1 GntR family transcriptional regulator [Mycobacterium sp. JDM601]MALRQVTRRSVPEHVFEQIMSEVLSGEMAPGEVLPNERRLAEVLGVSRPA
VREALTRLNAAGLIEVRHGDATTVRDYRRHAGLDLLPRLLVRGEELDLEV
VRSILEARLHNGPKVAELAAQRSGPQAAAVLNGAVDALVAEADPVQRQRA
ALTFWDHVVDAADSIVFRLMFNTLRVTYEPALEALATVMAVEVSHPQPYQ
RVAQAIAAGDPAGARRAAVELLAPATDALLTALSGLDQQQ
333990675YP_004523289.1 peroxidase BpoC [Mycobacterium sp. JDM601]MLKYEVHGTGAPLVLVHGITHRRQAWYPVLEHLTDHRTVVLFDLPGHGES
HDLVVRDGDVQGTLRTELVAMLDQLGLERPHIAGNSLGGRIALEAAADDL
VASATVLSPAAYWHNALDFAYIRFVFWCLTTSARALAPVVPTLARSARAR
RMMGAVVSAHPDRIPADEFVADLNGMRRAVPAMKKIFPAAEVFHREIPAD
IPVTVAWAARDRILLPYQARIAERRLPQARHIRLSGCGHVPMADDPELVA
RVLLEGSAPDRRAEAS
333990673YP_004523287.1 hypothetical protein JDM601_2033 [Mycobacterium sp. JDM601]MTVPQPLGKVGALARRTQAAGFSGLLFTEAGRTAYLNAATASQAAPGLEL
STGVAVAFPRSPFVTAATAWELQEATAGKFRLGLGTQVRTHVVRRYGAAF
DRPGPRLRDYVLAVKACFDAFRTGTLNHHGEFYDLDFITPQWSPGPIEVP
DPKVDVAAVNPWMLRMAGEVADGVHVHPLGEPGYLTRHVVPMVAEGARKA
GRAPSDIAIIVPAMTIVGDSDEERHRERELVRASMSFYGSTPNYAFIWDE
AGFEGTTARLREKQKAGDFAGMAAQITDEHLATFATESTWDELADKLLDR
YGAVATRLVLYNALGDPERFERYGQIARRISGG
333990671YP_004523285.1 transcriptional regulator [Mycobacterium sp. JDM601]MLLVMARSTYHHGDLRAAILSEAARMVAEQGADRMSLRELARAAGVSHAA
PAHHFTDRRGLFTALAAEGFRLLAEALTAARPRFIDAALAYVRFALAHPG
HYQVMFDKSLLDAADPGLGAAEAAAAAELSRGVAGLADPHARDDPTGAEL
AAWSLVHGFVTLWLNDAVDAAVKATDPMRTVERIARMLFDG
333990669YP_004523283.1 methoxy mycolic acid synthase [Mycobacterium sp. JDM601]MTDTELKPDVAHVQSHYDRSNEFFRLWLDPTMTYSCAYFERDDMTLEQAQ
LAKVDLALGKLGLQPGMTLLDIGSGWGSTMRRAIEKYDVNVIGLTLSENQ
VAHCERKFAEMDSPRSRQVRLQGWEQFDEPVDRIVSLGAFEHFADGVGTY
ERYDDFFKMCYQVLPDDGVMLLHSIVVPSEAEAEQMGLKRTMSLMRFISF
IRKEIYPGGRLPMISVVDEHASRCGFEITRHHMIGSNYVRTLDTWARALE
AHRDEAIELNGEQMYDTFLKYLTGCRELFRDGYTDVCQFTMEKPTR
333990667YP_004523281.1 3-oxoacyl-ACP synthase [Mycobacterium sp. JDM601]MTRFSTGNGFPDVVVTGVAMTTALAATVDDTWKKLLDGQSGIRHLDDPFV
EQYNLPVRIGGHLLEEFDHELTRKELHRLSYLQKMSTVLGRRVWANAGSP
EVDTRRLMVSIGTGLGSPEELVWGYQGMVERGMKGVSPLGVQKYMPNAAA
AAVGLERGAKAGVLTPVSACASGAEAIAQAWRDIVYDEADIAICGGVETK
IEAVPIAGFAAMRIVLSTTNDDPAGACRPFDRDRNGFVFGEGAAMLVIET
EQHAKARGATILARLMGAAITSDGYHIVAPDPSGERAGYAMTRAIELAGL
APSDIDHINAHATGTRIGDLAEAQAIHNAMGSHQPAVYAPKSALGHSVGA
VGAVEAILTVLALRDGAIPPTLNLHHLDPEIDLDVVAGQPRLGDYHYAIS
NSFGFGGHNVALAFGTY
333990665YP_004523279.1 methoxy mycolic acid synthase [Mycobacterium sp. JDM601]MTDASTGADQMRPHFEDVQAHYDLSDDFFGLFQDPTRTYSCAYFEDPGFT
LEEAQLAKVDLNLDKLNLLPGMTLLDIGCGWGTTMKRALEKYDVNVIGLT
LSKNQRAYAQQLIDGADSGRDRQVLLHGWEEFTTPVDRIVSIEAFEHFGH
DRYNEFFARCYDILPDDGRMAIQSSVSYHPYDLNARGKKLTFETARFIKF
MVTEIFPGGRLPTTEMMVQHGEKAGFVVPEALSLRPHYIKTLQIWGDALE
AHKDEAVAIQSEQVYQRYMKYLRGCQHYFTDEMLDVSLVSYLKPEAESIT
TR
333990663YP_004523277.1 NADP-dependent oxidoreductase [Mycobacterium sp. JDM601]MADRNRRFLLRERPTGRIGPDTFEFSEQAVPAIGDGEALVRVEWISLDPT
NRMWINDTPSYLPPVAIGEVMRAAGLGEVVASNNPNYPVGQVVQGLTGWQ
DYVVVSDAMPLFPVDVAQGVSPSTYLGALGMTGLTAWIGIRDIGKPKPGE
TVVVSAAAGAVGSVAGQLAKADGARVVGIAGGPEKCALLTDQLGFDAAVD
YRADDWGARLAAETPDGIDVDFENVGGDIMDAIFARVNVGARIALCGLIS
GYNATDPPPGPRAFGNLLIQRATLQGFIVLDHFLRAPEANSEIAELIAAG
KLTPLETVVEGFEQLPTAINMLFDGKNVGKLVVRTAG
333990661YP_004523275.1 hypothetical protein JDM601_2021 [Mycobacterium sp. JDM601]MAVRFLRVIAVFVLALTVAGTVPAGAAPGADPAAVAADLVAADQALRNPS
APEQVLAAAARRQQVAYRTLGAHPEWDAIVRPQIPAALLEVYDRNIDARR
QLMALTEPKSTMPPWRVVPPVPANELMAAYRAAEAASGVPWNYLAAINFV
ETGFGRINGVSDDAAQGPMQFLPSTFAAYGNGGDINSPRDAIMAAGRLLA
ANGFATNRDKAIWGYNHSDHYVRAVNDYAAVIGGDPAGFASYYRWDTYYR
TTAGDLLLPIGYVSTTRIPVEQYLAAHPQ
333990659YP_004523273.1 hypothetical protein JDM601_2020 [Mycobacterium sp. JDM601]MYRTREAVASTGILVAAIRARESARQDALFQDPLADRLAGEQGRRMLAAA
IADAGDQSTWAIVVRTRFWDEALLRAGIRQVVILAAGMDARAYRLPWPEL
TTVYEVDQPAVIAAKADLLADDRPRCRRVPIGIDLADDWPSALQAAGFDA
HAPSVWLIEGLLQYLDEAAVATLFERVDALSSPGSMLLYDVVGKTLLEAP
SMAPLLQAMAQQGSPWLFGTDEPGQLAERLGWSATVTDVAEPGMRWNRWQ
ASEGPDLPRGYFVAAQC
333990657YP_004523271.1 hypothetical protein JDM601_2017 [Mycobacterium sp. JDM601]MRWIVDAMNVIGSRPDGWWKDRGAAMVRLTRQLEQWATAEHQRVTVVFEK
PPSPPISSEVVGIAAAPRAGADSADDEIVRLVRADDCPHDIIVVTSDLGL
AQRVTEAGAASLPASRFRDLLEET
333990655YP_004523269.1 hypothetical protein JDM601_2015 [Mycobacterium sp. JDM601]MSDLCAPTFERLAESLGFSCAEAGGLVEFRNPLQLENWTLPVLEITVIVG
AVLALVYAINRFRRHGDATNLTLWFGAIAYLLIIEPPLYFPAAFGIAEHV
DTMFAHNVFSVDFLWGRLPLYIIAIYPMMATVAFEIVRILGVFRRYGVVV
GAVCVGFVHHAFYEIFDHLGPQLRWWEWSVDNPLNQPMFASVPMGSVVVF
AALWPASLAFCVQLLVGRHVDEGRRFSGLQVLLRTVVVGLLASLGTGILP
LPATLLGAATDGRLLGIAYAAELLVIVAVAVPVLVAQWRRLRLNLIIDGR
HDNPLMVRYAAVYLSVMTVLWLTALPAYLDAVGGVTANGDPVGSLWYTIG
CFTVAYLCVAAAATVPPILPDAVERATPAPAATG
333990653YP_004523267.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MARRRGWGGNPPHSDEEASRRIIAAAVDLVAETGAAVSLADVAGSLGVIR
QTVYRYFPTADALMRAVAIASVDDFLDRLTDHVRGIHDPADALTEGTLYT
LDAVTGSPHLGAMLSSTSPLNREMTSEESLTFGMRMVDRFDVDWAQHGYD
AASQRELVEFTLRVMLSFIVAPNDPGRSPDELRRFLRRWLGEAVAAQRRR
PTR
333990651YP_004523265.1 transporter [Mycobacterium sp. JDM601]MSGHSNPRPRYMRLVRRLAWPLIVFWLLLTVGLNVLVPPIESVAREHAVT
MSPQDAPSLIAAKHIGAKFHEFDSDSLVMLVLEGENELGPEAHRYYDTLI
AKLSADPEHVQHITDLWGDPITAAGVQSSDGKAAYAQINTAGDQGSTLGN
ESVDAVRKIVASVPAPDGVKAYVTGQAALTTDMTEAADKSMLKMMGVTGV
VIIIMLALVYRSAATVALALVMVGFEMGTARGLVALLGNAGLLGFSTFVV
AMLSSLAIAAGTDYAIFLIGRYHEARNAGEDRETAWYSMFRGTWHVILGS
GLTIAGASLCLHFARLSYFKALGIPSALGLLVVIAGALTVAPAIVAVAAP
LLDPKRVEGRGWRRIGTANVRWPGPVFVAALLVTLVGMLAVPGMKISYND
RYYIPADLPANVGYEAAERHFSAARMNPDVLMVEADHDLRNPADMIILDR
IAKNIFRTRGVERVQSITRPLGSPIDHTSIPFQVSMGAVPIQQNLQFMNE
RLADMLTMSDELGATIDSMNRLRELVMRMGDTTGRMHTDMADITSTVDEI
RDHIADFDDVARPVRNYFYWEQHCVDIPVCHAVRSVFDAYDGMDQFSEKM
RPLLDDINDMDAVIPQIVGQFTPMIAVAESMRASLLRMHSSFAGLVTQMA
RMTDTATEMGRAFDASRADDYFYLPPEAFDNPDFQKGLQLFVSPDGTAAR
FIVTYDADPATPKGISVVEPMLAAAHDAVKGTPLTGATFYLTGTAAVYND
IQSGSAYDILIVGVAAVTLIFIVMLLITRALVAAAVIVGTVLLSLSAAFG
LSVLVWQHIFGLPLNWIAPVFGVIILLAVGSDYNLLLVSRFAEEIDAGIN
TGIIRSIGGTGSVVTAAGLVFAFTMMSMAVSDLYSIGQAGSTIGLGLLFD
TLIVRSFLTPSIAALLGRWFWWPLRVPPPHAAGTPGVSTAAPGSAATRPP
VTAGSP
333990649YP_004523263.1 acyl-CoA ligase [Mycobacterium sp. JDM601]MHPPQHPAAPEGLVQIEECLDADGGIVLPPDDTLISLIDRNIANVGDAVA
FRYLDYAGPDEGRAVELTWAQFGRRLRAVAARLQQVTARGDRVAILAPQG
LEYVVGFYAAVKCATVAVPLFAPELPGHAERLDTALRDSAPSVVLTTAAV
RPIVEDFLRGLSQPLPPRVVVIDEIPDSAAAAFVPVEIDIDGVSHLQYTS
GATRPPVGVQVTHRSVGTNLLQMILSIDMLDRNTHGLSWLPLYHDMGLSM
IGFPAVYGGHSTLISPTAFIRRPQRWINALSDASRRGRVVTAAPNFAYEL
TAQRGLPAPDAGVDLSNVVMIIGSEPVSMSAITAFNEAFARFGLPRTAIK
PSYGIAEATLFVATIDPDAEASVLHLGREQLGAGRAVPVAADAPDAVTRV
SCGRVARSLWAVIVDAGTGEELPDGHVGEIWLHGDNVTAGYWRRPEETRR
VFGARLQRRLEGSHAERAPIDGSWLRTGDLGFYRNGELYVTGRTVDLMTI
DGRGHYAHDVEATVAQASPMVRTGYAVAFTAAPADRLVIVAERATGTGRK
DPGPAVAAIRAEVSRVHGLAAADVVFVPAGAIPRTTSGKLGRTACREQYL
AGGLA
333990647YP_004523261.1 transporter [Mycobacterium sp. JDM601]MVRVFSLPIVLAWVFLAVVLGTFVPSLGEVAATRSVPLSPLNAPSYQAML
NIGKVFEQYDSDSTAMVVLEGEDHLGDAAHQFYDEIIAKLEADREHVQNV
QDFWGDPLTAAGAQSVDGKSAYVQIFLNGSQGTSESHESVAAVRDIVASL
TPPPGITAHVAGNTVLNADTSVAGHQSMATMELVSVAIIIMMLLTIYRSV
VTMLVSMVVIGLGLFAAMGVTAAAGNLNIIGLTPYAVSMVTMLSLAAITD
YVIFLWGRYQEERSKGLEPEAAFYIAYSGVSHVILGSGLTIVGALLCLNM
TTLPYFQTMGLPCAIALLVVIAAALTLAPAVLTVASRFGLLDARQNLSTR
GWRKVGTSTVRWPIPIILLTGMVAVVGFVSLLTYEPQYNDQNFTPSDMPA
NLAMDVADRHFSQARMNPELLMLEADHDLRTPSDMLVIEKVAKNVFRMRG
IDRVQTITRPLGAPIEHSSIPFLLGAQNAGTLQAAKFNNDNSAQLLEQAD
EMAKTAASLERMYTIMKETSETTHSMAGRTHEMADTTDQLRDRLAEFDDF
WRPMRNYFYWEPHCFDIPICWSLRSIFDSLDGVDQLAQQIQGLTIDIDRL
DELMPQMLPVLRENIESMNRMRDMMIATHSTMAGTQAQQQELAKGATEIG
LYFDQAKNDDFFYLPPDVFDNPDFQRGIKMFMSPDHKAVRMIITHQGDPA
SVQGIAHVRDLKDVVADALKGTPLASAKVSLAGTASLYSDMQDGVTIDLM
VALIASLILIFAIMLIITRSVVAALVIVGTVAASLGIACGLSVLFWQDIL
GLGVQWIVLPLSMVILLAVGSDYNLLLVSRLKEEIPAGLNTGIIRGVGAT
GRVVTAAGLVFAFTMMAMLVSDLRVVGQLGMTIGIGLVIDTLMVRAFMTP
SIAAALGRWFWWPLDTYKITGHRGR
333990645YP_004523259.1 hypothetical protein JDM601_2005 [Mycobacterium sp. JDM601]MGRWGARRMSRRFAGVGVQIPAARLREMMAGAPPASAESIDYTFALAATA
IQREQRLARARRNRRRLVQLLIIAGLTLAALNLLICMGYLFVSLALHEPA
M
333990643YP_004523257.1 transcriptional regulator [Mycobacterium sp. JDM601]MAQAGVGPRVVVIVVFDDVTMLDVAGAAEVFVEANRFGADYRVRFASVDG
RDVATSIGARLGVTDRIAAVDSADTVMVAGSDLLPRRAIDPQLVDAVRSV
ASRTRRLASICTGSFILAQAGMLSGRRATTHWHDAPLLARAFPDVTVEPD
AIFIRDGDVFTSAGVSAGIDLALALVEMDYGSELVREVARWLVVYLKRAG
GQSQFSVLVEAHPPQQSALRAVTDAIAADPAADHSVNSLAVRAALSKRQL
TRLFQSELGTTPARYVEKVRVDAARAALDAGHSVADSAGRAGFGSAETLR
RVFIDRFGVSPKAYRDRFRTTARS
333990641YP_004523255.1 beta subunit of phenylphosphate carboxylase [Mycobacterium sp. JDM6MPPVPRWARRDEYGIGIPYFGDAGREMLTLEKLSRRFQQV
333990639YP_004523253.1 hypothetical protein JDM601_1999 [Mycobacterium sp. JDM601]MGRLTMFAGSLVAIVLAVVACTGYLARDDDSARHYDTVSLSASPNRIAVI
GDSYTSGYEDTGRGAANWTERAWQTLAGRGTYVHADVAAEGGAGYAVRGN
RGGLFGDLTARVVQPDDALVVFFGSRNDQDVEPGQLTRLVADTLGLARRA
APSTRMLVIGPPWPTAEVPADLWRIRDILSTEARVVGAEFVDPLAEGWFV
GRPELIGPDGVHPTDAGHAYMADKIVPLIAGQLPKRT
333990637YP_004523251.1 ceramidase [Mycobacterium sp. JDM601]MGRGIADITGEPAECGMLGYGVASQQTSGLHNRLRARAFVIVHPASEVRL
LLVVCELPLLLESVHREVLGRLAAAHGELYTVHNVMLTATHTHCGPGGYS
DHRLYNSNTGGFRPQTFAAIVDGICEAVERAHADLAPASLSLAVGRLHDA
SSNRSPSAFARNPEAERAHFPDAIDPQTTLLRIERSGRLVGAVNWFATHG
TSMTNRNTLISGDNKGYAAYRWERIDRGVDYLAPDPPDFVAAFAQTNSGD
MSPNLNHRPGSGPTEDEFENTRIIGERQAAAAADLTTGHGAEVTGGLAAL
ATYVDLSDFEVSPEFTGDGRTHRTGPAVAGAAALAGTDEGPGPLHPLLRQ
GRNCIVDSLVDATVYRVAPRLRDAHAPKGLVGPGSRLNRALTLMPNGGPV
QLLRIGQLYLIGIPAEVTIVAGLRLRRTVAAIVGAELRDVLVAGYSNGYL
HYVTTPEEYQEQRYEGGSTLFGRWELAALQQVAAGLATAMRDRRPAPVGN
AAAEPPRRRRSRRRVSADEPAAGRRFGEVLAPPLAHYQPGATVTAVFAGA
HPNNDLHRGGTYLRVERQTGGAEGGWSTVADDGDWSTTFRWRRAGRRGST
VTVTWTVPENTAAGRYRLRYDGDARGLEGQRTAFTGSTEPFEISRKR
333990635YP_004523249.1 hypothetical protein JDM601_1995 [Mycobacterium sp. JDM601]MLATLALGWAVGRGSTPFDGWFSHRTREVFGEQPRWLLAFTSGWLVLAVL
VGCLAVTLLRRQWALTAAVLICPFVVTAAAQGLKHLFDRRNGPYLAYPSG
HTALLVAVLAMMVVVAHACREARRWALALAAALSVLGMLGLVACGYHFLT
DTLGAAMLATALVCAAARLTSAL
333990633YP_004523247.1 hypothetical protein JDM601_1992 [Mycobacterium sp. JDM601]MATLRILMFAALIAGWLPAGPAAAAPGGDVPPLPAPARAAGFVDVRSAVP
DAIIDLRYATTNNFTGVQLYPANARCLVHESLAPGLAAAADVLRRRGRTL
VFWDCYRPHEVQVRMFEVVPDPNWVARPGPLARSHETGRSVDVTTADPRG
RLVEMGTGFDDFSPRAAAFAEGIGAQAAAERAALREAMSAGGLAVYSGEW
WHFDGPGAGVGRPILDVAVN
333990631YP_004523245.1 D-tyrosyl-tRNA(Tyr) deacylase [Mycobacterium sp. JDM601]MRVLVQRVSSARVTVDGETVGAIAPDGQGLVALVGVTHDDDVKTAHRLAE
KLWQLRILDEQRSASDVGAPILVISQFTLYADTAKGRRPSWNAAAPGAVA
EPLVEEFAEALRRLGARVATGRFGAHMHVELVNDGPVTVLLEL
333990629YP_004523243.1 transmembrane protein [Mycobacterium sp. JDM601]MDTQWAWFGGSGYWLGRLVLERGIAAVYVVAFVAAARQFRALIGESGMLP
VPRYLRRRSFRVAPSIFQLHYSDRFFAATCWSGAALAAALVAGAGELVPL
WAVMSIWLLLWVMYLSIVNVGQAWYSFGWESILLEAGFLAVFLGNDRVAP
PVLVMWLARWLLFRLEFGAGLIKLRGDSCWRDLTCLYYHHETQPMPGPLS
WFFHQLPKPLHRIEAAGNHFAQLVVPFGLFAPQPIAGVAAVIIIVTQLWL
VASGNFAWLNWVTIVLAAAALDQSWLTGLFPGLRPPEMPESPVWFTAVVI
AFTAAVVVLSYWPVRNLAWRQQRMNASFNPFHLVNSYGAFGTVGRCRREV
VIEGTAATELTDRTVWQEYEFKGKPGALDRLPRQWAPYHLRLDWLMWFAA
LSPAYARPWRDALLQRLLRNDRDTLRLLRHNPFPDEPPRYVRALLYEYRF
TTPAERRRDRAWWHRSLVGVYLPPVSAHGMPAPPGPR
333990627YP_004523241.1 hypothetical protein JDM601_1987 [Mycobacterium sp. JDM601]MSRIRKYLTVAAGAAAGLFLGALASSSAATADTAPINPGLPGVVEQMVAS
STAIPQQLLQTTTSALSGTPLAPAASPAQSPIATATLNVPQTTTPASQPT
GLPGLSGLPANLSSVLPFPMPNFGGTTPVAAAPTTMVPGAFAPTAPVTPM
EVMLIPGLP
333990625YP_004523239.1 phosphoserine phosphatase SerB [Mycobacterium sp. JDM601]MTSDLIAEIGSTEPGARVGAFFDLDGTLVSGFTATAHAGDRIRRRQARAG
EVLGVVEAAVRYRLGRMQFERLLVRAAGYLRGESIRELDEIGERLFVDHI
TGRIYPLMQQVVRAHQQRGHSVVLSSSALTIHAEPVARYLGIGQVLCNRF
ELDEHGLLTGDIVKPVVWGRQKAAAVQRFCADNGIDLGQSFFYADGNEDA
ALMSLVGRPRPVNPRPGLAALAAEHGWPVLRVSGPGRAPGRSLRRAAGFG
VAVLRAVATR
333990623YP_004523237.1 hypothetical protein JDM601_1983 [Mycobacterium sp. JDM601]MGHPVGAAETLPLVLSGACGLAMTATVASGAAGPAAVPALAAAGAVLAGF
RWPAAATVAVLLAVVAIGITDPPTVSAAVAGLAAVGYLVLRHAGTMTLPT
VIAVLGFTVAGVAATAFPWSLPWLPLLAPFAVLGVCVVVAQPFLGTGR
333990621YP_004523235.1 methanol dehydrogenase transcriptional regulatory protein MoxR3 [MyMSAGLSGTAETTAERCAAVLDEIEQAVVGKRPALTLILTAVLAGGHVLIE
DLPGLGKTLIARSFAAALGLDFTRVQFTPDLLPADLLGTTIYDMASGRFE
FRRGPIFTNLVLADEINRTPPKTQAALLEAMAEGQVSIDGQTHRLPSPFI
VLATDNPIEYEGTYPLPEAQLDRFAIRLRLGYLPEQGEAAMLRRRLDRGA
ALPTVRKVVDADDVTAMRESVEQVSVHDDVLRYVVSLANGTRHHPQVAVG
ASPRSELDLIQLARARALLLGRDYVIPEDVKALATSAVAHRIALRPEMWV
RRIQGADVVDELLRRLPVPRTQGAPGPAPDTAPP
333990619YP_004523233.1 hypothetical protein JDM601_1979 [Mycobacterium sp. JDM601]MPQRRRATQTSAAAMRAGADTATGRVIALIVLVLAAGAATRGYVPGVAHD
PRRPAEAGPVAQLILAALLAVSVGAVAVAVAQRARDRRAPPGSIGELSRT
VGAHRGQPAWRVLLIGLAVLTAWLLAVVVMVRLGAAHRFSIPAGLLGTRG
EAPTSPAGADAPAPVPLHPPPLGAAGAPLGYLLVLTAGLLVLIAAMLLVA
RARRATSAAPQINPAPAAAQPPTAGESLARAAELGLTRIADRSREPREAI
IACYAVMERHLADVPDAAPREFDTPTEVLARAVEHHALPADNAPRLVELF
TEARFSPHLMTEAHRAEAVAILRLVLDELRART
333990617YP_004523231.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium sp. JDM601]MGGLAEETSQRLVIFGITGDLARKMTFRALYRLERRHLLDAPILGVASDD
ITVEELVNRAAEAIRHSGEPFDEAVFGRLAERLSYLPGDVTDAALYEQLA
EQVGTDQSCLYYLEMPPSLFGPIVEHLGRAGLLQRSRVAVEKPFGHDLAS
ARDLNTRMRAVLREDQILRVDHFLGKQPVADLECLRFANTTLAELWDRHS
IAEIHITMAENFGVEERGGFYDAVGALRDVVQNHLLQVLALVAMEPPVGA
GDDDLNDKKAEVFRAMPAAEPVHYVRGQYCGYSEVPGVADGSQTETFVAL
RLQIENWRWAGVPIFLRAGKALPERVTEVRLFTRRVPALAFMPHRERAQR
NQIVLRIDPDPGLRLQLVAQDDQNAQAWRDVHLDSSFAHDLGEPIQPYER
LLHAAIVGDRRLFAREDSIEETWRIVAPLLEHPGEVHPYERGSWGPEAAQ
ALVRGHRSWQQPWLPANGRSR
333990615YP_004523229.1 hypothetical protein JDM601_1975 [Mycobacterium sp. JDM601]MTAQGQFDASHGRLQVGTGVAGRAAKMGHRLTIAMERWQAVVSWSGEQPT
AVTLTVEADSLRVLGGEGGMTPLTGPEKALIRTNARNCLGADKYRRIRFE
SSEIEANDDGYRLTGSLEIRGRTKPHVVAVQVSELGPPHQHRDSWRVDGE
TVVRHSDFGVRRYSMLMGAMQVADEVTVSFSATVSADEIRGS
333990613YP_004523227.1 hypothetical protein JDM601_1973 [Mycobacterium sp. JDM601]MTKGMRWVRRLMVGAVAAAALPGLIGLTGNEATASAFSRPGLPVEYLQVP
SAGMGRDIKVQFQPGGSGSPGLYLLDGMRAQDDYNGWDINTPAFEWYYQS
GISVIMPVGGQSSFYSDWYKPACGKAGCSTYKWETFIASELPAYLASEYG
VSQSRNAAVGLSMAGSSAMNFAIYHPNVFTYAGSLSGYVNPSDGKSWIGL
AMGDAGGYKKEDMWGPDDDPAWLRNDPTINVAKLVANNTRLWVYCGNGRP
NELGGDNIPATFLEGNFMIGQNKKFQEAYTAAGGSNAVFNFPDYGTHSWE
YWGAQLQAMKPDLQSHLGASAGGGEG
333990611YP_004523225.1 peptidase S15 [Mycobacterium sp. JDM601]MGMPEPRTARNVKLVLAAVAATGVAAVALRKSRPARPRKTSASPLLPEWA
APPAQYGVGVRRNVAVEMSDGVVLRADIHYPTVRETGEAAGGPFPVLLSM
TPYGKLAPPPAAQIGGGPTPHLIRRGYIEVMVDVRGTGASGGSFEMFGAD
QARDGVELVDWASALPNANGRVGMFGISYLAINQLFTAAAVGPDSPLKAV
FPVMAANDFYRDAAAMGGAPHLATVRGYGALYTMLNVINPTLEFFIRGGH
PRPRAGGLAAVRQRGRDQRGYFGPLVAEARTGGDAAYDGPFWDSMRPELV
LPEVAANNVAVFLVGGWHDAFQRGAPLNFAALQNACTGRAEHAPMQPGQP
LAERIRLMMGPWYHVSAFDGLHVQDLQLRWFDHWLKDDAGAEISGSPFSF
QAIGDSRWFHAREYPIAEAVPTRLYLSQGGRLLADAPAEQTVATLRYRAR
GPVSGRSLEQWTLGLNSFVTTQVGGRTRHDQDNRRLQRGALTYTTEPFDA
PTLIAGPITLRVEATADTTETLWVAHLDDVAPEGVSRPLTQGALLGSHRA
LDPDRTWYLPDGTVLRPHHVSTRSAVRPVEPGELTGYDIEIFPTAAMIAP
GHRLRLTVTSYDFPHLVPTAPARRALAGGTYRLHQGGPTPSFLLLPLADP
DTLD
333990609YP_004523223.1 hypothetical protein JDM601_1969 [Mycobacterium sp. JDM601]MAWMTKSPELAAGIGGFSTAVYNNGRLPMRTRELARMVIAFDNECAVCVN
TRDADGPAAGVSEDLYEHVSEWRTWPGYSDAERLAAEFAHRFATDHTGLR
DDEDFWSRCAEHFSDELLADLALSCALWLGMGRFLRTMDIGQACAFTLPS
RA
333990607YP_004523221.1 bacterioferritin BfrA [Mycobacterium sp. JDM601]MQGDPEVLKLLNEQLTSELTAINQYFLHAKMQENWGFTELAGHTREESME
EMRHAETVTDRILVLGGLPNYQRIGSLRIGQTIREQFESDLALENDVLNR
LRPGIVMCREKQDSTTAKILEAILVDEESHIDHLETQLELMDKLGEALYS
AQCVSRPPTT
333990605YP_004523219.1 hypothetical protein JDM601_1965 [Mycobacterium sp. JDM601]MAGTLGVAANVASMMPRTVHRHLPQSPPAPHIAATSFDVDAPAATASLTI
333990603YP_004523217.1 alkyl hydroperoxide reductase [Mycobacterium sp. JDM601]MALLTIGDQFPSYRLTALIPGDLSKVDAKGPEDFFTTVTSDDHPGKWRIV
FFWPKDFTFVCPTEIAAFGKLNDDFADRDAQVLGVSIDNEFVHYNWRLQH
EDLKTLPFPMLSDLKRELAEATGVLNADGVADRATFIVDPNNEIQFVSVT
AGSVGRNVDEVLRVLDALQSDELCACNWKKGDPTLNVGELLKESI
333990601YP_004523215.1 L-lactate dehydrogenase (cytochrome) LldD2 [Mycobacterium sp. JDM60MEQAMPVTQRRFPRVHELAPLIRFRRPRLNRRAQRLAAALTVEDLRRIAQ
RRTPRAAFDYTDGAAEDEISLERARQAFRDIEFHPAILRDVTDVDTSRDV
LGASVALPFAIAPTGFTRLMHTAGELAGARAAEAAGIPFSLSTLGTASIE
EVAAAAPGARRWFQLYIWRDRERSMALLRRAADAGYDTLLATVDAPVPGA
RRRDTRNGMTIPPALTLRTVADAIVHPAWWFDLFTTEPLAFASLDRWSGT
VAQYMDNMFDPSMTFDDLAWVRSQWPGRFVVKGIQTLADARAVVDLGADG
IVLSNHGGRQLDRAPVPFALLPHVAREVGADTEILLDTGIMSGADIVAAV
ALGARCTLIGRAYLYGLMAGGQAGVQRVIDILAEQIRRTMRLLGVSELAE
LSPQHVTQLRRHVPR
333990599YP_004523213.1 hypothetical protein JDM601_1959 [Mycobacterium sp. JDM601]MIAVPVGSVAPHAQREGRDPRRYQRPVPVRIGQTGQQLVLESCRRRCVAT
QPTGGPRLGRGTAHQRCSFQGRSTRRADVMSPRTLTRTPDDRCRPSVLQY
GD
333990597YP_004523211.1 hypothetical protein JDM601_1957 [Mycobacterium sp. JDM601]MHTHKELVRRLLRRAGKTYAQEAGIRLRNQPMPLFQLLTLCMLASKPIDA
AIAARASRELFRSGLRTPHKVLEADRRTMIEAMGRAHYRRYDESSATRLV
EIAEAVQQDYRGDLRLLAERSGRNVEAAVQLLKGFKGIGDTGASIFLREV
QDVWPWARSTFDDLALAAARDLGLPGDPSELGALSRGRNAELAAALVRYS
IDSDVRERLAD
333990595YP_004523209.1 acetyl-CoA acetyltransferase [Mycobacterium sp. JDM601]MLIGYGQINHPDHSEPVEPVDLMAAAAHRAAEDRVLRAVDSIRVVNLFSA
RYRDPGALLAQRIGADRPATRYTPVGGNVPQALVNRACLDIQSGRAGVVL
LAGGEMWRTRTRLRAAGSKLAWTRQDETVPMAECEGEDVPLSGPAEEGIG
LDRPAYVYPLFEQALRIAAGESVDGHRRRIGELWSRFNAVAVDNPHAWIR
EPVGAEEIWQPGPKNRMISWPYTKLMNSNNMVDQAAALVLTSVRVATELR
IPAERWVFPQAGADAHDTYAIAERAELHTSPAIRIAGARALELAGAGAIG
EIDYVDLYSCFPSAVQIAANELGLPTDDPDRPLTVTGGLTFAGGPWNNYV
MHSIATLAELLVAHPGRRGLISANGGYLTKHSFGVYGTEPPGAGFRWEDV
QPAVDAQVTRKGIAQWQGGGTVESWTTPFDRDGCAQQVFVAVRTPEGART
LAVIRDADVAESSVREDIAGAAVDVHEDGTAALR
333990593YP_004523207.1 D-xylulose 5-phosphate Xfp [Mycobacterium sp. JDM601]MSAETTAPASATLPDDDLARIDAYWRAANYLSVGQIYLLDNPLLTEPLAA
EHVKPRLLGHWGTTPGLNLLYVHLNRVIRERDADVIFVTGPGHGGPALVA
NAYLEGTYSQVYTGIEENRDGLRKLFRQFSFPGGIPSHVAAETPGSIHEG
GELGYALVHAFGAAFDNPELVVACVIGDGEAETGPLAASWHSNKFLNPAV
DGAVLPILHLNGYKIANPTLLARIPHSELEALLRGYGYRPITVAGDDPAV
VHRSLAAALDDAFDDIAAIRRAARADGSTMRPVWPMIVLRTPKGWTGPAK
VDGQQVEGTWRSHQVPLAATRTDPEHRRQLEEWLRGYRPTELFDEAGRLR
PELAALAPRGNRRMSANPHANGGLLLRDLDLPDFRDYAVPVSRPATETHE
ATRVLGTFLRDVIDRNRDRFRLLGPDETASNRLSAVFETTDRVWLSETAP
GDDHMAPDGRVLEVLSEHLCQGWLEGYLLTGRHGLFNCYEAFVHIVDSMF
NQHAKWLAVSRELPWRRPIASLNYLLTSHVWRQDHNGASHQDPGFIDLVA
NKRPEVVRVYLPPDANTLLSVADHCLRSRNYVNVIVAGKQPALAYLDMPE
AVAHCTRGLGIWDWAGTATGEPDVVLACAGDVPTLETLAAADILRRELPG
LAVRVVNVVDIMRLQPATEHPHGLPDSEFDALFTRDKPVIFAYHGYAWLI
HRLTYRRTNHDQLHVRGYRERGTTTTPFDMVMLNDLDRFHLVMDVIDRVP
GLAERSALLRQQMADARLAARLYTREHGEDDPRITDWTWRTDVSGADGGI
R
333990591YP_004523205.1 hypothetical protein JDM601_1951 [Mycobacterium sp. JDM601]MSQLAALNQFRAFVDVAVVVVVLVMANLVAHFTTPWAAVATVPAVAVGLV
ALVRCNGLSWAELGLGRAHWKSGVGYAAAAVLVVVSVIAVGALLPWTRPM
FLNNHYATLSGAVVASMLVIPLQTVIPEELAFRGALHGALHRAWGFRGVA
AAGSLLFGLWHVATSLGLTSSNVGFTRLFGGGFLGMVAGVTLAVLATGAA
GFVFSWLRRRSGSLIAPIALHWSLNGVGALAAALVWQLSA
333990589YP_004523203.1 transmembrane protein [Mycobacterium sp. JDM601]MLAATEFLAERSTTLTSVGWIGYIIIGAIAGWLAGKIVGGGGRGILMNIV
IGVIGALIGGFLLSFFLDTAGGGWWFTLFTATLGSVVLLWLLGLVRRG
333990587YP_004523201.1 molybdenum-transport ABC transporter ATP-binding protein ModC [MycoMADGLTLHAVVAERGLDVHMTVAPGEVLAVLGPNGAGKSTLLHVIAGLLR
PDPGLVRVGDRVLTDAAAGVHIATCDRRIGLLMQDPLLFPHLSVAANVAF
GPHSGHRRWRLSRRQPRTRALAAPWLRAVGAEELADRKPRRLSGGQAQRV
AIARALAAEPDVLLLDEPLAGLDVAAAEAVRTVLREVIVTTRRTTVLVTH
DLLDVFALADRVLVLESGRVAEIGGTAEVLAAPRSRFGARIAGFNLVAGV
IESDGVLRTRWGDRWHGIADDGPGVGRPAVAVCTPRAVAVYREPPAHGSP
RNLVAVTVAELDARGSAIQVRGVDQPDGAPGLAADITAEAAGELRLAPGE
PVWFGVKAQEVTLRATHPGMA
333990585YP_004523199.1 molybdate-binding lipoprotein ModA [Mycobacterium sp. JDM601]MWRTRVVSGAVAIMLAAGSTGLTGCSSGPAMPSITVFAAASLKAAFTEIA
EQFKTDHPGVAVEFNFAGSSDLATQLTEGARADVFASANTAQMDKVARAG
LLDGEPVPFASNTLVIVTAPGNPHAVRSFADLAGPDLAVVVCQPPVPCGA
ATGKVEDLTGVRLNPVSEEPDVTDVLNKVTTGQADAGVVYRTDAIHAGDK
VATVEFPEAAGAINTYPVALLKDVAQAAPARAFVELVTGAAGQKILHAAG
FGEP
333990583YP_004523197.1 NADH dehydrogenase Ndh [Mycobacterium sp. JDM601]MSAQPEVTAPQRRRHQVVIIGSGFGGLTAAKKLKRADVDVKLIARTTHHL
FQPLLYQVATGILSEGEIAPSTRVVLRKQRNAQVLLGDVTHIDLAGKYVT
SEVLGHTYDTPFDSLIIAAGAGQSYFGNDQFAEFAPGMKTIDDALELRGR
ILSAFEQAERSRDQARREKLLTFTVVGAGPTGVEMAGQIAELANYTLKGA
FRNIDSTKARVILLDAAPAVLPPMGEKLGLKAAERLQKMGVEIQLGAMVT
DVDRNGLTVKDSDGTIRRIESQCKVWSAGVSASPLGRDLAEQSAVELDRA
GRVKVLPDLSVPGHPNVFVVGDMAAVDGVPGMAQGAIQGAKHAASTIKAE
LGGADPADREPFQYLDKGSMATVSRFSAVTKIGPLEFSGFLAWLAWLGLH
LIYLVGFKNKVSTLLSWNVTFLSTRRGQLTITEQQAFARTRLEQLEVLAA
EAQRGAERAVS
333990581YP_004523195.1 transcriptional regulator [Mycobacterium sp. JDM601]MAKQTHLGDLERAVMDHLWSAPEAQTVRQVHEALSAQRDLAYTTVMTVLQ
RLAKKNLVSQIRDDRAHRYTPVRGRDELVAGLMVEALDQAADSGDRRAAL
VHFVERVGVDEAEALRRALDKLEAKHHVGPPAGGRHTS
333990579YP_004523193.1 6-phosphogluconate dehydrogenase [Mycobacterium sp. JDM601]MSASELVGTAQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLS
AHGSEGKFVRTESIPEFLAALEKPRRVLIMVKAGDPTDAVINELADAMEP
GDIIIDGGNALYTDTIRREKAMAARGLHFVGAGISGGEEGALNGPSIMPG
GPKESYTSLGPLLEEISAHVDGVPCCTHIGPDGAGHFVKMVHNGIEYSDM
QLIGEAYQLLRDGLALTAPQIAEVFTEWNAGELDSYLVEITAEVLRQVDA
KTGKPLVDVIVDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSV
PQRRAAAGLAAGALGDRPSDAARFTEDVRRALYASKIVAYAQGFNQIQAG
SAEHGWNVTPGDLATIWRGGCIIRAKFLNRIKEAFDTDPDLVSLLAAPYF
RSAVEAAIDSWRRVVTMAVALGIPSPGFSSALAYYDGLRTERLPAALTQA
QRDYFGAHSYGRVDAEGKYHTLWSGDRSEVPV
333990577YP_004523191.1 PE-PGRS family protein [Mycobacterium sp. JDM601]MQALSIGPVAAAVALVGAGVIAVTPPVHADLAAPAVTLTSGEAQDIVIDI
VRHGQRMPPFNDVITPSPDHPGPPLSDLGMQQAQDVAEKLHQELGDHVAG
IFSGQAIRDIDTAAPFAALQNMTTQILPGLNEIDSGIYAGQPIASLSGFL
YQFTPMLWTLFGLVLMPIPGSVEDPNGVVMDQKFTEAVAAMYSAAMANPV
ESDNGDITAVAFNNEADIAAWVALNVKNPDISLLLPLTLQTMFANDDGSP
LLPNTGIVQIEGNPTDGWTLVSWNGIPVPEDPGLLTRLIMDVRDLITTPQ
VAAWNLYQALLGGDATTIGEAFQTGLHDVSSVFLGFPQAVFDDITDAVAN
LGSAAGGAADDTGSALADLLALI
333990575YP_004523189.1 hypothetical protein JDM601_1935 [Mycobacterium sp. JDM601]MAIRTPIATSVDPRLARPGRGADRGSRIDAPAAWRGCHLESYLERKLHRQ
WRNRGS
333990573YP_004523187.1 inosine-5'-monophosphate dehydrogenase [Mycobacterium sp. JDM601]MRFAGGYDPGYDLTYDDVFIVPNRSAVASRLDVDLSTRDGSGATIPVVVA
NMTAVAGRRMAETVSRRGGIVVLPQDLPIDAVSQTVAFVKSRDLVADTPV
VLSPDDSVSAAMALIPKRAHGAAVVTVDGRPTGLVTRACCEGVDRFSRVR
DVAMSDLLSVPIGTEPRKVFDLLEHAPVPVAVLTNSDGTLAGVLTRTGSI
RAGIYTPATDAAGRLRIGAAVGITGEVTARAAALLAAGVDVLVIDTAHGH
QEKAMQAIRSVAALTPGVPLVAGNVVSAAGTRDLIGAGADIVKVGVGPGA
MCTTRMMTGVGRPQFSAVLECAAAAHDLGAHVWADGGVRHPRDVALALAA
GASNVMIGSWFAGTYESPGDLMFDRDDKPYKESYGMASKRAVAARTAGDS
AFDRARKALFQEGISTSRMMLDPDRGGVEDLLDHITSGLRSTCTYVGASD
LAELHERAVLGVQSAAGFAEGHPLPFGW
333990571YP_004523185.1 hypothetical protein JDM601_1931 [Mycobacterium sp. JDM601]MTDLFNVVLTVLLVAANAFFVGAEFSLISARRDRLEALAEQGRQSAVTVI
RAGEQLSLMLAGAQLGVTVCSILLGRIGEPAVADLLEPVFRLVGIPDALL
HTVAFIVALTIVVTLHVLFGEMVPKNIALAGPETAAMLLIPPYLIYMAAA
RPFIVFYNWCANVTLRAVRVQPKDELEITVSTVELSEMIAESVSAGLLDL
EEYTRLTRALQIRNRTVADVALPVGDIRAVPAAAPGRGPTVAAVDKALAQ
TGYSRFPVVDQGQYVGYLHIKDVLPLSESSAAAAGGDGAAAVVDIGVVRP
LPRVPASLPLADALTRLRRTNSHLALVVATDGAVVAMVALEDLVQDVVGT
VRDGTHHV
333990569YP_004523183.1 malate synthase [Mycobacterium sp. JDM601]MREETMTDRVPVGGLRVARVLYDFITEEALPGTGLDPDSFWAGVDKVVTD
LTPKNQELLARRDELQAQIDKWHRHRVIEPVDTEAYRAFLTEIGYLLPEP
DDFTVTTADVDDEIAVQAGPQLVVPVLNARFALNAANARWGSLYDALYGT
DVISEDDGATKTPAGANSGYNPVRGDKVIAYARKFLDESVPLANGAWAEV
KSFAVDDARLVITLADGLETTVAAPAEFVGYLGDAEAPSSVLLIHHGLHI
EILIDPNSPIGATDAAGIKDVVLESAVTTIMDFEDSVAAVDAEDKVLGYR
NWLGLNRGDLAEEVSKDGKTFTRTLSGDREFSAPDGGTLTLPGRSLMFVR
NVGHLMTNDAIVFGAEGTDGAEGTDSREVFEGIQDALFTGLIAVHGLTAS
DDNGPLLNSRTGSIYIVKPKMHGPDEVAFTAELFSRVEDVLGLPQATLKI
GIMDEERRTTVNLRACIKAAVDRVVFINTGFLDRTGDEIHTSMEAGPMVR
KATMKSQPWILAYEDNNVDAGLATGLTGHAQIGKGMWAMTDLMADMVEQK
IGHPRAGASTAWVPSPTAATLHAMHYHQVDVFEVQRELAGKRRATIDQLL
TIPLSEGLAWAPDEIREEVDNNCQSILGYVVRWISQGVGCSKVPDIHDVA
LMEDRATLRISSQLLANWLRHGVITADDVQSSLERMAPAVDRQNAGDPTY
LPMAPDFDDSIAFAAARELILSGTTQPNGYTEPILHRRRREFKARAGR
333990567YP_004523181.1 hypothetical protein JDM601_1927 [Mycobacterium sp. JDM601]MQQLALRPYLTAGIAVAGAGIIAIAPVSPVSPALPAAGAQFHAVQLTDAW
SDLFTHTTANLNNISENADWSAITAVFGKLFTDPFGVISAFTSITPTVTT
DISELPASVSVQLPPGLELAIASMGAQALASQAISNAAADMANGDFSTLL
TAPASIADAYLNGAQNVSLLGGIINIPVLNGILAPEQNFEADLNLTKLLD
LLGLGNLDLGNLDLSGLVGDITLGNLLSELGISDDGLGDLLQGSGITNLG
GMLGFLGLGDLGLGSLSLTGILSGLGLDTNVSLNDLSLDDVLNVFGINGE
VSLGLGDLLGNLGFGGLLDSHLGDMLSNLGLLGPVADVLAELLKPVLGLL
NPLLQPVLDVLTGGGLEEALNTITLGDLLGGQTITESVSSLLGAFGVSLS
PDDLSIGGILEGLGFAPSTGELTLSGLLGGLGLGGLDITGLLNGLDLGDL
IGGLGLSDLELNLGDLIGDLTGLNLGELLDDLGLGNLDLADISVGSFGGM
VTLLVDVIPQQILDMLGA
333990565YP_004523179.1 regulatory protein [Mycobacterium sp. JDM601]MGEQPGQEQLDFAGPSESGSDGEVAATASGVGEPVQAGLFPDDSVPDELV
GYRGPSACQIAGITYRQLDYWARTSLVVPSIRGAAGSGSQRLYSFKDILV
LKIVKRLLDTGISLHNIRVAVDHLRERGVRDLANITLFSDGTTVYECTSA
EEVVDLLQGGQGVFGIAVSGAMRELTGVIADFPGERADGGESIAAPEDEL
ASRRKFRDRKTG
333990563YP_004523177.1 regulatory protein [Mycobacterium sp. JDM601]MSAPDSPEPAGMSIGAVLDLLRPEFPDVTISKIRFLEAEGLVTPQRSASG
YRRFSAYDCARLRFVLTAQRDQYLPLKVIKARLDAEPDGALPLAESPYSV
PRLVSAGDVAHSDTALPVPPRRVRLSREDLLERSGADDILLTALVRTGVI
TAGPGGFFDEHAVVIAQCARGLADYGVEPRHLRAFRSAADRQSDLIAQIA
GPLVKGGKAGARDRADDLAREVAALAIALHTALLKSAVHDVLHG
333990561YP_004523175.1 glycine cleavage system H protein GcvH [Mycobacterium sp. JDM601]MSSESNVPSDLYYTAEHEWVQRTGTDTVRVGITDFAQAALGDVVFVQLPE
VGADVTAGESFGEVESTKSVSDLFGPISAKVVAVNADLDASPQLVNSDPY
GAGWLVDLQAADGLDETLAGLLTPDAYRATLAE
333990559YP_004523173.1 hypothetical protein JDM601_1919 [Mycobacterium sp. JDM601]MIGIAALIAGIVLGLVFHPSVPEVVQPYLPIAVVAALDAVFGGLRAYLER
IFDAKVFVVSFVFNVLVAALIVYLGDQLGVGTQLSTAIIVVLGIRIFGNA
AALRRRLFGA
333990557YP_004523171.1 CDP-diacylglycerol--glycerol-3-phosphate 3- phosphatidyltransferaseMSAGAGSHRVQDRVLTVPNVISLARLGLIVVFGYLLLVAQADGLAAATLI
ISGISDWADGKLARVLDQSSALGALLDPAIDRLYMAAVPIAFGLRGLVPW
WIIGTLLARDLLLAAVLPVLRSRGLTALPVTYIGKAGTFALMSAFPLILL
GQWDAVGSRAVLSVGWAFLLWGLGMYLWAFVLYLIQVRLVVRTLPKITSR
GADV
333990555YP_004523169.1 drug-transport transmembrane ABC transporter ATP-binding protein [MMDSKLFNPSIDWSHALPDSLLWIAMAWSISAVCVVAVVVLLRMSTRWGRQ
FWEITGGYFTGRDSARVWLMLGVLLLSVITAVRLNVLFSFQGNDMYSSLQ
TAFQGAAGGDEAVKQSGVHGFWVSIGIFSLMAVLHVARVMLDIYLTQHFM
VNWRIWLTDRLTGDWLEGRAYYRARFVKTPLDPAVGEAVEGAIDNPDQRI
QQDIDIFTAGNGANPNAPANGTGGTLLFGAVQSMVTVVSFTAILWNLSGT
LTVLGVDIPRAMFLIVLLYVAIATVVAFWIGRPLIRLSFRNELTNAAFRY
ALVRVRDSAESIAFYRGEVAERLQLRERFGGIIDNYLKFVNRTIGFAGWN
LSVSQAIVPLPWVIQAPRLFSGQIMFGGVAQTATAFGNISDSLSFFRNAY
DNFAGYRASIIRLHGLVEANREARELPELLVKPSTDGTVVLEGVEVRSPA
GDPLVEALDVQLGIGDALMIAGPSGSGKTTLLRSLAQLWPYASGTLQRPD
ADNETVFISQLPYIPLGDLRTVVAYPLAPQEISDIALVDALGKVLLPHLI
NQLDNVEDWAKVLSPGEQQRVAFARLLLTRPKAVFLDESTSALDEGLELT
LYQLLRTELPDTIVVSVSHRHTVRQHHKQVLELLGRGRWELTPV
333990553YP_004523167.1 hypothetical protein JDM601_1913 [Mycobacterium sp. JDM601]MTPLPRPPVQIAWVTSDLDATESTLSALLGARKWVRMPGVHFTPDTCSYR
GEPADFVADIALSYAGDMQLELIAPVSGRSIYSEFLRDSGPGLHHICVEA
ADPADFAAMIEDAAAQGAGVVAQGVMPGGIRFGYVSAVQAGVPFVEIAYI
PAEIRAVFDYIKEQQR
333990551YP_004523165.1 mannose-binding lectin [Mycobacterium sp. JDM601]MAQSLGDTLTAGKKLVKGESLTSKNGAYTLTLQDDGNLVLAARGKAIWAS
GTNGKDVVRAEVQTDGNFVLYTADKPIWHTDTKGKKDVKLVLQDDRNLVL
YAADGAAWSTKTETDAPPPEEPKAEEAPAEAAPAEPAAPAARKYTVVSGD
TLFAIAERFYGDGNKYPQIAEASGIANPDLIHPGQELTIP
333990549YP_004523163.1 Mg2+ transport p-type ATPase C MgtC [Mycobacterium sp. JDM601]MQTLSVAEFTLRLAVGLGCGALIGLERQWRARMAGLRTNALVAAGATLFV
LYSVSAGDTSSTRVASYVVSGVGFLGGGVILREGFNVRGLNTAATLWCSA
AVGVLAAAGDVLFAVIGTGAIVGTHLLLRPLGRLIDRDQHIEEDEPQSPY
QVQVVCRPKSEKYLRAQIVQHTAGNDLVLRGIHTGPAGDDNMTLTATMLS
DNRAPERLERLVGELSLQPGVYAVQWHAEGQAALSPE
333990547YP_004523161.1 PPE family protein [Mycobacterium sp. JDM601]MDFAALPPEVNSGRLYAGPGSGPMLAAAAAWARLAAETGSAAGVYRSVLS
GLTGQWWLGPASESMAAAVAPYLAWLDSTAALAEQAAARATAAAAAFDEA
FAAVAPPPMIAANRSAQATLVASNVLGQNSAAIASLDVEYAQLWVQDALA
MYSYAAKSAAATALTPFAEPPPTTDPARQGGQAAAVAAATAASGHAELSR
LITAIPQALNGLAPAAAVAAASTQPAQTTTALSLAQIASYIEVLPKSIVP
FNAAIKTVLYGMVQYSRNLNIDLDIAAATGGQAGFGSGATSLVATELPQP
VGAGPVSAGAGGPGRIGRLSVPPNWVTTAPVAKMAAAALPGAAAAAAPAA
AVAGAQIPTGVFGDIALASLAARALTGAAPRSRPAAAMNGHAQSRLERLV
TELAGTTDVQHWHVDPSRLDSLLEELAEQPGVHAVHVNPDGQNNAGPGRQ
PG
333990545YP_004523159.1 PPE family protein [Mycobacterium sp. JDM601]MDFGALPPEINSGRMYAGPGSGPLLAAAAAWDALAAELSSTASSYNSVVT
SLAQVWSGPTAAAMAAAAQPYSGWMGSTAAQAAQSSAQARAAAAAYDAAF
IATVPPPLIEANRSLLLSLIATNILGQNTAAIAAAELEYAAMWAQDAAAM
YGYAGASANATTLAPFAQPPQTTNPAGLQAQSAAAGQAAAGTGAQTQSSL
TQLISLVPQALQGMAVSGTAQAEPTAILDFLAGPLSPISLFGIGGIPYLL
AIQCVLLPMNGANVVSAVNRAQGPKPWLEQPLPAQALAGARLAGAPMPAV
SAGSANSGSIGRLSVPQGWLAQTPTAKAVAAVFPEAGPEAVAAVAAESES
GLAGDLALGGLAGRAMSLTAAGAGGRGPGGVTGRAAAGKPGKPSKATIIV
IPPSAED
333990543YP_004523157.1 EsaT-6 like protein EsxP [Mycobacterium sp. JDM601]MATRFMTDPDAMRAMAGRFDVHAQTVEDEARRMWASSTNISGAGWGGLAE
RTSMDTMGQMQTAFRNIVNMLHGVRDGLIRDANHYEQQEAASQQILSS
333990541YP_004523155.1 hypothetical protein JDM601_1901 [Mycobacterium sp. JDM601]MTSPQSAATDARNAMVAGMLASGISVNGLQPSHNPQVALQMFTTATTIDP
SMCDAWLARVLAGDSDIEVLANAWATVRTFGWETRRLGLSDLEFHPEVSD
GMFLRLRITSVESLAAAYAAALAEAKRYEEAAKLLDGIEPRNPFETELVG
YVRGMLYFRTGRWPDVLKQFPAAAPWRQPELKAAAAAMATTALASLGVFE
EATRRAQEAIEGDRVPGATNVALYTQGMCMRHLGREDEAAELLRRVYSRD
AKFAPAREALDNLDYRLILTDPETIEARTDPWDPDSAPTREQAEAHRHAE
EAARYLAEGDAELAAMLGMEQAKREIKLIKATTKVNLARTKMGLPVPVTS
RHTLLLGPPGTGKTSVARAFTKQLCGLTVLRKPLVVETNRSKLLGRYMAD
AEKNTEELLEGALGGAVFFDEMHTLHERGYSQGDAYGNAIINTLLLYMEN
HRDELVVFGAGYANAMDKMLEVNQGLRRRFSTVIEFYSYTPPELLELTKM
MGAENEDVVTDEAVEGLLPSYTKFYADENYSEDGDLIRGIDVLGNAGFVR
NVVEKARDHRSFRLDDSELDAVLAGDVTEFSDEWLHKFKELTREDLAEGL
SAAVAEKKPS
333990539YP_004523153.1 proline rich membrane-anchored mycosin MycP5 [Mycobacterium sp. JDMMRRLQRTAAAGAAMIMMASGSLAGMPVAGAIERPGIDPGALPPDGPPGPP
QTMRQTSYCTEVGVLPDTDFRVQPAYMDMLNLPEAWKFSRGGGVSVAVID
TGVTPHPRMPNLIGGGDYVMAGGDGLSDCDAHGTLVASLIAALPDNGVTP
LPPPRQTRRPPSVPTNEPSPPPPVPQTTIMVMPPPPAPPPPPAEGEEPGN
GPPAQHPAPAPPPAPAPPPAPAPGPAPGPAPGPANGAASSTHTTDAGTVR
SAGSAGRARIAPVDFRAPKAPPPPGPAPDAFSGVAPDVQLISIRQNSQAF
GPKEPFGDGQDPQLREKTDGIRTMARAIVHAANMGAGVINISHAICMNVR
TLIDQADLGAAVRYAAVEKNAVIVAAAGDTSWRDCKQNPIYNAMRPDDPR
DWNGVNTVVTPAWYDEYVLTVGAVDSAGAPLGKTSVAGPWVSIAAPGTDI
EGLSPRDDGLMNAVDGPENSLLVPSGTGFSTAIVSGVAALVRAKYPELSS
HQVINRLIRTARPPARGVDNVVGYGIIDPVAALTWDVPDVAPQPPERLSA
PLQVPPMPPERDMTPAWVAGAGLLAAVAAAGVALGVAALRRSRRNR
333990537YP_004523151.1 hypothetical protein JDM601_1897 [Mycobacterium sp. JDM601]MDPSTRTDITVNVEGFWLLQALLDIRHVAPELRCRPYVSTDSNDWLSEHP
GMAVMREQGIVVDDQVNETVAARMKVLAAPDLEVVALLSLGKLRYGVIDD
EDQPPGTRDIPDNEFRVLLARRGEHWVSAVRVGTDITVDDVSVTDAASIA
ALVIDGMESIHHADPAQITAVNVPMEEMLEATQSWQDSGFNIFTGGDLRR
MGISAATVAALGQALSEPAAEAAVYARQYRDDAKGPSASVLSLKDGSGGR
IALYQQARTAGSGEAWLAICPATPQLVQVGVKTVLDTLPYGAWKTHRRV
333990535YP_004523149.1 EsaT-6 like protein EsxP [Mycobacterium sp. JDM601]MATRFMTDPDAMRAMAGRFDVHAQTVEDEARRMWASSTNISGAGWGGLAE
RTSMDTMGQMQTAFRNIVNMLHGVRDGLIRDANHYEQQEAASQQILSS
333990533YP_004523147.1 DNA translocase FtsK [Mycobacterium sp. JDM601]MKRGFARPTPERAPVVKPENIVLPTPLSVPPPEGKPWWLVVVGVLVVGLL
VGMVSMTVANGSRMFLGAGAIFPIFMIGGIAMMMFGGRFGGGAQQLSRPK
LDAMRAQFMLMLDRLRESAAESADSMDANYRWYHPAPSTLSAAVGSSRMW
ERQPNGKDLNFGLARVGVGMTRPEVTWGEPQNMPTDIELEPVTGKALQEF
GRYQSVVYNLPKMVSLLVEPWYSLVGDREHVLGLMRAIICQFAFSHGPDH
LRMVVVTSDVEQWDWVKWLPHFGDPRRQDAAGNARMVYGSVRDFATEHAD
LFSGRGSFMPRHASSSAETPTPHHLIVVDGVDPQWEYVNTTEGIDGVTFF
DLTGAPEWRGVSQRVLRFDDKGIINALPRDRDTWMVIDDNEWFFALADQL
SLTDAEQFAQRMAHWRLAEAYEEIGQRVTHHIGARDILSYYGIEDAGRID
FNQLWTSRQNEGSRARLRVPFGNRSDNGELLFLDMKSLDEGGDGPHGVMS
GTTGSGKSTLVRTVIESLLLGHSPDELQFVLADLKGGSAVKPFSGVPHVS
RIITDLEDDQALMERFLEAMWGEIARRKSMCDSAGVDGAKEYNEIRSRMA
ARGDHSLPPLPMLVVVIDEFYEWFRIMPTAVEVLDSIGRQGRAYWVHLMM
ASQTIESRAEKLMENMGYRLVLKAQTAGAAQAAGVPNAVNLPGKAGLGYF
RKSGEEVIRFQAEFLWRDYQRGGILDDEQLPQVHSIDYIRPQLFTTAFTP
LEVSVSGTELEAADEMPAITATPAEEPAAEEEDWIRIPKVGTVIIDQLRQ
IDFEPYRLWQPPLDDPVAVDDLVNRYLGHPWQENYGTRRDLVFPIGVIDR
PFKHDQPPWTVDTSGPGANVLILGAGGAGKTTALQTLISAAALTHTPEQV
QFYCLAYSGTALTTVATLPHVGSVCGPTDPDGVRRTVAELLALVRTRKRS
FLENDVASMDVFRRRKFDGAPGSVPNDGFGDVYLVVDNYRALSEDNEVLV
EQVNQIINQGPSFGVHVVVTADRESELRPPVRSGFGSRVELRLAAVEDAK
LVRSRFAKDVPVKPGRGMVAVNYVRLDSDPQSGLHTLIARPAMADTDHHV
FESDSVGAAVSQVAVGRVRPVRRLPARFGLDEVRAVAANDQREGVGAGGI
AWAISELDLQPVYLNFAENGHLMVTGRRESGKTTTLATIMSEIERLYAPG
SSTAPPTTQQSAQVWLIDPRRQLLTTLGSDYVEKFAYNMDGAVALINELA
ATLANREPPPGLSAEELLSRTWWSGPDIFLIIDDIQQFPPGFDSPFQKAA
PWVTRAADVGLHVIATRTFGGWSSAGSDPLLRALHQANAPLLVMDADPDE
GFIRGKMKGGPLPRGRGLLMAEDTGVFVQVAATELRRAPTQERTAAPVR
333990531YP_004523145.1 hypothetical protein JDM601_1891 [Mycobacterium sp. JDM601]MNYPTDVVDVELELEQGYRTEIHKNHDDTVDVETYGGGFDLSRRAIAPHL
RIGRDRWLNLLWLIPIGFVGLLTAIAAGKGIRNIPGVEEFIAEYPGSMPS
TKVESGLPAWLGWTHFFNLFMMMFIIRSGIQILCDHPRLYFSRNSTPGKD
EWLRVGPPVPDDPYWTANADTVALPRHFGLPGFRHSIGLARWWHLGLDVL
WLLNGAVFYVLLFSTDQWRRIIPTSWDVFPHAASVMIQYMSLNWPDDHTW
TNYNALQLISYFVTVFVAAPAAVITGLGMSPALSQRLGLISKHLRLNIQV
ARSLHFLVLVYFLMFILVHVTMVFATDAFDNLNHMFAARGCVEGAEPGCH
SATGFYVFCAAAAVCIVAWFAATPLTIKYPRVVQKVGFALIGPFQRSLEK
LNPKPGTFTEDDISPFHWRNGRLPETVEYKEHEASDFKDWRLKVYGLVEN
PMEFSLEDLKALPYHDQITQHFCVQAWSGVAKWGGVQMSTIMEIVKPLPE
AKWVVFYSMGLGATGGIYYNAHPVDQMWHHMSMLAYNMNDEPLPYMHGRP
LRLRNELQHGYKLVKWIKGIEFVASYKEIGSGHGGYSEDHKFFGRHQTI
333990529YP_004523143.1 C protein immunoglobulin-A-binding beta antigen [Mycobacterium sp. MVVAGIAVGAVATACGDCENDSDDGGYGEVTTAPSAPLAPMTPIAPDEAV
PEQTVVPEAPLTSAAPAVEHPAPQGGATPAPAPAAPRVPSAPAVPAVPAI
PAIPAIPAIPAIPAIPAIPHP
333990527YP_004523141.1 hypothetical protein JDM601_1886 [Mycobacterium sp. JDM601]MALIQQVSGTPYITGGDSPAGTDCSGLASWVSNVATGRPAFGDRFHTANE
ESALLARGFQYGTAPGALVVGWNRSHTAVTLPDGTPVSSGERGGVKIGGG
GAYQPQFTHHMYLPMPTEAPADEAAPVLFAAMMEPAPAPEPAAEPMGMDM
APPLDAPPPFEAPPPFEAPPPFQAPPAEAPPMDAPAFDEPPTEPGPEPIE
RDAPPQP
333990525YP_004523139.1 hypothetical protein JDM601_1885 [Mycobacterium sp. JDM601]MDDTAAVKLQPWIATAMAHTAPQVQITTLICAFAVLTYCALRDRPAIVCG
VLAAVCGPAIEIAIAAAGQFRYAADSDALLGVAPWLVPLYFAFGIVAALI
GEITAATRRTTP
333990523YP_004523137.1 hypothetical protein JDM601_1883 [Mycobacterium sp. JDM601]MNATTLLPALAATALAGLVGAASSAHADPLNPRDPDYCGNSADILLCAEQ
QSTYPNAGEMAYLNAIRGKFPPGSEAPRLAAGRTACLEFPKHPTSLIVEQ
VSVYLQVPKPTATGVVDAAHAEICPSVQRS
333990521YP_004523135.1 hypothetical protein JDM601_1881 [Mycobacterium sp. JDM601]MRLRRSQVGATGFRRVGRGRGFSYTDGNEPVDDPAVLARIKELAIPPAWR
NVWICPYPNGHIQAVGTDAAGRRQYLYHQQWQAERAEEKYDRVLNLARML
PQWRADLLADLGGRGLNRGRVLALAQQLIDRGYFRAGGEEYTQENGSFGL
ATLLRDHVRIRSDCVDFDYPAKSGVRRTVSVDDPLVVRAVRALLRAPTDI
PRLLVYRTPEGWCEVRADDLNERFRELTDVQFSVKDLRTWHGTVLAAENF
AAAREPTSKTVRRREIAAVMRCVSEELGNTPAVARGSYVDPRVVDAYEQG
MAIRAALNRVPPPPPREGVRPPGRRGERDRPIDPAYRPGTALNCTAGCGL
RRLGSIDASRDPRAPVRHAGRPARDRRYRLRR
333990519YP_004523133.1 metal-dependent hydrolase [Mycobacterium sp. JDM601]MQIHRGNIVFTPTPQDFVTLADGYVIVGDDGVIADCVAELPDRYAGAPVT
DHGDRLMLPGFTDAHVHACQLPITGLQGSTELIDWLHTLTFPQEAALRDA
VYADAVYGEFVECLLRNGITSSIVMGTIHADSTGILVDKLIAAGLRSCVA
KVSRDRNAPADSRVDTAQEIADSRAFIEQTLPKSPLITPAIGPSVAMVCS
RELMAGLAQQAREFGIPCHMHLAENPTEIEMTLQMHPDSADFVDIYQRAG
LMGTADTVVAHAIHLNDREKRVLRDTGILVAHCPHSNLNLLSGVMPLADY
HDTGVHVGLGSDVAAGHALNMFQNIVGAIQSGAVSYLAERTTRPVRAAEA
FYCATKGGGGFFGKTGSFEPGYAFDALVVDDSMWPRFKPMTLAQRVEKLI
YCGDDRNIERVYVYGRQVR
333990517YP_004523131.1 hypothetical protein JDM601_1877 [Mycobacterium sp. JDM601]MASLAVSAALIQAQGTQDAAPKPAETAEAAPAPAPPPPAGKIRLADPAEA
AALAANVPMPTEGQQFTFPLPAGVAPENGLQVKTIWAARTIGVLFQEIKT
IYGYRQDPLRWHPDGLAIDVMIPNYHSDAGILLGDQIAGYALANAKRWGV
NHVIWRQKIYPGVGGGNWTSDYGNETANHYDHVHIATNGGGYPTGQETYF
ITSMTPAPPD
333990515YP_004523129.1 ThiJ/PfpI family protein [Mycobacterium sp. JDM601]MTKHILNVVSNVAHYDDPAEPTGLWLSELTHAYQIFADAGYQQTIASPKG
GPSPLEPRSLKFPNFDKSAKAWHADAAKMALLAGTASPDEIDPADFDAIY
FTGGHAVMFDFPDSQGLQRITREIFERGGIVSSVCHGYCGLLNTRLSDGS
LLVSGRRLTGFAWVEEVLARVNKLVPYNAEAEMKKRGARYQKGLLPFASH
VVADGRLVTGQNPGSAKATAKKIVSVLGG
333990513YP_004523127.1 hypothetical protein JDM601_1873 [Mycobacterium sp. JDM601]MSETCPAADYAPMAPGCPVSTGGYDAPPVPLGPDSLTWKYFGQWTGLFQG
TWAGSMQNMHPQLGAAVKDHSIFFMERIPRLMRSIYPIGGVVFDGYRAPQ
TGAEVRDYHIGIKGVDEQGRRYNALNPDVFYWAHATFFKSTLLAAEKFAG
GLSEDDKRQLFDEHVAWYRMYGMSMRPVPKTWEEFQEYWDHMCNNVLENT
WAAREVMDLSTMPKHPSLQWIPDWLWELNLKVMQRFLTFMTVALYDPPVR
ELMGYTWSARQERVHGYLCKAITLVSKYGPKRALMHPRKRSALDRASGRL
PVDAPLVQTPARNLPPVEYRDSPHFYCPKVD
333990511YP_004523125.1 hypothetical protein JDM601_1871 [Mycobacterium sp. JDM601]MWLVTLVSHTRPCGSGLHRTQQVTVVHDGAQLGAEHQTVALLGPAAGGNG
GVGGGNGGHGGTSVGANGTGGAGGDGGYGSGNGGNGGAANGAGSVAGDGG
TGGAGNFGSILGGGSGGGPGGAGGNGGDATGDGSTAGNGGDGGTGGYGSA
LGSGGDGGIGGAGGKGGDATGDGSTAGNGGDGGNGGTSSTTSDGRNGGVG
GNGGDGGAAIGDHSSGGTGGNGGEGGISSLVGGGQDGGAGGNGGNGGAVS
GVNSVAGNGGTGGTGGITSPLSGGRDGGAGGNGSDGGVAEGEGSIAGAGG
KGGDGGIGGMLGGGRNGGVGGNGGNGGDGVDGAAASHGGAGGAGGAGGGV
GLNASGQGGTGGVGGNGGASDGGVGGAGGSGGDGASSSGFGGAGGGGGGG
GGAGTGGQGGDGGNGGNGGTGLTTGSDDAPRGTGGTGGTGGDADGGTGGV
GGNGGNGGSGDLGSAGGIGGDGGDGGQVGPNGNGAGGNGGNGGGNSREPG
GTGGNGGADGTPGTPGADGDATLNPVG
333990509YP_004523123.1 hypothetical protein JDM601_1869 [Mycobacterium sp. JDM601]MFDSPLSATASSISAWVGFTMFGLSVSPMTAAPLDAMLV
333990507YP_004523121.1 hypothetical protein JDM601_1867 [Mycobacterium sp. JDM601]MQIPFVEAMLGMVDRRPDPMHIPGATEDAVTDDVVDTADPGDAVLLLQKM
ENRLVRHSLRHPDVLSAEQLRRLRYLLNFARLGDFEPGAAGPGSSRGRGD
VSVGAELAPWRGKVTDALYGPLREERDRVIALTAARDALGALAADQDEQR
RQLIERHGDDFSACELDAEVGHKKLVTVLGGGGGAGFVYIGGMNALLEAG
PVPDYLIGSSFGSILGSVVSRTLPVPIEEYVAWAKTVSFRAILGPERLRR
RHGLTGVFSLNFDQFADAMFRREDGELMRMSDLAIPFDAVVAGVRRQPFA
ALPARYRNQRLAALQLRSFPYLPIGLGPQVATRLWQTAAFIDPRVVKPLV
IGGDDPDRDVNVVDAASFSSAIPGVLHHETKDPQTVPMFDALLADNDVGA
LVDGGAASNVPVELAWKRVRDGRLGTRNACYLAFDCFHPQWDPRHLWLVP
ITQAIQLQMVRNAPYADHLVRFSPTLSPVNLAPSAATIERACQWGRKSVQ
GAIPVVSALLEPVWWEGEKPAVVESEPAQPVQQKAAPMSTVMSALRRPRN
RWERWRNRDAI
333990505YP_004523119.1 GTP-binding protein EngA [Mycobacterium sp. JDM601]MSTSESDGTWFDETDWEIGEDGGFNENVEDSGPPPVVAVVGRPNVGKSTL
VNRILGRREAVVQDLPGVTRDRVSYDALWTGRRFVVQDTGGWEPDAKGLQ
QLVAEQAAVAMRTADAVILVVDTVVGATAGDEAAAKILRRSGKPVFLAAN
KVDSERAEADAAALWSLGLGEPFTVSALHGRGVADLLDEVVAKLPEVAEV
SAGSGGPRRVALVGKPNVGKSSLLNRLAGDERSVVHDVAGTTVDPVDSLI
EMDGKIWRFVDTAGLRRKVGQASGHEFYASVRTHGAIDAAEVVIVLVDSS
QPLTEQDQRVISMVVEAGRAVVLAYNKWDLVDEDRRYLLDKEIDRDMARL
AWAPRVNISAKTGRAVQKLVPALETSLASWDTRISTGQLNSWLKEVVAAT
PPPARSGRAPRILFATQATARPPTFVLFSTGFLEAGYRRFLERRLRETFG
FEGSPIRINVRVREKRGAKRTR
333990503YP_004523117.1 pseudouridylate synthase [Mycobacterium sp. JDM601]MAFSDFQPDAEGVRLQKVLSQAGVASRRVAEKMIRDGRVEVDGQVVTELG
TRVDPAASVIRVDGARVSVDDTRVYLALNKPRGVHSTMSDDRGRPCIGDY
VEHRVRGDAKLFHVGRLDADTEGLMLLTNDGELAHRLMHPSFRVPKTYVA
TVLGSVPRGLGKKLREGVELDDGPAKVDDFAVVDAVPGKSLVRVTLHEGR
KRIVRRMLAAVGFPVQELVRTDIGAVALGEQRPGTIRVLNRKEIGELYTA
VGL
333990501YP_004523115.1 hypothetical protein JDM601_1861 [Mycobacterium sp. JDM601]MSTDAQTDTETAATGFRVRLTNFEGPFDLLLQLIFAHRLDVTEVALHQVT
DDFIAYTREVGAQLELEETTAFLVIAATLLDLKAARLLPAGQVDDEEDLA
LLEVRDLLFARLLQYRAFKHVAQMFAELEAAALRSYPRAVSLEDGFANLL
PEVMLGVDAETFAQIAAAAFTPRPVPTVGTEHLHQVMVSVPEQAGVLLRL
LEARGTGQWASFSELVADCQAPIEIVGRFLALLELYRARAVAFDQSEPLG
VLQVSWTGERPSNEDLVKAESAE
333990499YP_004523113.1 hypothetical protein JDM601_1859 [Mycobacterium sp. JDM601]MERGCGSGMLRGGRPVKPTAELSSSLMAESAWSWRTSEEV
333990497YP_004523111.1 site-specific tyrosine recombinase XerD [Mycobacterium sp. JDM601]MTAAAQPVDPLSGQLQGYLDHLTVERGVAANTLSSYRRDLRRYSEHLLAR
GVDDLARAGESDVTDFLVALRRGDPENGIPALSAVSAGRALIAVRGLHRF
AAAEGMAPMDVARGVKPPTPGRRLPKSLTIDEVSALLAGAGGESVSDGPL
TLRNRALLEMLYSTGSRISEAVGLDLDDVDVSDRSVLLRGKGGKQRLVPV
GRPAVAALDAYLVRGRPDLARRGRGTAAVFLNARGGRLSRQSAWQVLQDA
AERAGITAKVSPHTLRHSFATHLLDGGADVRVVQELLGHASVSTTQIYTL
VTVNALREVWAGAHPRAR
333990495YP_004523109.1 CTP synthase [Mycobacterium sp. JDM601]MLPPLRKHPQTEPKHLFVTGGVASSLGKGLTASSLGQLLIARGLQVTMQK
LDPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRDLSGSANV
TTGQVYSTVIAKERRGEYLGDTVQVIPHITDEIKRRILAMSDPDADGRRP
DVVITEIGGTVGDIESQPFLEAARQVRHDVGRDNVFFLHVSLVPYLAPSG
ELKTKPTQHSVAALRSIGITPDALILRCDREVPEPLKNKIALMCDVDVDG
VISTPDAASIYDIPKVLHREELDAYVVRRLNLPFKDVDWTEWDELLRRVH
EPHETVRIALVGKYIDLSDAYLSVTEALRAGGFTHYAKVEINWIASDQCD
TPAGAAAALGEMHGVLIPGGFGIRGIEGKIGAIAYARTHGLPVLGLCLGL
QCIVIDAARTAGIAQASSAEFDPDTPDPVIATMADQQDAVAGTADLGGTM
RLGAYPAVLEADSIVAEAYQATEVSERHRHRFEVNNAYRDRIAQSGLRFS
GTSPDGKLVEFVEYPREMHPFLVGTQAHPELKSRPTRAHPLFAAFVGAAM
DYKAAERLPVEIPEQHHEQPADLQHRADGRGGSAQPLADPLQEALPEHVT
RG
333990493YP_004523107.1 hypothetical protein JDM601_1853 [Mycobacterium sp. JDM601]MKMSALLSRNTSRPGVIGTARVDHDIDRLLRRVGPGDIVVLDILDLDRIT
ADALVEAEIAGVVNASASISGRYPNLGPEVLVANGVTLIDEAGPTVFKKI
RDGAKIRLHNGAVYSGDRRLARGVERSDVEIADLMLEAKSGLVAHLESFA
GNTIEFIRSESPLLIDGIGIPEIDVDLRRRHVVLVGDEPDAADDLKCLKP
FIKEYQPVLIGIGSGADVLRKAGYRPQLIVGDPDQMSAEVLRCGSQVVLP
ADADGHAPGLERIQDLGVGAMTFPAAGSAMDLALLLADHHGAALLVTAGH
TANIETFFDRTRQLTNPSMFLTRLKVGEKLVAARAVATLYRSRISAGAIA
LLVLSMLLAVIVALWVSQTDALVLEWLSNYWHDLSQWLRHWVT
333990491YP_004523105.1 inorganic polyphosphate/ATP-NAD kinase PpnK [Mycobacterium sp. JDM6MNSGNGERTVLLVVHTGREEATDTARRVEKVLGDHGITLRVLTAEAVDKG
SLHLAPDDMRDLGVEIDVVDPDNRAAEGCELVLVLGGDGSFLRAAELART
ADIPVLGVNLGRIGFLAEAEADHIDGVLDHVIARDYRVEDRMTLDVVVRA
DGEIVDRGWALNEASMEKGPRLGVLGVVLEVDGRPVSTFGCDGVLVSTPT
GSTAYAFSAGGPVLWPDLDAILVVPNNAHALFARPMVTSPDSTIAIEVES
DGHNALVFCDGRRKMLVPAGGRLEVQRGGRPVKWARLGSSPFTDRLVRKF
RLPVTGWRGQ
333990489YP_004523103.1 hypothetical protein JDM601_1849 [Mycobacterium sp. JDM601]MNSEIDDVRERIAALLAELPGEAELAELPAHSDLNALAQRLEAAHEVLVA
ALESVEKG
333990487YP_004523101.1 tyrosyl-tRNA synthase TyrS [Mycobacterium sp. JDM601]MPTTILDELGWRGLIAQSTDLDALTAEVTGGPITVYAGFDPTAPSLHAGN
LVPLLALRRFQRAGHRPIVLAGGATGLIGDPRDTGERSLNSADTVAEWSG
RIRGQLERFVDFDNGPTGAVVVNNLDWTAPLSAVEFLRDVGKHFSVNVML
DRDTIRRRLDSEGISYTEFSYMLLQANDYVELYRRYGCALQIGGSDQWGN
IIAGVRLVRQKLGATVHALTVPLVTAADGTKFGKSTGGGSLWLDPEMTSP
YAWYQYFFNTADADVVRYLRWFTFLSADELEELEKATAERPHERSAQRRL
AREFTTLVHGEAATEAVELASQALFGRGELARLDEATLTAALQETPVAQL
APGSPDGIVDLLVATGLSASRGAARRTIGEGGVSVNNVRVDSEEWSPQPG
DFLHGRWLVVRRGKRNVAGVQRVQGG
333990485YP_004523099.1 antibiotic resistance ABC transporter efflux system ATP-binding proMMISSRDELSGARPIPAVDIEHLRVIRGKRPVLHDLSVRIAPGTITGLLG
PSGCGKTTLMRCIVGTQVITGGQVTVLGDAAGSAALRRRVGYMPQQATIY
DDLRVIDNVRYFASLAGVDASAADDAVDSVDLQRHRGDYCANLSGGQRAR
VSLACALVGRPDLLVLDEPTIGLDPVLRAELWHQFQALARRGTTLLVSSH
VMDEADHCGDLLLMRQGRLLARTTPRRLREETGCTSMEEAFLSVIRRSTA
PRAG
333990483YP_004523097.1 hypothetical protein JDM601_1842 [Mycobacterium sp. JDM601]MSTDASNRRPGRPSGSSDTRQRILSSARELFAHNGFQNTSIRAVAADAGV
DAALVHHYYGTKQQLFAAATELPVDPMVVLGPLREAPVEQLGRILPELLL
PLWDSQAGTGLIAAMRSMLTGTEVPLARSFFRDIVVAELASRIDVPAGTG
VLRAEFTASQLMGIVVARYIVGLEPLASLPGDQVVAMVAPTLQRYLTGDL
PDRLGR
333990481YP_004523095.1 long-chain acyl-CoA synthase [Mycobacterium sp. JDM601]MDLNLSAITRPVEWLMATAQNGLEVLRWGGLETGTVPSPYQIVESTPMYK
LRRYFPPDNRPGQPQPGPPVLLVHPMMMSANMWDVTREDGAVGILHGAGV
DPWVIDFGSPDEVEGGMRRNLADHIVGLSQAIDTIAETAGRDVHLAGYSQ
GGMFAYQAGAYRHSKSIASIIAFGSPVDTLAALPMGVPPNIASSVAGFMA
DHVFNRLDISGWQARVGFQMMDPLKTAKARMDFLRQLHDREALLPREAQR
RFLESEGWIAWSGPAISELLKQFIAHNRMMTGGFAINGQLVTLTDITCPV
LAFVGEVDDIGQPAAVRGIRRAAPDAKVFEYLLRAGHFGLVVGSKAAELT
WPTVADWVLWQEGQGPQPPGVALMAEQAPEDSKGGVAMTSRIAHGLGEAS
GVALTLARGAADAMVAAQKSMRTMAIETARTLPRLARLGQINDHTRISLG
RIIGEQAAESPHGEFLLFDGRVHTYEAVNKRIDNVVRGLIDVGVRQGVHV
GVLMATRPSAMVAIAALSRLGAVAVLMPPDGDLGAAARLGGISEIITDPG
NLDLALAAVRDLGCQVLVLGGGETRDLDLPADAEAVIDMEQIDPDAVDLP
GWYRPNPGFARDLAFVAFSTVAGELVAKQITNYRWALSAFGTASTAALGP
TDTLYCLTPLHHESGLLVSLGGAVVGGARIALSRGLNPDRFVAEVRQYGV
SVVSYTWAMLREVIDDPNFVLQGNHPVRLFIGSGMPVGLWRRVTEAFAPA
QVVEFFATTDGQAVLANVSGAKVGSKGRPLPGAVEVELAAYDPDQDLILE
DERGFVRKAETNEVGVLLAKPRGPIDPSASVKRGVFAPADTWISTEYLFR
RDADGDYWLAGGRGSSIHTGRGMAYPVLITDALGIVTGVDLAVTYRVTAG
SGDDLVVSAVTVRPGATVTAADLSEAVAELPVGAGPDVVHVVPDLPLSAV
YRPTLGELREAGLPKAGRNAWYFDAASGQFKRLTAAVRAELAGGRQ
333990479YP_004523093.1 hypothetical protein JDM601_1839 [Mycobacterium sp. JDM601]MWRLLTAIVVCGLLPQCTGAPEPTPSSAAVTQPEPAAVAPVTAAELGTTW
RPGCPVAPAQLRRVTLTHLGFDARPHRGELIVHQELVPQVIAIFERLYRL
DFPIEKMRPAAHYRGGDDELSMADNNTSAFNCRRIPGSGNWAQHAYGRAI
DINPLLNPSVTRHGFEPKNAAVYLDRHRIEPGLLHPGDPAVRAFTDAGWR
WGGDWKSPVDYQHFERR
333990477YP_004523091.1 argininosuccinate lyase ArgH [Mycobacterium sp. JDM601]MSTNEGSLWGGRFAEGPSDALAALSKSTHFDWVLAPYDIAASKAHAKVLH
GAGLLTDEQRDGLLAGLDSLGEDVADGSFGPLVTDEDVHGALERGLIDRV
GAELGGRLRAGRSRNDQVATLFRMWLRDAVRRVAAGVLDVVDALAHQAAA
HPDAVMPGKTHLQSAQPVLLAHHLLAHAHPLLRDVGRIVDFDARAAVSPY
GSGALAGSSLGLNPDAIAAELGFDAAADNSIDATAARDFAAEAAFVFAMI
AVDLSRLAEDIILWSSTEFGYAVLHDSWSTGSSIMPQKKNPDIAELARGK
SGRLIGNLTGLLATLKAQPLAYNRDLQEDKEPVFDSAAQLELLLPAMAGL
VGTLAFDTERMAVLAPAGYTLATDIAEWLVRQGVPFRIAHEAAGAAVRAA
EQRGVGLDELTDAELAAISPDLTPQVREVLTVAGSVASRDARGGTAPARV
AEQLAGLRERAARQRRWVGG
333990475YP_004523089.1 arginine repressor ArgR [Mycobacterium sp. JDM601]MVAGTVTMSRADSPITRVGRQARIVEVLSAEPVRSQTELAALLAADGIEV
TQATLSRDLEELGAVKLRGPDGGVGGYVIPEDGNPLRMAGGTDRLCRLLG
ELLVSTDATGNLAVLRTPPGAADYLASAIDRAALPYVVGTIAGDDTIFVA
AREPMTGAELAAALNDLQ
333990473YP_004523087.1 acetylornithine aminotransferase ArgD [Mycobacterium sp. JDM601]MSLQDRWSAVMMNNYGTPPLALVSGQGAVVTDEAGKDYLDLLGGIAVNLL
GHRHPAVIEAVTTQLNTLGHTSNLYATEPGVALAEGLVDQLGAPARVFFC
NSGAEANEAAFKLTRLTGKTKIVAADGAFHGRTMGSLALTGQPDKRAPFE
PLPGDITHVPYGDTKALAEAVDSATAAVFLEPIMGEGGVVVPPAGYLAEA
RGITAAYGALLVFDEVQTGVGRTGAFYAHQHDGITPDIVTLAKGLGGGLP
IGACLAVGAAADLLTPGSHGSTFGGNPVCTAAALAVLRALADGDLVARAG
VLGKTLSHGIEELHHPLIDHVRGKGLLLGVVLTAPKAKDVELAAREAGFL
VNAAAPDVVRLAPPLIISEAQLDGFLTALPGVLDTAQEAAHA
333990471YP_004523085.1 glutamate N-acetyltransferase ArgJ [Mycobacterium sp. JDM601]MTRILREQGVTAPAGFRAAGIAAGIKASGAPDLALVFNEGPDYAAAGVFT
SNQVKAAPVLWSQQVLKSCRLRAVILNSGGANACTGPGGFQDTHATAEAV
AAALSEWGTETGAVEVAVCSTGLIGDRLPMDKLLAGVTDVVQEMAGGLVG
GDEAARAIMTTDTVAKQVALHHDDNWTLGGMAKGAGMLAPSLATMLVVLT
TDAKADAAALDTALRRAAALTFDRLDIDGSCSTNDTVLLLSSGASEITPS
QDELDAAVLAACEDLCAQLQADAEGVTKRVTITVTGAGNDDDALLAARLV
ARDSLVKTALFGSDPNWGRVLAAVGMVPFAIDPDRITVAFNGSPVFSDGL
PMPGAREVDLSGPDIDVTVELNQGSGQATVRTTDLSHAYVEENSAYSS
333990469YP_004523083.1 dihydrolipoamide dehydrogenase [Mycobacterium sp. JDM601]MNEPETFDVVVLGAGPVGENVADRARAAGLTVAIVERELAGGECSYWACV
PSKALLRPVLALADARRVAGAREAVSSPIDAAGVFGRRNDFVGDWDDTGQ
VDWINGIGATLVRGHGRLDGPRRVVVTTPGGDTVELAARHAVVICTGTRA
ALPELPGIAEARPWTNREATEAMSVPGRIAVVGAGGVGVEMATAWQCLGS
AVTMLVRGSGLLARMEPFVGEYVARGLAEAGVDVRTGVSVARLGRDGDGP
VRLELTDGGELEVDEVLFATGRSPATGDIGLDTVGLNPGDWLQVDDTCRV
QAVDDGWLYACGDVNHRALLTHEGKYQARITGDAIGARATGAPLDTADWG
AHAATADHHAVPQVFFTDPEAAAVGLTAEQAQQAGQRVQVVDVEIGEAVT
GAKLHADGYRGRARMVVDAEHEYLLGATFVGPGVADLLHSATIAVAGRVP
VSRLWHAVPCFPTISEVWLRLLEAYRDSASVQAPS
333990467YP_004523081.1 phenylalanyl-tRNA synthetase subunit alpha PheS [Mycobacterium sp. MGDQPVDPSVVSDATLNAALQAAQHGFTAAADLDALAHAKTEHLGDKAPL
ALARQALAKLDKADRADAGKRVNAARTQAQQAYDERLAALRAERDAAVLA
AESIDVTLPSARRPVGARHPITQLAEHVADTFVAMGWEVVEGPEVEAEHF
NFDALNFPVDHPARSDQDTFHIAPPGSRQLLRTHTSPVQIRALLARELPV
YVVSIGRTFRTDELDATHTPVFHQVEGLAVDRGLTMAHLRGTLDAFAQSE
FGPATRTRFRPHFFPFTEPSAEVDIWFEGKKGGPGWVEWGGCGMVHPNVL
RAVGIDPDEYSGFAFGMGLERTLQFRNGIPDMRDMVEGDVRFSLPFGVGA
333990465YP_004523079.1 hypothetical protein JDM601_1825 [Mycobacterium sp. JDM601]MDLEPVGRQADELEEVVEIPEHAPSSRRRSFSLDDAAAWLNRTTNDVRVV
DLVRRVRRALPGDPEFGDPLSTAGDGGPQAAARAAGRLMGDRSAASREVS
LGALQIWQALTERISRAPTNAEATLVFTDLVGFSTWSLRSGDDATLTLLR
RVSQAVEPPLLDAGGRIVKRMGDGIMAVFREPLIAVGAVLEAQDAIATVE
VNGFTPRMRAGIHTGRPQRLADDWLGVDVNIAARVMERAVKGGIVVSGAT
LERIEPGDLEELGVTAKRARRQVLSAKTSGVPADLMMYRLKAVRREPPAS
D
333990463YP_004523077.1 23S rRNA methyltransferase [Mycobacterium sp. JDM601]MLTERSARVVAAVKLHRHVARKREQRFLAEGPNLVEAAIRRGLAVEVFAT
ESAAQRHGELLASVRAPVHQVSDRAAKALSDTVTPAGLVAVCTVPEPDLG
GLLADAPHLVAVAVGIGEPGNAGTLIRIADATGASLVVLTGNSVDPYNGK
CLRASAGSVFNVPVVVAADTDAVLAALRESGLQLLATALDGDLSLDDADP
VLTAPTAWLFGPESHGLPAAVAAAADHRVHIPMSGGAESLNVAAAAAICL
YQSARAQRGARS
333990461YP_004523075.1 50S ribosomal protein L35 [Mycobacterium sp. JDM601]MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPSTRTRRLAGRTEV
AAADAKRVNKMLNG
333990459YP_004523073.1 hypothetical protein JDM601_1819 [Mycobacterium sp. JDM601]MFARHANPWSAWSRWATTPLILVPVWRRSWRDAAWVSVWFALNPVIFGEP
TDQAAWSTRAMLGEEQWVTDRPRDAALLVNLAGSAATTWALLSARRRRLL
PTVAATAAAMTLTMGYWALMVRYFDRRRYRGEHG
333990457YP_004523071.1 hypothetical protein JDM601_1817 [Mycobacterium sp. JDM601]MRAFTIAERRNRLARRHFLAPETATEPITQIAATLIGLHATDPATPYLSL
WARSSPFSVADLDSALYEKRSLIKQLAMRRTLWVVDPAELPAVQAAAGDR
VADTERRRLIADVAKAGVADDGARWLARAGAAVLRHLEEHGPASSTELRA
ALPELAGTYDPAPGKAYGGQTHLAPRALTVLGAQGDIVRGPNDASWTSSR
PRWAAAADWLGEPGEPISAEEAQARLVATWLRAFGPATADDIKWWFGTTK
TAVRKALSGIGAVDVDLHGTPGYALPDDLEPEPEPEPWGALLPGLDVTTM
GWYHRDWYLGEHRGQLFDNYGNAGPTVWWNGRIVGGWCQNAAAQVQLQLL
EDPGRPARQVLERRAKQLTAWLDGTRIAPRFPSPLVKALR
333990455YP_004523069.1 hypothetical protein JDM601_1815 [Mycobacterium sp. JDM601]MIVVADTSGLVAAFNAGDPEHRAAREALIGAALTVVSPLVLLEIEHVTTR
NVSRSAALAINDWLLAQERTGRVVIATVTAPTLRIARTVQNRYAALRLDL
TDAVSVVVAEQYETDAVLTLDRRDFRAIAPLNGAPAFRLLPDDR
333990453YP_004523067.1 hypothetical protein JDM601_1813 [Mycobacterium sp. JDM601]MTPKTSVDDTYTGHVEPGTAARRTLPGATIIKTSVGPMDNNAYLVTCTNT
GKTLLIDAANDAETLRALVRDHAPEVALIVTSHQHFDHWQALAELVAATG
APTAAHALDAEPLPVTPDRLLADGDTVTVGDLTFDVIHLQGHTEGSVALA
LDGAATGGITQLFTGDCLFPGGVGKTWQPGDFERLLGDVSAKVFDRFGDD
TVVYPGHGDDTTLGTERPHLAEWRERGW
333990451YP_004523065.1 transmembrane protein [Mycobacterium sp. JDM601]MSLVLDRAPVSTAAGSPRRLGRPPDAVLIAVVATLISGIGASRPSLWFDE
SATISASTHRSLPELWQLLTHIDAVHGLYYLFMHGWLAVFPATEFWARAP
SCLAVGTGAAGVVVLCRRFAGWQVSVCAGVLYAVLPRVTWAGVEARPYAF
AAASAVWLTVLWVSAARRNTPALWPGYGAAVVASTLLNTFTVLMVAVHAV
GLRACGCDRSVKRRFAGAAGIALAVLAPFLWFSRQQIWQVAWIRPVNAHT
VIEIAQQQFFDNSVPFAISAWLLIAGAAVAVRAGIRPAPAGELRQLVSLC
VAWLVIPTVATVAYSVMVKPVYYPRYLISTAPAMAITLALALNIAVITLA
RPRRAIIGALTVLIIAAAPNYVANQRDRYTKEGWDYSAVADVIDAHARPG
DCLLIDNTTRWLPGPIRALPAGRAETFAKLRDPGRGPHRQQLGRLWDGHL
AVWALTDQLAGCPTIWTITDHDRSLPAHQVAVKLPSGTRFARTPDGQVLR
QLGFHVVERWQFTFSQVIKATR
333990449YP_004523063.1 excinuclease ABC subunit B [Mycobacterium sp. JDM601]MAFATEHPVVAHSEYRPPADAVEGIVRAGGRFEVVSDYQPAGDQPTAIAE
LDRRITAGEKDVVLLGATGTGKSATAAWLIERLQRPTLVMAPNKTLAAQL
ANELREMLPHNAVEYFVSYYDYYQPEAYIAQTDTYIEKDSSINDDVERLR
HSATSSLLSRRDVVVVASVSCIYGLGTPQSYLDRSVELQVGSEVPRDGLL
RLLVDVQYTRNDMAFTRGSFRVRGDTVEIIPSYEELAVRIEYFGDEIEAL
YYLHPLTGDVVRKVDSLRIFPATHYVAGPERMTQAISTIEEELAVRLDEL
ERHGKLLEAQRLRMRTNYDIEMMRQVGFCSGIENYSRHIDGRGAGSPPAT
LLDYFPEDFLLIIDESHVTVPQIGGMYEGDMSRKRNLVEFGFRLPSACDN
RPLTWEEFADRIGQTVYMSATPGPYELSQAAGEFVEQVIRPTGLVDPKVV
VKPTKGQIDDLIGEIRQRAEADERVLVTTLTKKMAEDLTDYLLEMGIRVR
YLHSEVDTLRRVELLRQLRLGDYDVLIGINLLREGLDLPEVSLVSILDAD
KEGFLRSTRSLIQTIGRAARNVSGEVHMYADKITDSMREAIDETERRRAK
QIAYNEANGIDPQPLRKKIADILDQVYREAADSETVEVAGSGRNASRGRR
AQGAPGRAGQSVSAGVFEGRDTKSMPRAELADLIKDLTEQMMNAARDLQF
ELAARIRDEIADLKKELRGMDAAGIK
333990447YP_004523061.1 hypothetical protein JDM601_1807 [Mycobacterium sp. JDM601]MNANLRIGVATATTAALLGCGQLIPATAAADELHNVTYIARVDAWTTGSV
VTFMLNDYQTASGDIDGFGAPFQANAVLSDPSKAGMVIRLRWPSSANVHC
EIHVDDIVAVKSDRFVTTWKDSSDPRNGAMLCGALISSMA
333990445YP_004523059.1 30S ribosomal protein S1 [Mycobacterium sp. JDM601]MPSPTVTSPQVAVNDIGSAEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPSRELSIKHDVDPHEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEELKEKDEAVKGTVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGREIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAVRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGDEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAEQHVEVPDQVVAVGDDAMVKVID
IDLDRRRISLSLKQANEDYTEEFDPSKYGMADSYDEQGNYIFPEGFDAET
NEWIEGFDKQRAEWEARYAEAERRHKMHTAQIEKFAAAEHAEPRSGANGS
HRDEAPAGGSLASDEQLAALREKLAGNSA
333990443YP_004523057.1 hypothetical protein JDM601_1803 [Mycobacterium sp. JDM601]MLVFGLLAAGPVQAAPERPLRPERYDACTVPIVAPLEPVADGSGSATRGP
GQEGCAPAASPSPEPEFRPVEHPCGTYSNANGVFDLVVVRGDARCDEARS
VFERFDAAQPTDPFFCADESADIRAARGVVRFCCSEGARYELRVIH
333990441YP_004523055.1 hypothetical protein JDM601_1801 [Mycobacterium sp. JDM601]MHPVGAAVGAGEIATRFSFAVVVRYADLVPDVASQPAIDGWYATDDAGLP
HLIGAKCPQCGTYVFPPRENNCPSPACDGDVLEPVALSRRGTIWSYTENR
YLPPAPYPPSEPFEPFAIAAVELADEGLIVLGKVVEGTLAADLKVGMEME
LTTMPLYTDDEGVTRTVYAWKKVGA
333990439YP_004523053.1 hypothetical protein JDM601_1799 [Mycobacterium sp. JDM601]MKIVDANVLLYAVNTAAEHHDASLRWLDRALSGADTVGFAWVPLLAFVRL
STKEGLFPHPLRPEDAVDRVAEWTAASSAVVVNPTPRHADILTGLLARVG
AGGNLVNDAHLAALAIEHRGGIVSYDADFGRFGIRWDRPDDLA
333990437YP_004523051.1 hypothetical protein JDM601_1797 [Mycobacterium sp. JDM601]MSQSETVVVKVKPGSRKGPLVETDDDGQLTVYVREPAVDGKANAAVIRLL
AQYFEVPRSRVELASGAAARVKRFRIGR
333990435YP_004523049.1 proteasome subunit beta [Mycobacterium sp. JDM601]MPSSPVDLSSFSDFLRRQAPDLLPAGSAGLSSAGTAELPHGTTIVALKYP
GGVVMAGDRRSTQGNMIAGRDVQKVYITDDYTATGIAGTAAIAVEFARLY
AVELEHYEKLEGVPLTFAGKVNRLAIMVRGNLGAAMQGLLALPLLVAYDI
DDPDGQHAGRIVSFDAAGGWNVEEEGYQAVGSGSLFAKSSMKKLYAQVAD
ADSALRVAVEALYDAADDDSATGGPDLVRGIYPTAVSIDADGAVDVPESR
IAELAREIIESRTRGGDSAAKTKRGKK
333990433YP_004523047.1 hypothetical protein JDM601_1793 [Mycobacterium sp. JDM601]MSSLLQIRNVPDAVRRELKARAAIQGQSLNAYLLDLISREVNRPTVAEVL
QRAAQRAEHASGSAIDVVDADRIERDAQLAGPRR
333990431YP_004523045.1 hypothetical protein JDM601_1791 [Mycobacterium sp. JDM601]MQRIIGTEVEYGIASPSDPTANPILTSTQAVLAYAAAAGIPRAKRTRWDY
EVESPLRDARGFDLSRSSGPPPIIDADEVGAANMILTNGARLYVDHAHPE
YSAPEVTDPLDAVIWDKAGERVMEAAARHVASVPGAAKLQLYKNNIDNKG
ASYGTHENYLMSRQTPFSAIIAGLTPFFVSRQVVTGSGRVGLGPAGDEPG
FQLSQRADYIEVEVGLETTLKRGIINTRDEPHADADKYRRLHVIIGDANL
AETSTYLKLGTTALVLDLIEEGPEHGIDLSDLALARPVRAVHVISRDPTL
RATVALADGREMTGLALQRIYLDRAAKLVDARDPDARATDIIETWARVLD
QLERDPMECADLLDWPAKLRLLEGFRQRENLSWSAPRLHLIDLQYSDVRL
DKGLYNRLVARGSMKRLITEQQVLDAVDNPPTDTRAYFRGECLRRFGADI
AAASWDSVIFDLGGESLVRIPTLEPLRGSKAHVGALLDSVDSAAELVEQL
TT
333990429YP_004523043.1 hypothetical protein JDM601_1789 [Mycobacterium sp. JDM601]MATLDSMRLRFFPFDDEAASSAVRDTLLDDVVLGEHLTDRKLAKAARKAA
MRRRSWMADRR
333990427YP_004523041.1 hypothetical protein JDM601_1787 [Mycobacterium sp. JDM601]MATTQTATGQNLSVAARRPGPLQVMALGRVILAAVSLATPRQFARALGVT
PSPELTYMTRIYGARAFAMGLGYLTSGARERYRWKRLSLAVDTIDTVNGL
SHLVRGDLPLRAALGMVALTGSYAAIGATNVAAEFATSS
333990425YP_004523039.1 hypothetical protein JDM601_1785 [Mycobacterium sp. JDM601]MTPQVQLTVWGAPLPLEPPAAIPAPEQLTDVLNTLADPGIPAAGKSHLIE
GGLGPVESSVMDRKMAKGVANGKFPLSISVANIAPAGPGAATADVTASGP
QLEPRSVNLMFVDQGGWKLSKTSLMTLSQMTSSN
333990423YP_004523037.1 hypothetical protein JDM601_1783 [Mycobacterium sp. JDM601]MWVGWLEFDLLLGDVHSLKQKRSVVRPIVAELRRKFNVSAAETDSVDLHR
RSGIGLAAVSGERRHVVEVLDAAERLVAARPEIELLSVRRGLSRSDD
333990421YP_004523035.1 RNA methyltransferase [Mycobacterium sp. JDM601]MSESGIFQAGDRAQFTDAKGRRYTTVLVPGGDFHTHRGAIPHDEVIGLPD
GSVVKSANGDPFLVLRPLLVDYVMSMPRGAQVIYPKDSAQIIHEGDIFPG
ARVLEAGAGSGALTLSLLRAVGPQGRVVSYELRDDHAEHARRNVETFVGQ
LPDNWRLVMGDVADCDLPDGSIDRVVLDMLAPWDVLDVVSRVLIPGGVLV
IYVATVTQLSQVNEALREQQCWTEPRSWETMQRGWNVVGLAVRPQHAMRG
HTAFLVCARRLAPGTVTPTRLGRKRPV
333990419YP_004523033.1 hypothetical protein JDM601_1779 [Mycobacterium sp. JDM601]MTHFLVLLLALLIGVVAGLRALTAPAVMAWAAALHWINLDGTWAQWLSHP
ATVTILTVLAVGELVTDQLPKTPNRTVPLQFTARIVLGGFAGAVLGTAWN
YTWTALGAGMIGAVIGTLVGFAVRQRLVAVSGGRDLPIALLEDSVAVLGG
IAIAAYTAVL
333990417YP_004523031.1 phosphoribosyl-AMP pyrophosphatase HisE [Mycobacterium sp. JDM601]MKTFEELFAELGDRAATRPAGSATVAALDAGVHTIGKKILEEAGEVWLAA
EHESDDALAGEISQLLYWTQVLMISRGLTLSDVYRKL
333990415YP_004523029.1 5-methyltetrahydrofolate--homocysteine methyltransferase [MycobacteMTNFEPNIQPDCTEELTAALRRRIVVIDGAMGTAIQRDRPDEAGYRGERF
SEWPTPLQGNNDLLTLTQPEIIEGIHREYLEAGADILETNTFNANAISLS
DYDMADLSYELNYAGAALARKAADEYSTGDKPRYVAGTIGPTTRTASISP
DVNDPGARNVSYDQLVAAYLEAANGLVDGGADIILIETIFDSLNAKAAVF
AVETLFEERGRRWPVIISGTITDASGRTLSGQVTEAFWNSIRHARPIAVG
LNCALGAPEMRPYIAEMARIADTHVSCYPNAGLPNAFGEYDEDPERQASY
IAEFAEAGLVNLVGGCCGTAPEHIAEIAKVVEGKPPRELPTIEVATRLAG
LEPLNITDDSLFVNIGERTNITGSARFRNLIKAEDYDTALSVALQQVEVG
AQVIDINMDEGMIDGVAAMDRFTKLIASEPDISRVPVMIDSSKWEVIEAG
LKNVQGKPIVNSISMKEGEEKFIREARLCRKYGAAVVVMAFDEQGQADNL
ERRKEICGRAYRVLTEQVGFPAEDIIFDPNCFALATGIEEHATYGIDFIE
ACAWIKENLPGVHISGGISNVSFSFRGNNPVREAIHAVFLYHAIKAGLDM
GIVNAGALVPYDSIDSELRERIEDVVLNRRPDAAERLLEIAERFNSSGEG
TRDADLAEWRNLPARERITHALVKGIDAHVDEDTEELRAEIAAAGGRPIE
VIEGPLMDGMNVVGDLFGAGKMFLPQVVKSARVMKKAVAYLLPYIEAEKQ
PGEDDHTNGTIVMATVKGDVHDIGKNIVGVVLQCNNYTVVDLGVMVPAEK
ILTAAREYDADMIGLSGLITPSLEEMAGFAAEMEREGLEIPLLIGGATTS
SAHTAVKIAPRRSAPVIWVKDASRSVPVVAALLDDKQRPALLESTAADYA
SLRERHAQKNERPMVPLEKARANRTPIEWDGYTPPVPVIGTGVWEFLDYD
LAELREYIDWQPFFNAWEMKGRFPDILNNPASGEAARKLYNEAQQMLDTA
IEEKWLTANAVIGFFPANAVGDDVEVYTDDTRTEVLTMFHNLRQQGAHRP
GIPNRSLGDYIAPKETGLADYIGAFAVTAGLGSGEKIAEFKEALDDYSAI
LLESVADRLAEAFAERMHQRVRKEFWGFQPDEALDNDALIAEKYQGIRPA
PGYPACPEHTEKATIWKLMDVQERTRIELTDSMAMWPGAAVSGLYFSHPQ
SQYFVIGRLAQDQVADYAKRKGWTLAEAERWLGSNLGYNPED
333990413YP_004523027.1 dehydrogenase [Mycobacterium sp. JDM601]MVAIHSQVIFITGGAHGIGADTARRLHAQGAKLVLTDLDQAQLTAFADEL
GGDRVLTVAADVRDLDAMQAAADAAVERFGRIDTVVANAGIASYGSLLAV
DPEAFRRVIDVNLVGVFNTVRATLPAIVERRGYVLIVSSLAAFAAAPGMI
PYDASKAGVEHLANALRLEVAHLGVTVGSAHMSWIDTALVRDTKSDLSTF
GELLAKLPWPLNKTTSVAECVDAFVDGIENRRTRVYCPRWVGLFRWLKPL
LSSGVAEGQIGKVAAEMLPRMDAEVAALGRSTSAYNEAIEK
333990411YP_004523025.1 monophosphatase CysQ [Mycobacterium sp. JDM601]MTLTDAALAAELAVEAGKLLLKVRDEVGFGHPWRLGDAGDALANRLILSR
LREVRPDDAVLSEESPDDLARLRADRVWIIDPLDGTREFTTPGRDDWAVH
IALWQRDGSGPGAITDAAVSLPAYDNRSNVVFATDTVTANASPAGVPNPI
RVAVSATRMPAVVRIIREVLPVEPVLMGSAGAKAMAVVRGDVDAYLHAGG
QWEWDSAAPAGVVRAAGLHASRLDGSPLLYNRPDPYLPDLLMCRPEVAPT
LLDAMRRTLL
333990409YP_004523023.1 hypothetical protein JDM601_1769 [Mycobacterium sp. JDM601]MSRAIHVFRTPDRFVAGTVGQPGNRTFYLQAVHDERVVSVVLEKQQVAVL
AERIGALLLEVNRRFGTPVPPEPTEIEDLNPLVTPVDAEFRVGTMGLGWD
SEAQTVVVELLAVSDTEFDASVVLDDTEEGPDAVRVFLTPESARQFATRS
NRVISAGRPPCPLCDEPLDPAGHICVRTNGYRRGAFGPDDEPDDSDL
333990407YP_004523021.1 transmembrane protein [Mycobacterium sp. JDM601]MSVVEAAMSWPQVIVLAIVQGLTEFLPVSSSGHLALVSRAFFAGDAGASF
TAVTQLGTEVAVLVYFAKDIGRIATAWLSGVASALTRTPLAADRQVDYRM
GWYVIIGTIPICVLGLVFTDQIRSGVRNLWVVATALVVFSAVIAAAEYLG
RQTRHAKQLTWRDAVLVGSAQTLALVPGVSRSGATISAGLFAGLDRELAA
RFGFLLAIPAVFASGLFSLPDAFHPAGTGMSASGPQLLVATLIAFGVGWA
AVAWFLRFLVSHSMYWFVGYRVVVGTTILVLLATGVLAAQS
333990405YP_004523019.1 dioxygenase [Mycobacterium sp. JDM601]MTGEFDAGANCGDHPYATWDAAYVLGSLSSADRREFEGHLDRCSSCRSAV
AELAPIPRLLSLLSRDDLAALEAGRALPARRVPAPSGNGSRPPGTGETAQ
PVETVMPFFRTRNYAPVPDEQTAFGLPVEGAIPPELTGWYLRNGPNPRTA
TGHWCIGDGMVHGIRLERGRAAWYRNRWVHTDSFERPFPVYGAGGRRNLR
SSVANTHVVRHAGKTLALMETSLPYQITNDLKTLGAYDFGGKLADAMNAH
PKICPDTGELHFFGYGSLVQPHVTYHRADAAGELILSRPIDVPALTLMHD
FALTARHIVFLDLPVLFDLSLALTMDVGQDLPYRWDDSYGARLGVLRRDD
PYGAVRWFEVDPCYVFHIANAYDVTSADGDSIVLQVIRYPELWRDDSAFD
DAATLWRWTIDLADGSVEQTQLDDRGVEFPRIDDRRSGRRARYAVTVGTN
TLVRYDLDNGSAEEHRFVSDGVRGTADEAIFVAADGGPDDELAGWYLSYV
YDPARDASDLVIIDAADFAGDPVARIRLPRRVPHGFHGNWLRD
333990403YP_004523017.1 hypothetical protein JDM601_1763 [Mycobacterium sp. JDM601]MWDAAYVLGALSTAERAEFEGHLVGCPWCQSAVAELEGMSELLSHLDLDL
VAALDPDDEDDPAPAPAPARNGRRLRLSWVGTAAAAAAVAVAAFVGVAGQ
SAPPPDATAVPMLQVHTALLASTVSVSDMDWGTLIELRCVCLADSSAPHD
LLALVVVGRDGSRNRLASWVAHPGHTATPTGSISMSVDQIASVQVVSADS
DEVLLQRTL
333990401YP_004523015.1 hypothetical protein JDM601_1761 [Mycobacterium sp. JDM601]MYTLLIVAVGIERLVELLVSRRNAGWAFSHGGEEYGRGHYPVMVVLHGAL
LAGCLIEVWAAHRVFIPRLGWPMLAVVAAGQALRWWCIGTLGPRWNTRVI
VIPNAPLVRAGPYRWLHHPNYVAVMVEGLALPLVHSAWLTAIGFGVANAL
LLVVRIRVENTALGYA
333990399YP_004523013.1 transporter [Mycobacterium sp. JDM601]MLRGITWAALSAPRRMLAVAGLILIASAIFGAPVAGKLSAGGFNDPGSES
ARAARILVDKFGQSDQQMLITVTDADGATSDRAASVGIAIVEQLRTSPWV
YGTSSTWTNSPGLVSTDGRSGLVIAELRGGENNAQHYAKSLLESMTALDL
YDRDGVTVAAGGEAVIYAQINEQNQHDLLVMEAIAVPLSFLVLVWVFGGL
VAAALPLAVAAVAIVGSMTILRVITAYTDVSIFALNLTTAMGLALAIDYT
LLIISRYRDELATGAAPDAALTRTMVTAGRTVLFSATTVALSMAFMVLFP
MYFLKSFAYAGVATVAFVACAAIVLTPALIVVLGARLDALDMHRLARRLL
SRGEPEPKPVEQQFWHRSTTAVIRHAVPVAVAGVTVLVLLGTPFLGVKWG
FPDDRALPRSASAHQVGDRLRTGFADDSSATISAVVPEAAGLAPGDLERY
AAALSAVTHVSAVTAPTATFVNGQPAGPPAAPTGLVDGFALVTIASTAPL
FSADSDDQLDQLHQIAGPAGKTVLFAGLAQNNRDSVAAITSRLPLVLGLI
AAITFVLLFLLTGSVVLPVKALVLNVLSLTAAFGALVWIFQDGHFGAFGT
TPTGTLVANMPVLLFCVAFGLSMDYEVFLIARIREYWLASGRTPADNDAS
VALGLARTGRVITAAALVMSISFAALIAAHVSFMRMFGVGLTLAVLTDAT
LVRTVLVPAFMHLMGRANWWAPGLLARLHDRVGLSEDHTPEASAAERHRR
SGHPPDEPVFADGADYRGPVNGRPTPRHARPQSGSARR
333990397YP_004523011.1 hypothetical protein JDM601_1757 [Mycobacterium sp. JDM601]MTALRPRRLPASWESELSDEYEWIPLRLPPEVTRIGASTRLAIEAEYRGW
ELTRVRLYTDGSRRVLLRRKKSQMNAISGNRCVDQPGL
333990395YP_004523009.1 hypothetical protein JDM601_1755 [Mycobacterium sp. JDM601]MTNAPDPYAALPQLPTFTLTSSSLTDGGTLAKPQVSGIMGAGGEDASPQL
SWSGFPEETRSFAVTVYDPDAPTASGFWHWAVANLPATCTELPEGVGDGS
LLPGDALTLVNDAGMRRYVGAAPPAGHGAHRYYVAVHAVDTEKLDLAEDA
SPAYLGFNLFMHAIARAVIVGTYEQK
333990393YP_004523007.1 hypothetical protein JDM601_1752 [Mycobacterium sp. JDM601]MTRPSRSNPASARTFRDRRDAGRALADRLADYRDADGLLVLGLARGGVPV
GWEVAAALNAPLDVFLVRKLGVPQQPELAMGALAGGQVVMNDQVLSSLGI
GGAEVQSVIDRESAELRRREHAYRGGRPPADLHGRVVILVDDGIATGASV
LAAVRAVQSAEPARTVVAVPVGPLSACRKIAQEADDVVCATMPDSFDAVG
QAYLDFRQVSDDEVRDLLATPTTTAS
333990391YP_004523005.1 hypothetical protein JDM601_1751 [Mycobacterium sp. JDM601]MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVEGELTRLIEENADLR
QRVSELDQELAAARAGGGGQQPTTAIPVYEPSPEPSAPQPVAAAAPEPPT
EDQHLKAARVLSLAQDTADRLTGTARAESEKLMADARANADQILSEARQT
AETTVADARQRADAMLADAQTRSETQLRQAQEKADALQADAERKHSEIMG
TINQQRTVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDTS
AASDGGGFNHFNRGTN
333990389YP_004523003.1 transmembrane protein [Mycobacterium sp. JDM601]MALFFTILGIALFVFWLLLIARIVIEFVRSFSRDWHPRGATVVILELIMS
ITDPPVKLLRRLIPQLTIGAVRIDLSIMVLLLIAFIGMELALQHAA
333990387YP_004523001.1 hypothetical protein JDM601_1747 [Mycobacterium sp. JDM601]MTFRVRRVTTTRSGGVSAAPFDSFNLGDHVGDDPAAVATNRARLAKATGL
GPDRLVWMNQVHGDQVVVVDEPRDTPVDATDALITGVPRLAMVVVTADCV
PVLMADARAGVVAAVHAGRVGAQRGIVARALEGMLAAGAQLGDISVLLGP
AISGPHYEVPAAMAEEVEAALPGSRTRTSAGTPGLDLRAGITRQLRELGV
EAIDADPRCTAADPKLFSHRRDGRTGRLASLVWLE
333990385YP_004522999.1 cell division protein FtsQ [Mycobacterium sp. JDM601]MGDGAARDIEETEHVENTEAGQNTDAGQATGDAAAGAESEEPAEAEGPRR
RARRERAERRAAQARAEAIEQARRDAKRRLRAGSAEPQQGVPRGAIRGLK
MVLATFLAVVLVVGLGLILYFTPVMSVRDIEVTGIAAVPREEVIDVAKVR
LGTPLLQIDTGSVAERVAAIRRVASTRVQRQYPSVLSITVVERVAVVFKD
FPDGPHLFDRDGVDFATAPPPGPLPVFDVENPGPTDPASRAALQVMTALA
PEVAGQVSRVAAPSVASITLTLADGRVVVWGSTDRTAEKAQKLAALLTQP
GHTYDVSSPDLPTVR
333990383YP_004522997.1 UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide) pyrophosphorMNDSVSKPDRGAPISVVLAGGGTAGHVEPAMAVADALRAVDAGVRITALG
TARGLETRLVPARGYDLELITPVPLPRKLNADLVRLPARVVRAVRETRAV
LRAVRADVVIGFGGYVALPAYLAARGIGRRQIPVVIHEANARAGLANRVG
ARGAVRVLSAVGDCGLSRPEVVGVPVRAAITTLDRAALRATARAHFGFAD
DARVLLVFGGSQGAQSINQAVAGAAKHLAAAGVSVLHAHGPKNTLDLPQP
AEGDPPYVAVPYLDRMDLAYAAADLAICRSGAMTVAEVSAVGLPAVYVPL
PIGNGEQRLNALPVVDAGGGELVDDAALTPDFVAGTVAGLLTDRARLAAM
TSAARLAGHPEAAQRVAQAALDVAADRRSRSRNEH
333990381YP_004522995.1 UDP-N-acetylmuramoylalanine-D-glutamate ligase MurD [Mycobacterium MTGVLSSGARVLVAGAGVTGRAVLNALAPLGLDLTLCDDDPAALRAHTGV
TTCSPAQAGSQIADYTLVVTSPGFAPTTPVLAAAAEAGVPIWGDVELAWQ
LDAAGRYGPPRRWLVVTGTNGKTTTTSMLHAMLTAAGRRAALCGNIGSPV
LDVLGEPAGGSARLDGGERKLGPPHESELLAVELSSFQLHWAPSLRPEAG
AVLNIAEDHLDWHGSMAAYTADKARALAGRVAVVGLDDARAAALLGGSPA
AVKAGFRLGEPAAGELGVIDGMLVDRAFAGAEAVALAPVASISVPGPVGV
LDALAAAALARSVAVPPEAIAAALASFQVGRHRAELVVVADGISYVDDSK
ATNPHAAEASVLAYPRVVWVAGGLLKGASVEATVARIADHLAGAVLIGRD
RGEVAKALSRHAPDVPLVFVETGQDADMQVMGETAVSPVTRVTRVADGSD
ESLGSRVMTAVVAAARDLARPGDTVLLAPAGASFDQFAGYGARGEAFAAA
ARAAAGAV
333990379YP_004522993.1 UDP-N-acetylmuramoylalanyl-D-glutamyl-2-6-diaminopimelate--D-alanylMIALTVAEIAAIVGGRLADISPEQAARTVVSGSVEFDSRRITAGSLFLAL
PGARADGHDHAASAVAAGAVAVLAARPVGVPAIVVDPGPKAASRSGALEH
DDASGSGATVLAALATLAAAVAARLVAEGLRIIGVTGSSGKTSTKDLIAT
VLAPLGQVVAPPGSFNNELGHPWTVLRADEHTDFLVLELSARHRGNIAEL
AAIAPPQLAVVLNVGSAHLGEFGSREAIAETKAELVQAVPESGVVILNVD
DSAVAAMADKTVARVVRVSRSAPADVWADAVVLDELARPRFALHAGGEAD
VTVSLGVSGDHQVGNALCAAAVALECGATPQQVADALAGAGPASGHRMQV
STRADGVTVIDDSYNANPDSMRAALQALAWIARGENPGAKRHSWAVLGEM
AELGEDAISEHDRIGRLAVRLDVSRLIVVGVGRAMGAMHHGAVMEGSWGA
EATAVQDVDAALALLRAELRSGDVVLVKASNSAGLTALADALVSDDPGDR
R
333990377YP_004522991.1 penicillin-binding membrane protein PbpB [Mycobacterium sp. JDM601]MRRSARSTGPTRRADGSIKAGTRRAGRSAKPTKQAKSAKTTKVAQQTGHS
ARDRRTRPATDLGLRSASFVFRHRTGNAVIFLVLALSAAQLFYLQVPRAS
GLRAEAAGQLKVTDVQQAMRGDIIDRTGDKLAFTIEARALTFQPIKIGKQ
LAEARKKDPAAPDPQRRFQEIAKDVAGRLGNKPDAATLLKKLRSNETFVY
LARAVDPALAEAITDKYPEVGSERQDLRQYPGGSLAANIIGGIDWDGHGL
LGLEDSMDAVLAGTDGSITYDRGSDGVVIPGSYRNRHRAVNGSTIQLTLD
DDIQFYVQQQVQQAKNVSGARNVTAVVLDAKSGEVLAMAGDNTFDPSQDI
GRQEDRQLGNPAVSSPFEPGSVNKIITAASVIEYGLSNPDEVLQVPGSIN
IADVTVSDAWEHGVAPYTTTGIFGKSSNVGTLMLAQRVGPERWFEMLEKF
GLGQRTGVALPGESAGLVPPVDQWSGSSFANLPIGQGLSMTLLQMAGMYQ
AIANDGLRIPPRIIKATIAPDGARTEEPRPDGVRVVSEQTAQTVRNMLRS
VTQRDPTGVQQGTGWQAAVDGYQIAGKTGTAQQINPGCGCYYDDVYWITF
AGIAPVDNPRYVIGMMMDNPHRAADGSPGTSAAPLFHNIAGWLLQRHNVP
LSPDPGPPLVLQAM
333990375YP_004522989.1 methyltransferase [Mycobacterium sp. JDM601]MAEQGEFGHVPVLLERCVELLAPALTRESPDGRGATLVDATLGAGGHTER
FLSQFPGLRVIGLDRDTTALEIAGTRLDRFADRLRTVRTRYDAIGAALTE
VGLAPTGSVDGVLFDLGVSSMQLDRAERGFSYAQDAPLDMRMDPEAELTA
AEIVNTYDAAALTDILRRFGEERFASRIAAHIVRRRSQTPFTSTGQLTAL
LYEAIPAPARRTGGHPAKRTFQALRIAVNGELESLRSALPAALDALAVGG
RVAVMSYQSLEDRIVKQLFAAVTTSRTPVDLPVELPGDRPRFTTLTRGAE
RAQPDEVEHNPRAGSVRLRAVQRVAAGPASTARGD
333990373YP_004522987.1 transmembrane protein [Mycobacterium sp. JDM601]MPLSDHEQRMLDEIESALYAEDPKFASSVRGGALRTPTTRRRVQGMAMFL
TGLVMLVSGIPFYSTVNPGFLILSVVGFVVMFGGVVFAITGNHATAVGDG
VAKTGGSQQRRVKGGSGTFASRMEDRFRRRFEP
333990371YP_004522985.1 hypothetical protein JDM601_1731 [Mycobacterium sp. JDM601]MHVRRLLPTFRRFTAYRRLLALVVLVLITAPMMVGCVRVKATITVSPNDQ
VSGQIIAAAKPRNDNDTGPKLSADVPFAQKIAITSYNRDGYVGSQAVFSD
LTFAELPQLAEMNRDAAGVNLALRRAGNLVILEGRVDLTSLSDPTADVEL
SVAFPGEVTSTNGERLGDDTVQWRLKPGVVSTMSAQAHYTDPSTRSFVRA
AMWLVLSTFAVAGAVALIAWGGRDRSPRFSSPHDDAG
333990369YP_004522983.1 geranylgeranyl pyrophosphate synthetase IdsA2 [Mycobacterium sp. JDMGEDYQGLIAGLEEFVLSGGKRLRPAFAYWGWRAITGRDAVDDELLLFSA
LELLHACALVHDDVIDASATRRGSPTTHHKFADLHRARGWRGPADQFGIS
AAILLGDLALVWADDIVAGAGLPTDAQRRVRRVWSDIRTEVLGGQYLDIV
AEASGDESIAAAMTVNTYKTASYTVVRPLQLGVAAAADRPDIQALFHEVG
TDLGVAFQLRDDVLGLFGDPAVTGKPSGDDLRSGKRTVLVAEAVELADKS
DAAAAERLRASLGSALTDVQVRELCDLIEAVGALAAVEDRIDSLTRRAMT
ALAAAPIDEAAKAGLTDLARLVADRKA
333990367YP_004522981.1 regulatory protein [Mycobacterium sp. JDM601]MVSSIPAAEDILDPDEPMFDLPTVAEMLGVPVTKVHQYLRDNHLLAVRRG
GVLVVPQVFFTAAGEVVKSLPGLLAVLHDGGYQQTDIVRWLFTHDPSLSL
TRDGARESVANARPIDALHAHQAREVMRRAQAMAY
333990365YP_004522979.1 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase [Mycobacterium MNWTVDVPIDQLPALPPLPADLRERLDAALSRPAVQQPSWPADQAKAMRT
VLESVPPITVASEIVRLKGLLAEVARGEAFLLQGGDCAETFADNTEPHIK
GNIRTLLQMAVVLTYGASTPVVKLARIAGQYAKPRSADIDALGLKSYRGD
MVNGFAPDAAVREHDPSRLVRAYANASAAMNLVRALTSSGLASLELVHDW
NREFVRTSPAGARYEALAGEIDRGLRFMNACGVADRELQTAEIYASHEAL
VLDYERAMLRMADIEGEPKLYDLSAHYVWIGERTRQLDGAHVGLAEVIAN
PIGIKLGPTTSPELAVEYVERLDPNNEPGRLTLVSRMGNSKVRDLLPGII
EKVQATGHQVIWQCDPMHGNTHEASTGHKTRHFDRIVDEVQGFFEVHHAL
GTHPGGIHLEFTGEDVTECLGGAQDISDADLGGRYETACDPRLNTQQSLE
LAFLVAEMLRG
333990363YP_004522977.1 hypothetical protein JDM601_1723 [Mycobacterium sp. JDM601]MLEWFRDDIIGRGRLPLLCCLLAFLATFLVTRSVVRYIRSTAGRVGAPRW
WQPRNIHIGSKHIHHVVFGVLLVMAAGVTLVAAGPHGHEPAFSLAAISFG
IGAALVLDEYALILHLSDVYWEEDGRASVDAVFAATAVAGLLVLGFHPLA
FLLSLWHDTSSPLIRAGVFAGLVMSLPLGVVVLLKGKVWTGLIGMFFFPL
LVVGAIRLSRPHAPWARWRYLPQRERLRRALLRERRLRRPVIQAKLWLQD
AVAGRPQLPDERVVDAELDREVRAASAPTQPIMIGRPRVSPARPPAGRAA
GSDRPAYPGRLPGRSASAGRSAPNRAVADASAPTVPFSTPLPAHPLQRPG
GPGR
333990361YP_004522975.1 1-acylglycerol-3-phosphate O-acyltransferase [Mycobacterium sp. JDMMWYWLVKYVFFGPLLTLIGRPKVEGLENIPEHGAAILASNHLAVMDSFYL
PLVVRRRITFLAKSEYFTGTGIKGWFTRWFYTAVGQVPIDRSDSDAAQAA
LTTAQRILNAGKLLGIYPEGTRSPDGRLYKGKTGLARLALHTGVPVIPVA
MIGTNVVNPPGTKMLRFSRVTVRFGKPMDFSRFEGMADNRFIERAVTDEV
IYELMGLSGQEYVDIYAASLKNGAAQQDGATAQPVARFPETAAG
333990359YP_004522973.1 hypothetical protein JDM601_1719 [Mycobacterium sp. JDM601]MGKSTLAAATAVADARAGNRVLLVSTDQAHSVGDVLGVSVVPGAGRDPVA
VALDDAGPGGLDVLALDTLALLEAHWVEVVEVLAGRFPESDLGSVAPEEL
SALPGVQEVLGLHEVGELAGSGRWDRVVVDCASTADAMRMLTLPATVALY
AERSWPRHRRLSGPDGASDALVELVERISGAAERLATLLTDEALVGARLV
LTAERVVAAEAVRTLGTLALTGVRVDELIVNQILLQDDSYVYTNLPAHPA
FDWYAERIREQHGVLADLDRAIGDVAMVLVPHLAGEPIGPKALGELLEGS
RRRGGSAPPGPVRPVVDRESGSGLGAVYRLRLELPQVDSGALSLGRSGDD
LVIGAGGTRRRVRLASVLRRCTVLDATLRGSELTVRFRPNPEVWPVSSDE
EVRR
333990357YP_004522971.1 hypothetical protein JDM601_1717 [Mycobacterium sp. JDM601]MNSIQVADETFIAASGAQVGALVGDRSSWRRWWPDLQLQLVEDRAEKGVR
WTVGGPLTGTMEIWLDPMLDGVLLHYFLHAEPSGVTGRQLAKMNLAKLNH
RRRVAGKRMAFEVKARLEQARPVGVAPAAVS
333990355YP_004522969.1 glycosyltransferase [Mycobacterium sp. JDM601]MSRVLLVTNDFPPRPGGIQSYLEELVRRIAGSGRHDVTVYAPQWKGADAF
DEAAESTGYQVVRHPGTLMLPGRAVDTRMRRLVAEQAVDTVWFGAAAPLA
LLAQRARAAGAGRVVASTHGHEVGWSMLPVASSVLRRIGESCDTVTFVSH
YTRGRFASAFGPHAALEHLPPGVDTDRFRPDPGARTELRARHGLGGRPTV
VCVSRLVPRKGQDMLIRALPAIRRRVDGAALVIVGGGPYADTLRRLAVEC
GVADAVTFTGGVPAAELPAYYLLGDVFAMPCRTRGAGLDVEGLGIVFLEA
SAAGVPVVAGDSGGAPETVLDNRTGRVVDGRSVEQIGDAVSGLLADPDRA
AAMGAAGREWVMSDWRWETLAGRMADLLQA
333990353YP_004522967.1 hypothetical protein JDM601_1713 [Mycobacterium sp. JDM601]MYADPADDALAKLSELSRQAEQTTEAMHTAQLNLDRKLAEQQAADRAHSD
DQAALAAAKEQLSSYRSAVNRFAATTYMGGRVGGMDAILTAESPQQLIDK
LAVQRVVASDLSVQLERFRVASEQADQAEQASAKSAEEARTAAEQAAAVR
AELQAKQSRLQLQISVVKSQYYALTPQQRTAMAEPGPVPEAAPGEPGPDG
QPPAPGFGIPGFPIPGSDAPPPMELGAPGGGSGGAATAVQAALTQVGTPY
VWGGAAPGGFDCSGLVMWAFNQAGINLPHSSQAQASGGQPVALSDLQPGD
VLTFYSDASHSGIYVGDGMMIHSSTYGQPVRVVPMTSSGPIHNARRY
333990351YP_004522965.1 hypothetical protein JDM601_1711 [Mycobacterium sp. JDM601]MTSRADAGQLSFVQLQAQLEATPAAKALRETTFVVVDLETTGARASPGVD
GAVDAITEIGAVKVRGGVVEGEFATLINPQRGIPPQIVRLTGITTAMVHD
APTIDAVLPMFLEFAGLGSARKGGDDTVLVAHNAGFDVGFLTAAAQRCGL
GWPRPPVLCTVRLARRVLSREEAPSVRLAELARLFAVSTTPTHRALDDAR
ATVDVLHALIERVGNQRVHTFADLRAYLSHATPAQRRKRTLAEALPHRPG
VYLFRGPSDEVLYIGTATDLRRRAGGYFNGSDRRSRITEMVALATRIDHV
ECAHPLEAGVHELRLLAAHAPPYNRRSKFPRRWWWITLSQEAFPRLSVVR
APRHDRVIGPFRSRADAAATAALLARFTGIRTCTTRLSRTGRHTCPPAEV
SPCPAAPDITAAQYAATVQRAAALIDGTDNSALRSAVHQVTALAARGHYE
SAARLRDHAATTIEILWRSQRARALAALPELVAAAPDGTGGWRLAVIRHG
RLAAAGNAPRGVPPMPVVDAITLGAQAVRPEPAPAGGALVEETALIARWL
AAPGVRIVRVEGAAEGGGWAEPLASAGAWMAWAAQARSARLASELSAEAD
PTSEQLFGRTAVYRRDSALQPVLPGRQPFSAAG
333990349YP_004522963.1 ubiquinol-cytochrome C reductase QcrC [Mycobacterium sp. JDM601]MKTLRKWARPHHNQTVARRRLRRRLSGGLLLLVALAMAGGLAAVVTPTPQ
VAVADESASALLRTGKQLFDTSCVSCHGANLQGEPGRGPSLIGVGEAAVY
FQVSTGRMPAARGEAQAPRKYPLFDDNQIDALGAYVQANGGGPTVVRDAD
GSIAQASLRGDDLGRGGDLFRLNCASCHNFTGRGGALSSGKYAPDLAPAN
EQQILTAMVTGPQNMPRFSDRQISMEEKKDIIAYVRAVTEEHDPGGYGLG
GFGPAPEGMVMWIVGMVAAIGAALWIGARS
333990347YP_004522961.1 ubiquinol-cytochrome C reductase QcrB [Mycobacterium sp. JDM601]MSPAIGDLLARQADDIDTRYHPAAALRRQFNKVFPTHWSFLLGEIALYSF
IILLLSGVYLTLFFDPSMAEVIYHGVYQPLNGVQMSRAYETALNISFEVR
GGLFVRQLHHWAALMFAASIMVHLARIFFTGAFRRPREANWVVGSLLLIL
AMFEGYFGYSLPDDLLSGIGIRAALSSITLGMPVIGTWLHWALFGGDFPG
TILIPRLYALHILLLPGIILALIGVHMALVWFQKHTQFPGPGRTESNVVG
VRVLPVFAIKSGAFFAIITGILGLMGGLLQINAIWNLGPYRPSQVSAGSQ
PDFYMMWTEGMARLWPAWEFYPFGHTVPGSVGVALIMGAVFILLIIYPFL
EKRFTGDYAHHNLLQRPRDAPVRTGIGAMAISFYMVLTLAAMNDIIAWKF
HISLNATTWIGRIGMVILPPIMFFATYRWCLGLQRSDRDVLEHGVETGII
KRLPHGAYIELHQPLGPVDEHGHPIPLEYAGAPLPKRMNKLGSGGAPGRG
SFLTADPASEDAALNEAAHASERRALTALAERQDGDGNGQQH
333990345YP_004522959.1 transmembrane protein [Mycobacterium sp. JDM601]MLMVGRNIADRFGHPGQSPEVTDRVLLGVCAAIWLALLGMSVAATVALVD
LGRGFDQPTESSHTGLLYIVIGVSALVILAAIPVLLRARQAGPARRSAGF
APPAAAGPRPRPGAPLPQRGFDAPGRRSAATRPALLPNQAQVDRVLLRGV
TVLGSAFGGALTMVAAATYLMAVGKDTGSWVCYGLAGAITLAMPVIPWLY
LRRLGEVLELPSRFG
333990343YP_004522957.1 hypothetical protein JDM601_1703 [Mycobacterium sp. JDM601]MRIESRLFEFVATFFVVVGVVYAVLTSLFATGGVEWAGSTALILTGVMAL
IVATFFRFVARRLDTRPEDYEAAEISDGAGELGFFSPHSWWPILIALSGS
VAAVGIALWLPWLITAGVVLVISSVAGLVFEYYIGPEKH
333990341YP_004522955.1 asparagine synthetase AsnB [Mycobacterium sp. JDM601]MCGLLAFVRAPAGTADPAAADSGDLTDIVTSVERAAHLMRHRGPDELGTW
TGDGVALGFNRLSIIDIEHSHQPLRWGPAEQTDRYVLVFNGEIYNYLELR
EELAATHGAAFHTDGDGEAIVAGYHYWGADVLPRLRGMFAFALWDTVRGE
LFCARDPFGIKPLFMASGSGGTVVGSEKKSLLDMAALVGFDVGDAGIDRR
ALQHYTVLQYVPEPETLHRGVRRLESGCWARISPDRPIPEITRYFKPRFD
ATPISRDTEQARYDEITAVLEDSVAKHMRADVTVGAFLSGGIDSTAIAAL
AMRHNPKLITFTTGFEREGFSEIDVAAASAEAIGARHVVKVVSPAEFVAA
LPEIVWYLDDPVADPALVPLYFIAAEARKHVKVVLSGEGADELFGGYTIY
REPLSLRPFNYLPAPVRRSMGKLSKPLPDGMRGKSLLHRGSLTLEERYYG
NARSFSDEQLRAVLPGFSPEWTHTDVTAPLYAESAGWDPVSRMQHIDLFT
WLRGDILVKADKMTMANSLELRVPFLDPEVFAVASRLPVSAKITRTTTKY
ALRRALEPIIPAHVLHRPKLGFPVPLRHWLRAGELLEWAYATVGATGAGH
LIDVAAVRTMLDEHRAGTADHSRRLWTMLIFLLWHAIFVERSVIPQISEP
TYPVQI
333990339YP_004522953.1 hypothetical protein JDM601_1699 [Mycobacterium sp. JDM601]MTVQDQSTTESHGVVLTDEAAAKVKSLLAQEGRDDLTLRISVQPGGCAGL
RYNLFFDDRTLDGDVIAEFNGVKLAVDRMSAPYLQGAEIGYADQIDKQGF
TIENPNAGGSCSCGDSFN
333990337YP_004522951.1 transmembrane protein [Mycobacterium sp. JDM601]MKLPGRRKDEAGSAGSADSAGGAVDLDSTESEAAARSGLTAPKGRPTPKR
DARARRRGPVAPAPMTAAEARARRKSLAGPKLSKEERRVAKAQRRERMAQ
RRERMLAGDESALLERDRGPVRRYVRDIVDARYNLLGLFMPVALGLMFVM
IAVPQVQYYISPAMMLLMILMAVDGVLLARKVGRLVDTKYPDNTEARWKL
GIYAASRASTLRRMRAPRPQVRRGERLD
333990335YP_004522949.1 cobalamin 5'-phosphate synthase CobS [Mycobacterium sp. JDM601]MIRSLASAITFGTAARLPAATGGVPGRGTLTALPVVGAGLGALAAGAVWT
GGFAFGPGSAVTGLLAVAVLLAATRGLHIDGVADTADGLGCYRPAEQALQ
VMRDGATGPFGVVAVVLVVGLQASAFPMLDTAGIVVAVCAGRVAAVLACL
RSVPAAPGSTLGAAVAGSQPVPVAIAWVAVLAAGSTLAGAAPWHGPVAVA
VALVGAAVLVRHCVRRLGGVTGDVLGAAVEWTTALAAVLLAAF
333990333YP_004522947.1 branched-chain amino acid transaminase IlvE [Mycobacterium sp. JDM6MKSGLLEFQVSVTANPTPDEVRETILAEPGFGKFHTDHMVSIDYTRDAGW
HNARVMPYGPIELDPSAVVLHYAQEVFEGLKAYRWTDGSIVSFRPEANAA
RMRASARRLAIPELPDELFIESLRQLIAVDSAWVPAAGGEESLYLRPFIF
ATEPGLGVRPANEYRCLVMASPAGAYFKGGIKPVSVWLSTEYVRACPGGT
GAAKFGGNYAASLVAQAQAADNGCDQVVWLDAAERRYVEEMGGMNLFFVF
GTGGSARLVTPELSGSLLPGITRNSLLQLAADAGFAVQERKIDVDEWQQK
AAAGEITEVFACGTAAVITPVSRVKSAAGVFTIADGEPGEVTMALRDTLT
GIQRGTFADTHGWMARLD
333990331YP_004522945.1 adenylate cyclase [Mycobacterium sp. JDM601]MVDWDALTAAGISDARQRADLLEYLDGLGFSTEQMAEAERQGRLFGLAGD
VVGRSGPPDYTLRTAAEALRIPVGDVERAWTMLGLSVDSPDTPALSQADV
DGLATWVQMRSYLGEPVDGFLRVLGATMARLAEAESSMIRISEPDMWLGH
THSELRTARAWRTVAEYIPRIGAMIDAVHRQHQVSARTFLEGLAGGPTSS
MVCGVGFADLTGFTALTQVLTSEELATLLTDFGGSVADVVHADGGRVVKF
IGDAVMWVSASGELLAKAATDLVDHPKARKVGLQVRAGLGYGEVLAINGD
YFGTPVNLAARLVDAAEPGQVLACAGVVKELPDWPVVERGPLKLKGFDEP
VPAYELELPADR
333990329YP_004522943.1 hypothetical protein JDM601_1689 [Mycobacterium sp. JDM601]MMGSGNGGDNCELWSGFDISGVASNYQAIAGILAGFTFAAVTVVLDRSHR
KHAGGHPVDVRGAEYEKLTGIALVAAFLGLLFASFQYGILAGERGCALTG
GRAASEELLGDVMFAASISILVYGLVQFAASSSAALAKHARFIVVVLVPP
VVFAFAEIKLMDLAISLGSPEDRQPLQPLWDHANRLAAPLGLTVMAVSGA
LWFAGAKRRRSPSPRGRIVRTSQTALPYITIAFVMYARIRSVVALPTIDP
HSHITPGEGWMWVTLLTVVVLLQSTALSFQSGVEISDPVVEKQPA
333990327YP_004522941.1 hypothetical protein JDM601_1687 [Mycobacterium sp. JDM601]MGNLIVAIAGSSGLIGSALVSALRTDGHQVLRIVRRTPANGGELRWDPEA
GDIDADALAGVDAVVNLCGIGVSDRRWSGAFKQTLRDSRITTTEVLSAAV
AEARVPLLINASGVGFYGDTGARTVDESAPAGRGFLARLAQDWEAATAPA
RAAGARVVLARTGLVLARAGGLLARLRPLFSLGLGSRLGSGRQYMSWISL
DDEVRALRFAMTEPALSGPVNLTGPAPVTNAEFTAALGRTLNRPAPLLVP
GFAARAVFGEFAEEGLLAGQRAIPAALEQAGFQFRHNTIGEALSYATERP
TPL
333990325YP_004522939.1 lipoate biosynthesis protein LipA [Mycobacterium sp. JDM601]MGPNYTDLKLLVKREKLHTVCEEAGCPNIYECWEDREATFLIGGEVCTRN
CSFCLIKSGKPSELDRDEPRRVAESVQAMGLRYSTVTGVARDDLADQGSW
LYAETVRAIKALNPSTGVELLIPDFGGRPDLLGEVFESRPEVLAHNVETV
PRIFRLIRPGFSYERSLNVLTQARDAGLVAKSNLILGMGETPEEIRAALA
DLYDAGAELVTITQYLRPTERHHPIDRWVKPEEFVEHARYAEELGFAGVM
SGPLVRSSYRAGRLYQQAMARRAERDRTPAPG
333990323YP_004522937.1 hypothetical protein JDM601_1683 [Mycobacterium sp. JDM601]MSRTFSSWLSGPESARPQPPEGAPGQDLGLPPTGPGSLASTGRRALGLAV
DWLVAYGLAGLGVTLGLVTPPLLATAVLVIWLVLGVAAVRLFGFTPGQYV
CGLRVVAVDGTGVGLVRAVVRGLSIALVVPALFIDADGRGLQDRATATAV
VRSR
333990321YP_004522935.1 hypothetical protein JDM601_1681 [Mycobacterium sp. JDM601]MSAYGRRFGVGVGLVSGAVAVAVTVGLGGAHAGAADQLAGIAVAGENADS
TELLIIASTNFGDASDVITGIDTSELSGTLLSAVEAMHRFPSIMDRAVDI
IDDKLAPAEATILEHSGSMSSLIDQLFFAPLNQQWADAGESMLDASQAFE
SAVAEGSMADTMSAGFQMLGINFGEVIPLALASAPVVWIGSLFDDAVAMT
DFFDFGF
333990319YP_004522933.1 glutamate-ammonia-ligase adenylyltransferase GlnE [Mycobacterium spMAYPGAQRRKLPSVGRLGLVDRYAAADLTALGWYSAYTQPHVDVLWALSR
APDADVALRTLVRLSETPGIDWQELSAALLADRGLRGRLFGVIGSSLALG
DHLIAHPQSWKLLAAPEGADGAADGVITLPSADALRAMFADCIAETTDGA
YVERLRVLYRDRLLVLASLDLAPTVEPLPALPFVAVGAHLADLADAALAA
ALQVAERNVCGADDTAAVPRLAVIAMGKSGARELNYVSDVDVIFVAEEAH
AVSSRVAGELMAVAGEAFFEVDAGLRPEGRHGALVRTLESHIAYYQRWAK
TWEFQALLKARPAAGDAELGRAYVDALLPMVWTACEREDFVADVQAMRRR
VAQLVPAEIRDREIKLGTGGLRDVEFAVQLLQLVHGRGDESLHVASTVDA
LAALGAGGYIGREDAATLTASYEFLRLLEHRLQLQRLKRTHMLPPPDDDE
ALRWLARSAHVRPDARHDALGVLREELKAQNLRVSRLHAKLFYQPLLEAV
GPAGLELAGGLTPGAAERQLAALGYDAPQNALTHLAALTNQSGRRGRVQT
VLLPKLLYWLSDTPNPDAGLLAYRRLSEALAAHRWYLSTLRDSSAVAKRL
MRVLGTSAYVPELLLRAPDVLLAYGDGPAGPKLLDPEPDAVARALIASAA
RHADPVRAIAAARSLRRHELARVASADLLGMLDVRDVCAALTSVWVAVLQ
ASLDAIIRVNLPDGQAESAPARIAVIAMGRLGGRELGYGSDADVMFVCEA
NEQVAGVSDADAVRWATSIAEQVRALLGTASADPPLQVDINLRPEGRSGP
PVRTLASYAAYYDQWAQPWEIQALLRAHRVAGDADLGRRFLLMVDRTRYP
AGGVSVDAVREIRRVKARVDAERLPRGADPNTHTKLGRGGLADVEWTVQL
LQLRHAHEVPALHNTSTLETLDAIADAGLVDEDDVDRLRQAWLTATRARN
ALVLVRGKPTDQLPGAGRALNAVAVAAGWPGGDGGEFLDNYLRVTRRAKV
VVRKVFGD
333990317YP_004522931.1 exported protease [Mycobacterium sp. JDM601]MTPGHAVLAAPRVGQPVQWDKCRFTADTNIKVPDDAQCGFIAVPVDYSNT
QGAVARLAMIRFPATKDKIGSLVINPGGPGESGIETAVGLVTTLPRKVRE
HFDLVGFDPRGVASSRPAVWCNSDKENDRLRALNQVDYSPEGVARIENET
KEYVERCLEKTGKEFLANVGTVNVARDLDAIRAGLGDEKLTYLGYSYGTR
IGSAYAEAFPQNVRAMILDGAVDPNADPIEEDLRQAQAFQGAFDDFAADC
AKEPECPLGTDPDKAVDVYHSLVDPLVDKPARTKDPRGLSYSDAIVGTIM
ALYSPTFWTHLNDGLSDLAGGRGDIMLSLSDLYMRRDAKGQYTNATDARV
AVNCVDQPPITDRAKVIDEDRRSRELAPFMSYGKFTGDAPLSTCAFWPVP
PTSEPHTISVPDLPPTMVVSTTRDPATPYQAGVDLAKQLRGGLLTFNGTQ
HTVVFQGNECVDGFATRYLIEGTLPPTDAKC
333990315YP_004522929.1 3-methyl-2-oxobutanoate hydroxymethyltransferase [Mycobacterium sp.MLTAYDYSTARIFDDAGIPVLLVGDSAANVVYGYDSTVPISIDELIPLVR
AVVRGAPHALVVADLPFGSYEGGPAAALATATRFMKEGGAHAVKLEGGER
VAEQIATLSAAGIPVMAHIGFTPQSVNTLGGFRVQGRGDAAEQTIHDAIA
VAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDAQVLVWQDMA
GMTTGKTARFVKRFGDVGAELHRAATRYADEVSAGTFPAEEHCF
333990313YP_004522927.1 hypothetical protein JDM601_1673 [Mycobacterium sp. JDM601]MWIDGHAIGQLDYIADAAEEQDLVALIRPLSQVIGVEVNAYGPADTFGER
TYRRAVVVRFASGNPIEVDTTQHTNDSLRGSADRFIDRVLGALAGTSAGD
333990311YP_004522925.1 protein CheR [Mycobacterium sp. JDM601]MSEPQRDAQEFWDEFYDGDDRIWSGWVNVHLALIAAGLAPGRALDLGCGE
GADAIWLAEKGWQVLAVDVSANALDRARAAARQREVLPHIHFERHDLSDS
FPAGRFDLVSAQFLHSPARLERDTVLRRAAEAVAAGGLLLIVDHGAAPPW
AGEQAHAHHFAAAEEVLAGLRLDDARWERLRVGTAERDAVGPDGQIATLT
DNVILLRRTPNGDVQAAS
333990309YP_004522923.1 cysteine synthase a CysK1 [Mycobacterium sp. JDM601]MGRIYDNVTELVGHTPLVRLNRLTDGLGAKVLAKLEFYNPAHSVKDRIGV
AIVDAAERSGELRPGGTIVEATSGNTGIALAMVGAARGYKVILTMPDTMS
TERRVMLRAFGAEIVLTPGAEGMSGAVAKAKQIIADTDNSVAADQFANPA
NPEIHATTTAEEIWSDTDGAVDIFVAGIGTGGTLTGVGHGLKERKPGVRI
VGVEPKDSPILTGGDPGPHKIQGLGANFVPEVLDPEVYDEIIDATFDDAV
KVARRLGTDEGILGGISAGANVWAAIELAKRPENDGKLIVTVIPDFGERY
ISTPLFAHIRE
333990307YP_004522921.1 transcriptional regulator [Mycobacterium sp. JDM601]MAATDENSVDLRVRRRLRELRTQQGLTLEDVATRARIDVSTLSRLESGKR
RLALDHLPRLAEALSVSTDELLRAPEHRDPRVRGAAQTRHGITYWPLTRH
GPAGGLHAFKIRVNVRRRRPAELPVHEGHEWMYVLSGRLRLVLGDDDFLI
GPGEAVEFSTWIPHWFSAVDGPAEAIMIFGAHGERVHLRD
333990305YP_004522919.1 hypothetical protein JDM601_1665 [Mycobacterium sp. JDM601]MKAEVAQQRSLLELSELDAELARIAHRSGHLPEQQERDRILAEHTTAADR
LAALELALEDLDGQAARFESEIDAVRQRADRDRALLDSGQTSAKQVADLQ
HELETLQRRQASLEDSLLELLEQREQLHAQATAESGVVDELATELARVEE
TLQTASAELETTRAQRAATRAELAGTIDGELLALYERQRASGGVGAGPLR
GGQCGACRIEIDRGELARISAAPPEEVLRCPECSAVLLRVKDFG
333990303YP_004522917.1 hypothetical protein JDM601_1663 [Mycobacterium sp. JDM601]MTRTTTVSAELVIFDLDGTLTDSAAGIVASFRHALDHIGAPVPGGDLAQR
LVGPPMHHTLAAMGLGEQTDAAIAAYRADYTSRGWLMNTMFDGVAALLGD
LRAAGVRLAVATSKVEPTARRILAHFGLDGHFEVVAGASVDGSRAAKSEV
LAHALAQLAPLPARVLMVGDRRHDVDGAAAHGIDTVLVGWGYGQADYQDT
ADSGPDFPGGPVARVQTVAELREVLGV
333990301YP_004522915.1 transmembrane protein [Mycobacterium sp. JDM601]MRRLAFLLRPSWLALAVVVLAFAYLCFTVLAPWQLGKNTTTTRANSQLER
ALTAEPVPLTTVLPHQDSSAPDEQWQPVTATGRYLPDAQVLVRLRLIDGA
PAFEVLTPFAVAGGPTVLVNRGYVRTDDGGSRMPEITPPPDGQVSITARL
RDSQAVIPGKNPFRENGFRQVYSINTEQVAAVTEVPLTGSYLQLVDDQPG
GLGVIALPRRDAGPFLSYGIQWIAFGILAPIGLGYFAFAELRARRSESSA
AADADSDEPAPPMTVEQKLADRYGRRR
333990299YP_004522913.1 hypothetical protein JDM601_1659 [Mycobacterium sp. JDM601]MVDISGVGIWSAPLRYGDQGEAAEAAAELEELGFTALWIPDVGGPVFDAV
GNLLSATRRAVIATGILNLWMHTPADVAASYASLTATHGDRFLLGIGVSH
APLIDAGDPGRYRRPLRAMTTFLDGLDAADTPVPVGSRVLAALGPKMLGL
AATRSRGAHPYLTTPDHTRFAREQLGSGPLLLPEQTAILCADRAEAREIG
TTWLGSYLALPNYANNLLRSGFTEDDIASVSDRLFDAIIAWGTVEAVTGR
IAEHRAAGADHVCVQLLDADPRAFPRDHWRRLAETVC
333990297YP_004522911.1 hypothetical protein JDM601_1657 [Mycobacterium sp. JDM601]MVAADNAPNFARKLGIGSNQLVQEFGWDEDADDDIRADVEEACGSELLDE
DTDEVVDVVLLWWREGDGDLVDTLMDAITALADDGVIWVLTPKTGKSGHV
RPAEIAESAPTAGLMPTSSVNLGDWSASRLVQPKSRMGKR
333990295YP_004522909.1 hypothetical protein JDM601_1655 [Mycobacterium sp. JDM601]MPVGLWPARHGNRSLRRSCLFYPAPPQPGPAVGESAAGGLISACSRLRGN
V
333990293YP_004522907.1 hypothetical protein JDM601_1653 [Mycobacterium sp. JDM601]MADNSAGPVLPRSTLDLLSAVPDTLLRRLKHYSGRLATEAVSAMGDRLPF
FAELEASQRASVALVVQAAVVNFAEWMHDPHGNVGHTAQAFELVPQDLTR
HIALRHTVDMVRVTMEFFEEVVPMLARSEEQVTALTVGILKYSRDLAFTA
ASAYADAAEARGTWDSRMEASVVDAVVRGDTGPELLSRAAALNWDTNAPA
TVVVGTAPPGPDAFSGQKASQDVRDVAERHGRAALTDVHGTWLVAIVSGP
LSPTQKFLADLLAAFSDGPVVIGPTAPSLTAAYHSASEAISGMNAVIGWT
GAPRPVLARELLPERALIGDASAIAALHTDVMRPLAEAGPSLTETLDAYL
DCGGAIEACSRKLFVHPNTVRYRLKRIADFTGRDPTQPRDAYVLRVAATV
GRLANQAQHASFSSAQVTYATAAMPPTPGPGLDEHHVG
333990291YP_004522905.1 meromycolate extension acyl carrier protein AcpM [Mycobacterium sp.MPASQEEIIAGLAEIIEEVTGIEPSEVTVEKSFVDDLDIDSLSMVEIAVQ
TEDKYGVKIPDEDLAGLRTVGDVVGYIQKLEAENPEAAAALREKFGSESN
333990289YP_004522903.1 3-oxoacyl-ACP synthase [Mycobacterium sp. JDM601]MTTALAADAESTWKALLDGQSGIRKLTDSFVDEFDLPVRIGGHLVETPES
FDEGLSRTELRRLSYLQKVALVLSRRAWDHAGSPEVDTTRLMVSVGTGLG
STEELVFAYDDMRERGLRAVSPLTVQKYMPNAAAATIGLDRKAKAGVLTS
ISACASGSEGIARAWQQIVLGEADIAICGGVEQRIEAVPIAGFAQMRIVM
STNNDDPAGACRPFDRDRDGFVFGEAGALLVIETEEHAKARGANIIARIM
GGAVTSDGYHIVAPDPNGEQAAHAMKRAIELAGLTPGDIDHINAHATATT
VGDIAESHAIDNALGKGGGGAAVYAPKSALGHSVGAAGAAESILTVLTLR
DQVIPPTLNLKNLDPEIDLDVVADKPRPGDYRYAINNSFGFGGHNVALVF
GRY
333990287YP_004522901.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MSSVTGRSAVVAAGAKNLGGLISTTLGRSGVNVAVHYNSDGSESDADKTV
AAVRDAGAKAIKVQGDLTIPANVTALFDAAVDAFGGVDFAVNTVGKVLRK
PILETTEAEYDSMFDINAKAAYFFLQQAGERLNDNGSVVTIVTALLGAFT
DGYATYAGSKSPVEHFTRAAAKEFGTRGINVNSVAPGPMDTPFFYPQETP
ERVEFHKSQGMGNRLTQIEDIVPLVVFLLEGGHWITGQTIFANGGYTTR
333990285YP_004522899.1 membrane-associated methyltransferase [Mycobacterium sp. JDM601]MPGYLAALALTLCPVLVVARLIMLRRSGTRALHFGNIDKKDFLIPPFALL
YFYVIFANAFGWPLVAAGRFFSSDVVAWAGVALCVGGLLFLLLSLIAFGT
SFRVGIDVDQPDELVTSGVFAVSRNPIYVGFALVLLGQFLVFPSWIPLIY
LLAAVWLFNRQVVREEAFLRQHYGQEFADYCNRVRRYL
333990283YP_004522897.1 transcriptional regulator [Mycobacterium sp. JDM601]MLSTSNDEQVDVGDRILDAAASCLLALGVERVTLAAIARRAGVSRPTVYR
RWPDSRSVIAALLTARITDAWMQVRAPGSGRAALVDRIVAVAVRVRHDPV
VMQVLHHAPELAMVYIAERMGASQRHLVDVVAAELADAQQGGSVRAGEPR
QLAAMCLLITQSAIQSAQIVAPILDEDALAAELTYNLNRYLS
333990281YP_004522895.1 diacylglycerol kinase [Mycobacterium sp. JDM601]MTRRIGRVTLLTNPAAGHGNARHAAERALARFQQRGVDVNHIVGSDPRHA
RQLLDEALAAGTDAVVVAGGDGVISLALQALALGAVPLGIIPAGTGNDHA
REYGLPTGNPEAAADVVVDGFTETVDLGRITADGGAQSWFGTVMAAGFDS
LVSDRVNRMRWPHGRMRYNLAMVAEMSKLRLLPFRLTFDDDEPMDIDLTL
AAFGNTRSYGGGMLICPGADHADGLLDVTMVHSGSRTKLIRLFPTVFKGT
HVGLDEVSTRRAASVRVECPGINAYADGDFVAPLPVTVTAVPGALQILRP
E
333990279YP_004522893.1 hypothetical protein JDM601_1639 [Mycobacterium sp. JDM601]MSAALDALDDWPVDHVAAAVIGPQGVLADRGDTTRSFYLASVTKPLVARA
VQVAVEEGAVELDTPAGPPGATVRHLLAHASGLSADSDRVLAKPGTRRVY
SNHGFAVLAEAVEQASGIEFGRYLTEAVFEPLRMSASWLDGGAAAAGFGV
TSTVADLAAFAGDLLAPVTVSPQLHAEAITVQFPGLDGVLPGYGRQRPND
WGLGFEIRDGKSPHWTGSANSARTYGHFGQSGTLIWADPVIERVLVVLTD
RDFGDWVTPRWPALADAVVSEYGGD
333990277YP_004522891.1 D-amino acid aminohydrolase [Mycobacterium sp. JDM601]MSFDTVIRGGRWFDGTGAPSAIRNIGIRDGHVAAISAEPLDEAGCGQVID
AAGKWVLPGLLDIHTHYDVEVLVAPSLSESVRHGVTTVLVGSCSLSTIHV
DGQDAGDLFGRVEAIPRQYVVDTIDKHKAWSNCADYIAGLERLPLGPNVT
AFIGHSDMRAATMGLDRATRGDARPTPAEQARMEQMLDEALQAGFVGMSS
QQLLFDKMDGDVCRSRTLPSTYAKPRELRRLKAKLRRSGRILQAGPDVKN
PFDVVSQLAQALGIFRRPLKTSLLAAADVKSNPLAVPAMVKASRVLNKLG
ADFRWQHLPVPFEVYADGIDLVIFEEFGSGAEALHLRESVERDELMRDEG
YRRRFRKDYQNKYGPRVWHRDFFDAEIVECPDASVIGKSFGQVGVDRGGV
HPVDAFLDLVLEHGTALRWHTTISNHRPDMLRKIAREPGVQMGFSDAGAH
LRNMAFYNMGLRLLRHVLDAQQAGQPFLSIEQAVHRLTGELADWYRIDAG
HLRVGDRADVVVIDPAHLDDTLDAYVEETFAAYGGMSRMVNRNDAAVTAV
FISGRAVVLDGQPTGVLGTQRTGSFLRADTRTPAVTAQATVPAAGAPTAT
333990275YP_004522889.1 hypothetical protein JDM601_1635 [Mycobacterium sp. JDM601]MSTIQRVVTSGTFELDGGSWDVDNNIWIVGDDSEVVVFDAAHTAAPIIEG
VGGRKVVAVVCTHGHNDHITVAPELGETFDAPVLLHPSDEMLWRMTHPDK
DFRPLSDDQTLRVAGTELRALHTPGHSPGSVCWYAPELGAVFSGDTLFCG
GPGATGRSFSDFPTILASISEQLGSLPADTVVYTGHGDNTRIGDELVNYD
EWVARGH
333990273YP_004522887.1 hypothetical protein JDM601_1633 [Mycobacterium sp. JDM601]MRESSIVVRPEAAGTPSRRLQAAGLAHATAVFEQLAAAVPLPRAPRPIVV
ADYGAATGYNSLLPICAAIAAFRRRTRPDHAVLVAHTDLPDNDFTALFST
LADDPDSYTRKDAASFPSAIGRSFYAQILPSQSVNLGWTSWATMWLRRPA
EELPEFDDHVHVDHSDDAGVRQEYTRRAAQDWHDFLAFRGRELAPGGKLL
VLTAAVDAQGRSGYQPVLDAIVAALDELVHDGLLSRDEVTRMTIPVLGRS
EKELRAPFAPAGRFEALTIDRLEVFDAEDRFWERYLLDADARALGAQWAA
FTSAAIFPTLAAALAGGAGDPRAADFVQRLQAGVAAELASSPQQVQIPLA
LVVLSKRAA
333990271YP_004522885.1 cutinase [Mycobacterium sp. JDM601]MAVYAVDYPATNDWPTGIQGIRDATTHIQATAANCPKTKMVLGGFSQGAA
VMGFSTANAIPDGVVGVDVPQPMPPEVADHVAAVVLFGTPNERAMNFLGQ
PPLAIGPAYLAKTIQLCAPEDPVCSEGMNFAAHAPGAYDGIADEGAAYAA
NRL
333990269YP_004522883.1 acetohydroxyacid synthase IlvX [Mycobacterium sp. JDM601]MTNGAQALITTLVDSGVQVCFANPGTSEMHFVAALDSVPQMRGVLCLFEG
VVTGAADGYARIAGKPAATLLHLGPGLSNGLANLHNARRAHVPVVNVIGD
HATYHKKYDAPLESDIEPLTDWTHGWVRRTGAGTDIGRDAAEAVAASMAS
PAQVANLILPADISWDDGAQAAGPVEAVAAAAPDPHAVAEIADVLRSGEP
VALLIGGPAAAEVAALQATDRIAAATGARALVETFPARLARGAGVPAIDR
LGYLAEQAAFQLDGIKHLVVAGTRAPVSFFAYPGKPSDLVPEGCAVHQLA
GLETDVAAALAQLAEAVAPGVQPRPAPAAAPQLPAGELTPQNWVQVIGAL
LPENAIISDESNTSGLMLPAATAGAPRHDVLTLTGGAIGQGLPVALGAAV
AAPDRPVIALQADGSAAYTISALWSMARENADVTTVLINNSSYAILRMEL
ARVGAEAEGGRYGPKAEALLDLSRPNMDFAKIAEGFGVPASVATTCEELA
EQFRRALAEPGPHLIDARMPSVF
333990267YP_004522881.1 transcriptional accessory protein Tex [Mycobacterium sp. JDM601]MTAHLALKPVNARLADELAVAERQVAAAVALLDEGASVPFIARYRKEVTG
SLDDGQLRTLEERLRYLRELDDRRAAVLASIEEQGKLTDELSAALLQADT
KARVEDIYLPYKPKRRTKAQIAREAGLEPLADRLLADPMLDPQQLAGEFT
GEDVADAAAALEGARAILVERAAEDAELVGAVREKFWSCGSLRTAPRSDE
AAKNAAAQKFRDYFEFSEALETMPSHRVLAVLRGEKEEALALTFGGGDAE
PYQAMVAESLGVDMAAPGQATPWLAETVRWAWETRLAFSAAVDARMRLKQ
RAEADAVTVFATNLKDLLLAAPAGNRTTLGLDPGFRTGVKVAVVDGTGKV
LDTCAIFPHQPQRQWDQAKAMLAALIARHGVDLIAVGNGTASRETDALAG
ELIADLKAAGAAAPVKAMVSEAGASVYSASAYAAHELPDLDVTLRGAVSI
ARRLQDPLAELVKIEPKSIGVGQYQHDVSPGNLARSLDAVVEDAVNAVGV
DLNTASAPLLAKVSGVSESLAEAIVAHREQAGPFRSRAALRDVPRLGPKA
FEQCAGFLRIRDGDDPLDSSGVHPEAYPVVRRILDRAGVALAEIIGDERL
LRSLRPADFADDRFGVPTVTDILAELEKPGRDPRPAFSTATFAAGVEKVA
DLKVGMVLEGVVTNVAAFGAFVDVGVHQDGLVHVSAMADRFVSDPHEVVR
SGQVVKVKVVDVDVDRQRIGLSLRLRDKPDRGSAAKPAAGRDTGKQNRGR
RPGNGAGRRDAAPAGGSMAQALRDAGFGK
333990265YP_004522879.1 hypothetical protein JDM601_1625 [Mycobacterium sp. JDM601]MSEPDQVLPPAAAARAAIRADLALIDDAQARLRRADTDIVGNAFRVEVAE
HLETQHRVNRGLSYRIFGEIADPADGPEDPRLPADTKIPDLLWSRLRITR
AEVRRRFRIAARIRPRRNLTGPPTPPELPETAAAVEDGRIGDDHIKAVAK
ALDELPAKIAPTDREAAERTLARHATEQDAAFVTAIGHAIADRLNPDGNF
TDEDRARRRNLVLGRQGPDGMSRLSGCVDPEARAYLEAVFAAVRPGHRQP
DCSAGRDTRSSGQRDHDALKLALRHGIESGAMGTHRGVPVTVIVTTKLAD
LDQAARAMADPNVPMPAPARTGGGSRLPMRDLIRMAANSIHYLAVFDDHS
ERPLYLGRSKRIATLDHRIICHARDHGCTRPNCSESGYHCEVHHSPNWDP
DGRTDADALYFACGADHGAATRGDLHTHVTEQGRLAWTDGTSPPQINHLH
HPEELLDDPHADP
333990263YP_004522877.1 AMP-binding protein [Mycobacterium sp. JDM601]MPDWDSPAFTAAEVARYHDAGWWSQTTLSDAVRRNAQHFPARAAYVDHPG
AELTWREFDAAADTLAARLAGAGVSPGDRIAVWHGDSAAIHVLFVAIERC
GAVVVGIGARAGIREVTAILAAAQAELLITDEPRQAAAADLEIHTVHIDA
LNAAAEIGLPGPQLGADDVFLINSTSGTTGLPKCVVHTQNRWHYFHQLAV
ANGQLSGDDVFLPIIPTPFGFGLWTSHTTPIHLGATAVLLDRFTAAATCA
AIAEHRVSVLCCVSTQLTMMMADPASREFDLSSLRVVFTGGEALPYRPAA
EFEELTGATILQFYGSNETGLLSATTLDDPLERRLRTGGRIVPEMAVRLF
GGEDGDTDVTDSGRGQPACRGPATSLGYLGGADHDKLFTADGWMRMGDIC
EIDADGYLSVTGRTSDFILRGGKNISAAQVEDAVMTHPAIAVAAAVPMPD
EVFGEKVCVFAELADAKVAGTGNLELPELVEHLLALGVSKELLPERLVVV
DELPRSSGGKIAKGQLRQISGHS
333990261YP_004522875.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MSQHLQDKVVVVTGAGGGFGKLIAEKCAAGGARVVGVDIGAENLAAVFDG
IRAAGLSGTHHIADVTDMGQMKAAVEHAVATFGAVDVIVNNAGVMPLAYF
ADHDKAWQQWHRAIDINIKGVVNGISAVYDQMIAQGRGHVVNISSIYGNA
GVAGSGVYSATKAAVTVLSDSLRSEAKGKIKVTTVKPTGVLGTNLGSGVV
NGAAIMGIVGSRAENYMQSMTAFANGTLAAEQTDVDSVKYWLITPDDLAA
AVVAVIDQPWGISISDITVRASGEDYIY
333990259YP_004522873.1 serine/threonine-protein kinase [Mycobacterium sp. JDM601]MFTGLLEESMMGETAPGSRAGSRVGRYLLKRLLGRGPTGEVYEAVDTQKD
RPAALKLLAPALGRDPAFREWLQREALTVGRVQEPHVVPVRDYGELDGEV
FIDMPLVHGADLSALLKRTGVLPPSRAVNIVWQAASALDAAHAAGVIHRG
VKPRNLLLTGDDFVYLVDFGIAGAPGANAGDADHAGARWKYSAPELFSGG
DFGPGVDVYSLACVLYQCLTGSPPYRADSVKMLANAHQTKPIPRPSHAGS
TIPPTFDAVIAKGMAKDPQERYGSAAELATAAYQALGAPDQHRTLQIYEA
SQQSTPPLIEQPKPSVPPVVPTAQPPEQPKPPAAPTATSPAGPVPPAPPV
SPAPPMSPAPPVSQAATQPSTPPPTAPAAPETEPAPAPEPVGAAVRATGQ
PSIPRISAPDHDWFSSPRPVPAYRDPVKRKKLLRLAAALAVVVGLITWLT
NRSGSDEFAADGDLPGSAAAASEPASPASNAEAQARLLKLLPAGYPQDAC
ASTTPMGGAIAEVTCGRNVDVDGPPSATYSLFPNAGTLRLSFDNTVQATN
VVTCPGRIQSPGAWHRTATPDKPSGMLLCGTRQGSPTLVWTNDADLMMAA
LRTEHSTPSLEQFYSWWSSHS
333990257YP_004522871.1 hypothetical protein JDM601_1617 [Mycobacterium sp. JDM601]MKSISTVLAAGALAAAGAFSTGIAAADEPAPATHPLGTQGTLPEGPGVHG
WTVADLRPSSDAIPYQPRGTLWEATATDEAIQGTVFPIVANLSARSASGQ
DYQSLFTVPTPQGIVPTGLTQGQKTSGKVYFDVTGDAPNSMVYQAGGADL
IRWVVPAPQPQSRPAAPQPQAPAGAGSQSPASGGSHRAPAPAQGPSSRPA
NPAPASPPVGSSGTPLPEGSSGTPLPDSSATAGGSAGTPASP
333990255YP_004522869.1 oxidoreductase [Mycobacterium sp. JDM601]MAKPPLSMKPTGWFQVAWSDEIGIGEVHSMKYFDQEMVAWRAESGQLTVM
NAYCEHLGAHLGYGGTVCGEVLQCPFHGWQWNAQGRNVCIPYQDKPNRGR
RIGTYPVVERNESVYIWHDVDRREPYFDPPDVFASFDDRTAADYYPQQRL
YRQSLEMHPQYVLENGVDFAHFKYVHRTPIVPVFTRHDFAEPVSYVDFTI
TFEGDDGQRIEDVNSGVEAINGGLGIAVTKSWGMIDNRTISAITPVDDRT
SDVRFMVYIGRTPGADPVRAEARGAEFGREVIRQFEQDIHIWSHQRYSDP
PALASAEYEGFTAIRQWAKQFYPDGIGGSAAEVAEATAQKGSPA
333990253YP_004522867.1 cutinase [Mycobacterium sp. JDM601]MLAAALLTAPVVIPAGAPGAVAPASAACPDVEVVFARGRLESPGAGAVGN
AFVSALRSKTSKHVSLYAVNYPADNQIDVGANDMSAHIQNTINGCPNTRI
VAGGYSLGAAVTDVVLAVPFQAWGFTNPLPPGADEHIAAVALFGNGSQWV
GPITNFNPIYNDRTIEQCHGADPICNPADPNTWQENWPQHLASAYISAGM
VNEAADFVAGKL
333990251YP_004522865.1 hypothetical protein JDM601_1611 [Mycobacterium sp. JDM601]MSDITELHQALLARVFDTNATAPLELRRAAFEDTGLDEPISTLIDTVALR
SYRVTDEDISATRAAGLSEDQIFEIVVCAAVGQATRQYTSALEALAAAGE
RGKP
333990249YP_004522863.1 monooxygenase [Mycobacterium sp. JDM601]MTISVAIIGAGFAGVGAAIRLKAQGITDFVILERDSRVGGTWRDNTYPGA
ECDIPSRLYSYSFARNPEWSQTYSGSAEILGYIDNMVESAGIAPHIRFGH
NVTGVVYDGDAGEWTVGLAGREPLRARTVIVASGPLANHSFPSIPGIETY
KGHKIHSARWDHDYDFVGKKVAVIGTGSSGVQIIPELVKVAESVKVFQRT
PGWVLPKLNTSTGDRLKQIYRHVPLAEKLMRSAWYWGHESVALGVVWDTP
LTRLVEALSTANLRLQVKDPWMRRQLTPDFSAGCKRLLMTSDYYPALQAD
NCTLVTWPIARLSPKGIRTVEGIEHRFDAIVFATGFDVSKAGTPFPVTGL
DGRDLASEWSRGAYAYRSVAVSGYPNLFFTFGPNSGPGHNSALVYMEAQI
DYIVGAISKLLQFDWKSLDVRPEVQSRYNKDIQRRLESTTWNSGCQSWYL
TEDGFNATMFPGFATQYVNQLKTVDLKDFKITVAETSRDPVLST
333990247YP_004522861.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MIFGIDTVLNAFRTDRRSVKAKAVVTGAGSGIGRSFALELVRRGGDVLCA
DIDAARAAETVALIEQLPTGTGHAVQCDVSDRAAVEQLARHALEVFGGAP
TLVINNAGVGIGGKPVGDIGFEDWEWALGINLWGVVHGCEIFTPILREAG
RGGIINVASAAGFAAAPSMAAYNVSKAGVMSLSETLAAELDGTDIAVTML
CPTFVKTNVFTDGRITPGSMSLSQQLARWTGLSADSVAARTLDAHDSGRL
YVVPQFDATVIWHLKRHFPALYARGAGLLGRVLPKN
333990245YP_004522859.1 PE family protein [Mycobacterium sp. JDM601]MKRLIIGAALCGAAMAFAATANAADENNYEFLYGSTDALVLGPTGIPTPS
ANYISNGIDLYLEPLGYQGTVASSEALTLPNSYDFFESVPGGEKILIDAI
LADYNAGAMGCDDAGVCTDPLTIFTYSQSSLVAAHAQDDLIEAGVPTDAL
RFVMLGANPDAVPTNFYETQIFNIDGDIFTNNVYESWWDLLFGGNTSFED
VLIGLALHNSYLGLTEAQIDAATSVTEGMTTINEIPTLTIPELFQALLAS
FFNV
333990243YP_004522857.1 hypothetical protein JDM601_1603 [Mycobacterium sp. JDM601]MNTTLWIIAGVAAAGYAIGGAILLLMPKDKYRSLGTNQHWVDDFTTGHLK
AIGTIKLIAALGLVLPAVLGVAPLLVPIAACGLMLFMAGAATTRFRRSEW
GLMAGDAMFLAVFAFLAWGRFLLQPFA
333990241YP_004522855.1 peroxidase BpoA [Mycobacterium sp. JDM601]MTAETFVTHTPGDVRIIADRHGDPDARAVVFLHGGGQTRRSWGRAAAAVA
QRGWQAITVDLRGHGESDWASEGDYRLVSFASDVNEVLRTLPPDPVVVGA
SLGGFTAMLLAGELAPGAASAVVLVDIVPNMDASGAERIQAFMAERMDSG
FDSLDEVADAIAAYNPHRPRPADLEGLTTNLRRRGDRWYWHWDPKFVSGS
DEFSPLEIHDVDRLNAAVGNILGDGVPMLLVRGQLSDLVSAESAELFLTR
FPQVEFIDVAGAGHMVAGDRNDIFADAVLGFLARHTD
333990239YP_004522853.1 oxidoreductase FadB5 [Mycobacterium sp. JDM601]MRVVVITKHGPPSVLQVQDRPDPLPPASGQVRIAVRAAGVNFADHLARVG
LYPDAPKVPSVVGYEVAGTVEAVGGGVNPARIGERVLAGTRFGGYAEIVN
ADAADTVALPPSMSFEQGAAVPVNYATAWAALHGYGSLQVGERVLVHAAA
GGVGIAAIQLAKAAGAVVDGTSSPGKHAQLEALGIDRAIDYRRNGWWKGL
PPYDIVLDGLGGTSLRRSMALLRPGGRLVAYGLSSLQQGEKRSLRRAAPQ
ALAMLRGFSLLTQMEQSKTVIGLNMLRLWDDRGTLEPWIAPLSQALADGT
AAPIVHAAVPFANAPEAHRILAARENVGKVVLVP
333990237YP_004522851.1 PPE family protein [Mycobacterium sp. JDM601]MSPPEVTSAKIYAGPGSGPLLAAAASYDALAAQLNTFAAGYFSVIADLQG
ESWTGRASAAMAAAATRYAEWAAATAGQVERAAGQARAAAAAYENARLAI
VPPALVTANRARLAGLAATNILGQNTPAIAATEFEYADMWAQDSLGMYGY
AASASTATQLPAFQPPPPTTSPAGAAAQAAAVAGSAGATGVSNSQNFLSQ
LLAGLPQQLGGLSTGAAAALPAQADPLLPLAGIEAMNILLGPASFGMQTA
RTISAVGSFSLAGNAYMLTHGNAGIGAASAVAPVLAKEAVPVAEAGAAGN
RPAVLAHMGGDAAPVGQLSVPPAWADATPVGAATKEPVWLSDAELADTSE
GGAVADMPGASPAVGMGPMAAMMAGGAAGRQTVAGALRVAPSRFKMPRPS
CGG
333990235YP_004522849.1 hypothetical protein JDM601_1595 [Mycobacterium sp. JDM601]MLGLHGGAVVAAETLIDLLWGDGPPRTAAKALQTHISALRRALGDGFVLT
EGTGWILSTTEVDASRYKLATKAGRDAVAIGDTTQAVACFEEALTLWRGT
PELPDSRRGLSEKTRWIEGHAALVEDRADALLAAGRAAEIIGELEAAVAD
APLRERRWSQLMLALYRAGRQGEALGAYQRARSLLADELGVDPGPELRRL
EAAIVAQDTALEYPVAQPPSSVTRAVTFLLTDIEGSTAAWEANAGAMAVA
LARHDELAELVVTSRGGRLIKTRGEGDATFSVFERPSAAAAAALELQDAI
RHEPWALQEPMRIRIALHTGEVELRDGDYFGRAVNRAARLRSLAVGGQIL
CSGATAELVIDTLPDDVLLADLGMRQLRNLPRPEHVFELRLELAERPAET
SDAPLQRPDLPAILTGPGGSARLDEGEAKLGPPHERGPFVGRGRELERLA
SAWQTTLTVGVHAVLIAGEPGIGKTRLAGEWSRQAYEHGALVLYGRSDED
LGAPYQPFAEALRSLVPCIEAKRLRGLRGLEALLPLVPGLIDVLPDLVTP
PRADPDTERYALFDAVLALLELAAASAPVVLVLDDLHWAAKPTLLLLRHL
LRFGDHTRVQVVATYRSTDLDRSHPLAAMLADLHRDGTADRLALGGLDED
DVTAYVTEAGHDDEELARALASVTGGNPFFLIEALRHVAESGGVWDPSTL
PQGVREAVSRRLSRLPAETNKALAAAAVVGSHFALELVERVVDQDLIDAF
DEARQAGIVVEEPGGRYRFNHAIVRQSLLAELASVRRMRLHQRIAATLEA
QPGADDDLLAELAYHYFECAWAGNAAKAVGYCRRAADQAMARLAYEGAAD
LYDHALHALEEIDDELPDRDEQAAELLIARCEALLAAGDVASAAGAIAQL
QAATVDSARLAAWATCFNGQLSMLTHPERLDSVEAAVGAAAGTLAQVADA
AGEAKAHTVRAGCLARLGRIGDCEIALDDALTAARRAGDHRRVNAVLAGA
PLAALWGPNPVPRAGGRCLDVVRLLRITTDSPAVEATSTRCQAVLEAFRG
RAEAARRMIDSARRTVTELGLRHALLEVEQFAGIVELVVDEAAAAEPHLR
QAYRGFRRMGLDADTAETAALLGRACLALDQDAEAAELCSESERLAGHAL
KASIAWRTLRALLLARRGEHAEARQVAEAAVGLAERTDGLVDHGDACLAL
ATVLNAAGDEVGARAAAERAVDLYERKGAAALAEKVRLALGERVPPPAAD
RPEEPAVELDTAAVRVGEHVMAAIHRKAWDEFERLFAPDLVVESRRKVVG
LSLPSDAVRLVMRRELEAGAQIDHAMIAARGERLALSHMITTIPDARPGA
PQDELLQLYGIDEEGRVTLQIWFDVDDMDAAIAELDAAYARLEGERVPAR
LESAAARVYRRNLAHYAARDWDALSKTFAQNIVEDDRRRVANAGLRRGRD
GVTAGNRALAELGVTFALDTIATRGERLALSHGRASAGQPPDDFHGDFLD
VAEIDADEQVVAHVIFEADDFEAAIAELDTRYLAGEAATYAQTWSALTQT
YAAANRKQLQLTPDCVNIDHRRLATIETGHLAAYLRSSWDDAQNFVVYIE
AVHRLSARGAVFTQAARGTSDRGFDAEWREVIVATFDGDLVNRCEQFDET
DLDTALARFDQLGRPVPRLENAAAHVYQRILAHYAARDWAALAEILAEDC
SSMDRRPVVNAGHRQGRDAIVAEVAAIAEAGLILTSDVIATRGEHLVLCR
GRASEGGRRPDAFRSDLLDVVEIDTNAQVVARVIFDIDDFDTAIEELDIR
YLAGEAAAHSDVWSTVAASYAALNRHELPLTTPDCVNADHRRETAFGPGD
VTAYIQGGWDTEQDIDIYVEQVHRLSGMGAVVTYVARETSHEGLAAEWRG
VAVFTVNGEKINRTEVFDGSDLDAALARFDQLSAPVRRLENAASQAYEHF
RAYFATRDWDAMAELLTVDTSVYDHRRVVNAEIQRGRDGEIANMQAFADI
DATRSTSMVLATRGERLVLCRTCISDEDHQAGGFRIELLIVVETNADKRI
LARVAYDPDDIDAAFGELETRYLAGEAAAFAHTWSVIAQIYAAYNRHELP
AADWINVDHRRSTPFATGDVTAVIRAWRELTPDFSMHIETVHRLNNFGAV
ITHTSSGTSQEGFDAEWRQIQLLTVEGDRINRCEIFDEADLDAALARFDE
LSAQTRQLENAATRACAHAADAYNRRDGAALFALTSADSRLDDRRKGLRD
THEGAEVQKVVAVTLETTPGSWRMEIRPIATRGSRLALTRRSYRDSDDPD
QAVTVDLLSVVEVGADGLMNHTVTFDPEDFDAAVAELDARYLAGEAAAHA
HTWSIVMGAYAALNRHEIAPTTPDWVNIDHRRGAAFEPGDMVPYLQAAWD
DSPDTRMYIAAVHRLSDIGAVITHVARGISQDGFDAEWRDVTLMTLDGDS
FDRSELFNEADLDAALARFEAVHAHDAEINAKGAASALD
333990233YP_004522847.1 hypothetical protein JDM601_1593 [Mycobacterium sp. JDM601]MIPAQQVIDTALATATGADTETIVLVTDKAEASLRWAGNSMTTNGVSSSR
TTTVVTIVRDDEGPRVGSLCSAEVDPALIPELVAASQEAAAGAPEARDAA
ELVAGTGAPDDWDADVPGTGAEVFAELAAGLSRGFRGADQLYGFARHEVS
TTFLASSAGLRRRFTQPTGTVEINAKRDGASAWAGISSPDFVDVRCDSLL
EQLSTRLGWAARTVELPAGRYETLMPPSTVADMMIYLGWTMSGRGAQEGR
TALSAPGGGTRVGERLTELPLTLYSDPHAFELECAPFVATGASSETASVF
DNGLDIGCVDWIRGGVINALVYPRAAAAEFGAPVALAADNLLMTGGSASM
AEMIASTERGLLLTTLWYIREVDPTTLLLTGLTRDGVYLVEDGQVRAAVN
NFRFNESPLDLLRRATQAGIAEPTLPREWGDWATRAVMPSLRIPDFHMSS
VSQAQ
333990231YP_004522845.1 sugar ABC transporter permease [Mycobacterium sp. JDM601]MVAFLLLPMLVVVWLSLHRWDLLGPISYVGAENWRSVLTDPVFGNSLAVT
VLFVVIVVPVQTALGLAVAVLLARELPGSGAFRTIYVLPWICAPLAIAVL
WRWILSPTDGAVSTVLGHRIEWLTDPGLALPVTAAVVVWTNVGYVALFFL
AGILAIPAQVLSAARIDGANGWQRFWRVTLPMLRPTMFFVLVTGVVSAAQ
VFDTVYALTGGGPAGRTDLIAHRIYDEAFGAAAIGRAAVMALVLFTVLVG
VTVVQQLSLGRRVSYDLT
333990229YP_004522843.1 periplasmic sugar-binding lipoprotein UspC [Mycobacterium sp. JDM60MNRPRFSTLFAIAVVLLAALFGVTAVLLDHASTRSAGAKTVVTVRLWDEQ
VAAAYRQSFAAFHRAHPDIEVRANVVSYATYFDTLRTDVAGGGADDIFWL
SDAYLAGYADTGRLLKIDGTGADWEPSVVSQFTRGGTLWGVPQLTDAGIA
LYYNADLLRTAGVDPARLVRLRWDPRGGSDTLRPVLAELTRDTAGRNAGT
PGFDPRRIRQWGYNAANDPQGIYLNYIGSAGGMFQRDDQFAFDNPAAVAA
FEYLVRLINEDHVAPPASDTNTNGDFSRNQFLAGKMALFQSGTYNLAAVA
EQAAFNWGVAMLPAGPAGRVSVTNGIAAAGNAASPHPQAVRDVLAWLGSH
QGNEYLGRQGAAIPAVLSAQHVYFDYWARRGVDVTPFFAVLDGPRIPAPG
GFAGFPAGKQAIKPYFDEMFLGRTDVAATLRRAQDAANTAAAR
333990227YP_004522841.1 hypothetical protein JDM601_1587 [Mycobacterium sp. JDM601]MVLLRPVPGTSVVHRLWAGTKLLVVFGISVLLTFYPGWVTIGAVGLLVFT
AARVARIPRGALPSVPRWLWVLLVVGGATAAMAGGEPAGLGGLLNFLRIT
ALSIVLLGLGAMVSWTTNVAEIAPAVATLGRPLRLLRIPVDEWAVALALA
LRAFPMLIDEFRVLYAARGLRPKTRPRTRRERRRRWAREAIDLITAAITV
TLRRADEMGDAITARGGIGQISASPARPKLADAVALALVTLTCGASLALE
LTVLTTAG
333990225YP_004522839.1 hypothetical protein JDM601_1585 [Mycobacterium sp. JDM601]MAAPAHISLGADLLSVVARLNRVATQRVALPIPGAQARLLSTIEDLDEAR
ISELAAVDHCSQPTMTTQVRRLEDAGLTTRTPDPQDARAVLIGITEKGVQ
TLDQVRRDRAAAIDPELDRLSAEDRRTLAEAVEVLRRFLAETAPSRPGR
333990223YP_004522837.1 hypothetical protein JDM601_1583 [Mycobacterium sp. JDM601]MALVTSIAAQLMATTPATAPAVSERVLQTLVEQLNVDAGFLRHNDHEIRA
SKLVAEWPPRTDPPDPDPLAVVSFTTADPVFTTCAHGKRVAVIRPEPSES
GYVRQLAIDHAIESLSVATAPLISGPVTTGMLGLVKFRRPKWRPEELNTI
EAIASLFAQLQARVVAEERLRYLADHDDLTGLHNRRALVAHLSDRLVAGN
PGPVGVFYIDLDRLKPINDYLGHAAGDWFIQDFARRLRAYAGNRTMTARI
GGDEFVVIPDWPMSMASAETFADRLQGALRDKVEIQGHTVTSTVSVGVTV
GLPGEDTSAGLLHRADEAVLAAKRGGGNQTVSSTDDMSLKSLFRKDIELH
LQGKIDDESLLLYYQPEVDLWSGAIVAVEALVRWRHPTRGLLLPGSFISI
AESANLADDLGRWVMRSACAEFSSWQANGVRTNATLRVNVSPVQLAARGF
VQNVVDTVEEFGLRPGSLCLEITERAVVQNIETTRRTLAELREAGVQIAI
DDFGTGYAVLSHLKDLPVDTLKIDTVFVRELGVNAGDLAIVRAIIALAEA
FGLQVVAEGVETSAAALTLMRHGCHRAQGFLFSRPVPGAAAESMLASRWM
AMPFLADSQALVI
333990221YP_004522835.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MARQVRSEATRRKLLDAAIDVFGEVGYVAAGRTAIIERAGVTKGALYHHF
DSMESLVMAIIEGGFSTMLSTFRNMCQPSSPALEGMIHGMFAVTAVLAVD
KEARAAGHLVFALSESNELGGDVADEWAAAVAAQTARAIAEGDLREGLDP
AQVAEPITGAMLGTWLLSSCEDGIARLTRMWEMLLPAIVAPDSLAYFQQF
LAREALRHQAEPGPGGGDEDSAAVD
333990219YP_004522833.1 hypothetical protein JDM601_1579 [Mycobacterium sp. JDM601]MRWKLARLLSLCWILVAGCGPCEAPVAAPGVEYLGQAHLAPSTVFAGTTV
GGLSGISYDSQRDCYYVISDDRSASGPARFYTVRLSVSDRGIDAVAIMAV
HPLLDEHGRQFEPRSFDSSPPVVPPDPEGIAFDSGRQRLYWSSEGERRTD
GPRGPVLADPWVRIAGLDGSYLGRLTTPPQLAMSAQRTGPRRNKTLEGLT
LSPDGRSLFAAMEGPGYDDGALPDQARGALTRITAYRVDPGADSAAPVAQ
YAYPLEPATAPAETNGLTDLVALSDTAFLVIERAFSVRPTVRLFRAEIGD
ATDVLGVPALAGAAVTPMVKTLVADLSTTPGLEPLDNIEGITLGPKLPDG
RQTLVLVSDDNFSPRQLTQFVVFAMSAR
333990217YP_004522831.1 hypothetical protein JDM601_1577 [Mycobacterium sp. JDM601]MAWFLALNATPTKGVQAPTYELQDSADIERITEEMASFAATDRAVAVPAV
FNNGRQKVTLYVRPAAWGAWAIYELTDEERREMMANSPLVSALAQARAAQ
QQQSQSQQTPPMFAPQQPPSQAGPSVIPRLD
333990215YP_004522829.1 DNA primase DnaG [Mycobacterium sp. JDM601]MPGRISDRDIATIRERVRIEDVVGDYVQLRRAGADSLKGLCPFHNEKSPS
FHVRPNHGLFHCFGCGEGGDVYAFVQKIEHASFVEAVELLADRVGHTITY
TGASATNIQRERGGRSRLIAANAAAAEFYAAALGSPEAAPARKYLTERNF
DAAAAQRFGCGFAPSGWDGLTKHLLRKGFEFKELETAGLSREGRRGPMDR
FHRRLLWPIRSSAGEVIGFGARRLFDDDPMEAKYVNTPETTLYKKSNVLF
GLDLAKRDIARGHQAIVVEGYTDVMAMHLAGVTTAVASCGTAFGDEHLAM
LRRLMMDDKFFRGELIYVFDGDAAGRAAAVKALEGEQQLAGQSFVAVAAD
GMDPCDLRLAHGDEALRDLVARRTPLFEFAVRTALAEMDLDNAEGRVAAL
RRCVPMVAAIKDPTLRDEYARQLAGWVGWDDVAQVIGRVRAAAKDSRGAA
KRMSNTPAAAAAQPPVARPNPADPTLWPQREALKAALQFPTLAGPVFDSL
TVESFTHPGYAAVRSAIDTAGGTAGAAAGAQWIETVREQTTSPLTIGLIH
ELSVESIRVDDEKLPRYIGGVLARLQEVWVGRQIAEVKSKLQRMSPVEHS
DEYHALFGDLVAMEAYRRSLLEQASGDDLTA
333990213YP_004522827.1 deoxyguanosine triphosphate triphosphohydrolase Dgt [Mycobacterium MAMNSYDSYGAHDRDRIVAETSKTAGLPGTGGQHRTDFARDRARVLHSAA
LRRLADKTQVVGPRDGDTPRTRLTHSLEVAQIGRGMAIGLGCDPDLVDLA
GLAHDIGHPPYGHNGEQALNEIASGCGGFEGNAQNFRILTGLEPKVLGPD
GASAGLNLTRAALDAVTKYPWPRRSENGPDRTKFGFYDDDRAAAEWMRRG
APEGRVCLESQIMDWADDVAYSVHDVEDGVIAGRIDLRVLGDASTVAELA
RLGDPDGEHDLAAAAQRLTELPVVAAVAGYGKFVVTLSASVALKRLTSEL
VGRFASAAISATHATAGRRPLTRYQADLEVPELVRAEVAVLKTLAVQFIM
SEDQHRKIQAAQRERIHEVAHRLLAGAPESLDPIFVPAFVAAADDGARLR
VVIDQIASCTEGRLERLAAG
333990211YP_004522825.1 hypothetical protein JDM601_1571 [Mycobacterium sp. JDM601]MTNELDMLLAKQGGVATAGQFQRHLGRAAFETGVARGELTQVWFGVYSRS
DPDTTLRLAGLDLRAGEQVAVCLGTAAAAYGFDTEEVTDLHVLNPVGHQL
RNSDGLVVHRRDAAPLAFVDGRLATEPAWTAVEVARSLRRPRALATLDAA
LRSGTCDRRQLRSAAARQGGRRGIVAVRDLMPLADGRSDSAMESEARLRM
IDGGLPVPELQYKIVDRNFQIWTVDFAWPAYRVAVEYDGFDFHSSPEALR
RDRRKRAALQEVGWTVLSLVDDDVRRRPWDMVRRIEGEMSRSRAA
333990209YP_004522823.1 ArsR family transcriptional regulator [Mycobacterium sp. JDM601]MAPAMTGLVTDDHQHTGPAYPATPPREILDAAGELLRALAAPVRIAIVLQ
LQESHRCVHELVDALGVPQPLVSQHLKILKSAGVVTGERSGREVLYRLAD
HHLAHIVIDAVAHAGEDH
333990207YP_004522821.1 hypothetical protein JDM601_1567 [Mycobacterium sp. JDM601]MMTDLAHRLHTVLTAAAVPTDAEPDGALTVHHDGTLASLRVVPITDELEL
VSLTQILAWDLALTKKLRERAAEQARLSQLGTVNLVEKNAKVADVMLRYN
FPGSGLTDDALCTLVLLVLAKGVDIRQALIG
333990205YP_004522819.1 hypothetical protein JDM601_1565 [Mycobacterium sp. JDM601]MTENPRADVVSRQYERWTYPPPIHDLQAWSAGNWEWFDPSHAHRVLWPDR
EYRPDLDILIAGCGTNQAAVFAYNNPKARVVAVDISQASLGHQQYLKDKH
GLWNLELHQLPIEELSTLGMDFDLAVSTGVLHHMADPKVGMKAIAERLRP
DGVAAIMLYARYGRIGIEILESVFQDLGLEQSDASIQTVRQAIRMLSPDH
PVQSYLKIAGDLVSDSGLVDTFLHGRAKSYDVDGCIDLANSAGLDFQGWL
LKAPYYAHDIAAPSGGFYDVVNALPEAKIWSVMERIHTLNARHFFLATRP
DRPKNTYAIDFSTPESLDYVPLFRFKCGLNGSEIFRPGWRMQLNPAQLPF
VQSIDGRRSIREIASSLAQAGGPSRGSTADLEKFGRKLFQSLWRLDFVAM
DLSTDS
333990203YP_004522817.1 recombination protein O RecO [Mycobacterium sp. JDM601]MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTRSKFGAR
LEPFAHIDVQLHPGRNLDIVTQVVSVDAFASDIVSDYGRYTCACVMLETA
ERLAGTERAPATALHRLTVGALRAVADGRRPRELVLDAYLLRAMSVAGWA
PALTECARCATPGPHRAFHVAAGGSVCGHCRPAGSTTPPMGVLDLMAALH
DGDWELAERSVSAHRSHASGLVAAHLQWHLERRLRTLPLVERVQRAAAGQ
GAVEAEAVSEATGSDG
333990201YP_004522815.1 hypothetical protein JDM601_1561 [Mycobacterium sp. JDM601]MAALSLTRIAVAAGSLALSLSAGAGFASADPDLGPIINTTCNYSQVNAAL
NAENPAAAAEFNASPMAQTWLRSFLSSPPDKRQRIATQIQAMPEAQQYIG
TITSIATSCNNY
333990199YP_004522813.1 monooxygenase [Mycobacterium sp. JDM601]MNAREPRVIVIGAGIAGITTAHVLRERGFTDITVLEKGSDVGGVWHWNRY
PGLRCDVPSQIYQFGFAPKPDWRHAWASGTAIQRYHRDVVDRLGLAPLIR
LDTEVTAAQWDERRHWTLTTAAGEQLVADFVVCATGVLHHPFTPDIPGLA
NFAGPVVHTARWDDGLDTAGKRIAVIGTGSTGVQVVSALQPAAASIDHYV
RSAQWILWAPTSLRQIPGAAAVLARFPTLHRALYRLMIFGGSALLTDVTT
RPSWRRRAVQAYARACLRIQVRDKELRAKLTPDYQPLCKRQVVSGSYYRA
IRADNSNLVTGDIAEVTPSGIRTADGAHRDTDVIVLATGFHAHNYMRPMR
LLGRDRLSIDDAWSAGPRAYRMTAIPGFPNLFTVLGPNSPTGSISLQYTS
ELTARYIAQWLEKFRDGELTSVEVTEEATARFNDEVAAAMGPTVWNTGCN
SWYLTEGGAVDLWPFDRATMNAMLAGPDLADFHLS
333990197YP_004522811.1 GTP-binding protein Era [Mycobacterium sp. JDM601]MSEFHSGFVCFVGRPNTGKSTLTNALVGAKVAITSNRPQTTRHTIRGIVH
REDFQIILVDTPGLHRPRTLLGKRLNELVKDTYAQVDVIGLCIPADEAIG
PGDRWIIEQIRAVAPKTKLLVVVTKIDKTSRDKIAAQLVAVGELAPEAEI
VPVSAVSGEQVDVLIGVLAGALPVGPAFYPDGELTDEPEETLMAEFIREA
ALEGVRDELPHSLAVVIEEVRPREDRDDLIEVYAVLYVERDSQKGIVIGR
GGSRLREVGTAARSQIEKLLGTKVFLDLRVKVAKNWQRDPKQLGRLGF
333990195YP_004522809.1 metal-dependent hydrolase [Mycobacterium sp. JDM601]MSIEVSNESGLDVSEVELVSVAKFVLARMDVNPGAELSMVLLDTAAMADL
HMRWMDLPGPTDVMSFPMDELEPGGRPDAPEPGPSMLGDIALCPEFAAEQ
AAAAGHSLGQELALLTVHGVLHLLGYDHAEPDEEKEMFALQRRLLEEWVA
DQVESYRVQTQSEKDRRLLDKSRYFDEP
333990193YP_004522807.1 methyltransferase [Mycobacterium sp. JDM601]MSENAFTPALGRLAPARFFDAVVAMTRERLWRGLTVEHLAPQPDEAILDV
GCGTGSLAVLAARVQPQAQVTGLDPDPEILAVARGKDPGRRVRWLTGMGD
ALVEAVGAESVDGVMSSLVLHQCPMAMKRAILASMFAVLRPGGRLVIADY
GLQRTRLMRTAFRIVQLADGRIDTQPNADGVLPELISAAGFAEVAEAEVV
ATVTGSISVYVARKP
333990191YP_004522805.1 16S ribosomal RNA methyltransferase RsmE [Mycobacterium sp. JDM601]MAGLFYVEALPEVGALADIDGDAGFHAATVRRIRPGEQLTLGDGVGVLAE
CRVEHTDRAGLRVRVVERKVVDAPAPPVTVVQALPKSERSELAIELATEA
GADGFVAWQADRCVARWDGARADKGLRRWRAVARAAAGQSRRAHIPPVEG
VLGTAELVSWVRERVAGGTTVLALHDGAGAGLPAVAAASALALIVGPEGG
ITDTELAALTDAGAVVTRLGPTVLRTSTAAAVALGALGVLTPRWG
333990189YP_004522803.1 heat shock protein transcriptional repressor HrcA [Mycobacterium spMGVADDRRFEVLRAIVADFVATKEPIGSKALVERHNLGVSSATVRNDMAV
LEAEGYIAQPHTSSGRVPTEKGYREFVDRIDEVKPLSSAERRAILSFLDS
GVDLDDVLRRAVRTLAQLTRQVAVVQYPTLSVSTVRHLEVIALTPARLLL
VVITDSGRVDQRIVELGDAIDDHQLSQLRELLGAALDGKRISAASTAVAE
LAGHLDGRSGLSPGLANAVGRSATVLLESLVEHREERLLLGGTANLTRNA
ADFGDSLRSVLEVLEEQVVVLRLLAVQQEAGKVTVRIGHETEAQEMAGAS
VVSTAYGSQGTVYGGMGVLGPTRMDYPGTIASVAAVAMYIGEVLGAR
333990187YP_004522801.1 glycerol kinase GlpK [Mycobacterium sp. JDM601]MTPRADRVVLAVDLGTGGPKVGLVALDGTVLWSDLISVPTSYGPGGAATQ
DARLWWAIIRDATRRGLADSGVRGDQVAGVSITGQWASTVPVDADGRPVG
PCVMWMDTRGAPHSRKVFGGPLAGYRPRALLSWLRRNGGIPSPSGDDPVG
HMLHLQHDDPVVAGAARWFLEPVDYLSMCFTGRAAASRASMMASWLTDNR
DLAVLDYDDVLVRLAGVERAKLPPLVPTGSIISRVAPAVAAELGISAAAQ
VVTGTPDMHSAAVGSGAVRPGELHLTISTTSWISCPMTVKKTDAFHQLAT
VPGLDPASYLLVNNQDTAGRALQWLRDNLFDDLDYPALTALAAGAPAGSN
GVIFTPWLKGEHSPIDDRNARGGFHNLSLDTTRADLVRAVLEGVAYNSRW
LLDCVNRFTTTTGPIRIVGGGARSELWCQIIADVCGRTCERVADPLNAQL
RGAALFAGIGMGELDRDELHDLIPLDGVFEPDAGNRAAYDRLFAEFPRLY
KTQKGMFARLSRS
333990185YP_004522799.1 balhimycin biosynthetic protein MbtH [Mycobacterium sp. JDM601]MSTNPFDDDNGSFYVLINDEDQYSLWPSFADVPAGWRVVYGGEQGAARAA
CLEYVEQRWTDLRPKSLRDAMAAERG
333990183YP_004522797.1 non-ribosomal peptide synthetase MbtF [Mycobacterium sp. JDM601]MTEASTQRNTASSIEDVLALSPLQQGLFSLAKLATDGLAADDGVDVYTVQ
FVIDIVGAVDAQLLRRSAEAMLGRHANLRASFWDVDLPHPVQIVPVDVTV
PWREINATPNEFDEIARSERTTNFDLARGPLLRFVLARSAPDRHRLILTV
HHLLVDGWSMAVFFDELVTIYRAGGTDPLPAPRPYRDYIGWLAAQDVTAA
TERWREYLAPLTAPTILADGERTELGSVMPQTHEMALDPDDTARLTEWAR
RNGLTLNTVLQFAWAVLLGRLTDRREVAFGAVVSGRPQQLTGVESMVGLF
INTVPVVAATPAGAEVVTVCQALQRDTAAMRDLSYLSLAAVQRAARNAVF
DTLLVFENAPIGSAAAGVTTPDGVQFIPVTVESLTHYPLTVVSYPPRDGR
LTLLLEAVPEALGDLSAPDLGRRLLQLLRQLVDPARPRVADLDVLLPVER
SRHDSPVAAPAATVPALFAVAAASHPDNPALTGEQQILTYAELEAESSRL
AQALAGRGIGPEDRVAIALPRSADSVIAILAVLQSGAAYVPVDVDLPKER
IESILRQADPKLTLTAELLAELRSDAAQRCPTPAGIHPDSTAYVIFTSGS
TGEPKGVIGTHRALTSYFADHQQRMYAPAMARLGRPLRVAHAWSLSFDAS
WQPLVGLLGGQAVHLFSAEEMRDAEAIIDGVRRHRLDMIDTSPSMFTQLF
DAGLLDAHAAHRLTVLALGGEAIAPHVWTRLRRVSAASSVAVHNCYGPTE
TTVEAVVADVAHTEVPVIGEPVRGMTAHVLDSALREVPDGVAGELYLAGA
QVTRGYLGRAGATAARYVADPFHAGGRMYRTGDLVRRRTDGRLIYLGRAD
DQVKVRGYRVEIAEVEAALAAATGVAAAAVLPVDGATGTQLAGFVTGTGL
DAARVRTAVSARLPAYLVPARIVVVESMPLTPNGKLDAEELLALLARAGP
VVGPGDEPATETERILVELMAEIFAGPESPAPGVETDLRDLGLDSIVALA
MVRAARRAGLPMRPRTALTCTTIRDMAAAMDTEAAEAAAAGQSDAVAVAD
DGPIPLLPAGRWLYQYGSPRRLGQVEAVRVPADIEAGQLRSALAAIVAAH
PVLRTRLDPDTMTLCPVEPADILTEITVGADGPADLVAVTEHGAKLLADL
DPENGVLLRAVWLRPPTGTGVLLLCAHVLALDPVSWQVVLGELHAALAGA
DPLPERSGYRRWAAALSARAQNLDTVDFWADQITGHDPQLGARRVRPDHD
RAGDLTVSVAVADPEVTAALLASRAPMHDLLVAATARMIRAWRTRRGQQD
PAPLLALETHGRAEDLVYEGRRVDSADIAGLLTSIYPLRIHQADPIGVAR
ALAEIPGSGIDYGLLAYLRDDTAARFAGQPGPQLLLNYLGRVDRVGDGPA
LAPDLIAGLPSVPEPDQAVRHELGIFAAVADLGAGPVVMTQWRTLPDILG
GAEITELQELFTGALRDLVEEL
333990181YP_004522795.1 polyketide synthase [Mycobacterium sp. JDM601]MLNSHPATLPDGRTPVLISAHARDLVQAEAGALARYLRNRPAGVGAVAQT
LRATRPIRRYRTVIRARDTDELISGLEAVYHDVEHPLVARSHRQEAARIA
FVFPGQGNQWPGMGADLFEIAAYCAEADRCEHAFRRAGHASPLTYLRGAD
DPDPVVVQAAQFTHAAALAATWRHFGVLPDITVGHSLGELAAAYTAGAVD
LDAAAAVVIARAELTDLLADNAAGRFGMAMIALAADDAAELIAGISGWLE
LSVINGPESVVVSGEWAAVQQILERADRRGVFARELAVRYPAHTSVLEPL
RDRMTARLPDAQFHGAPVEFIGSVYGGPIPPGKTFRQYWFDNLRQQVRFD
LAAAAAVARGVTNFIEMSAHPTLLVPLGDVAGTAQVLASTDRDQPAGEAL
AANIAAAAITDPGYRWRDFAAPAAAPLRHFPHAPMHTTRLWAGRKTPAPR
HRLPVVMSEQWQSIEVPEDRPAGMAVIDYTGQSPELAAELIAAMGADPVD
PAHAEQLVLVAPPADDIEITAVATAFTGPAVAQAPPALGVHCRRVWLITA
GAEQLDGDLPPRPQAAALAALHRSTGFAHPDQTFAHLDLPVDPTADDIGA
AVAALSLTDTEVAVRAGRLSVRRLVRSDAAPAVPAIPENVVISGGTGAIG
MAFAAFCADHGARDISLLSRSGDTDATADRLAALRMRTGARITAIRCDIT
DDAALAALIAEHHPAPAGLVVHTASAEAVAAEQITEAAVRDALGAKVIGL
DNLVRHWPQRADAQVLVCSSVLALWGGSGHGLYAAANRMADTLVSRLRAQ
GRSANSIRWGLWQSVAVVSGEEKNRIARTGLTPMAPEAAITTGLSATPND
PAILAADFDRLGVFFDSQGVPSPFDVTAAPASAISGDRPVGDVVVGELAA
VLGLDRTDDIDMHRALVDLGMDSLLALDLRKRLARTTGRRVALGPLLAGM
TAAQLTATLRDDTAAAAATRKDCFNP
333990179YP_004522793.1 thioesterase [Mycobacterium sp. JDM601]MAGDDISAVARFPTWIGHFSGPGPATLVFPHAGGAAVNYRPLALALAGGV
DTYVMQYPQRADRFREPAAETLPELAQGLFDAGPWEELGPLRLFGHSMGS
IVAFEFARLAEQRGIEVQRLWASAGPAPGAVAGLRKVPTGDADLRAELEQ
LGGTDPRILADQEFLALLLTPVRADYQAFNRYRCAPEVTIRADINVLGGR
SDDRVGTDLLKRWADHTTGACTLSLYDGGHFYHYEHIDALANRIIANA
333990177YP_004522791.1 hypothetical protein JDM601_1537 [Mycobacterium sp. JDM601]MSADDDPEARIRELERPLSDFAKAAEVTVSSAGAEQVSPTAGNGRGVGVA
VRAMAAVFVTVAAAAMFLISRGPTGTTPGFPTVPSTAAPTPSRSVPVVPP
ASASPANPTPGRADTITVSGAGQDKTLACAGNQVSVSGVRNTITLTGRCA
GLTVSGIGNVITVDFTPAITTSGVDNRVTYRFGDPEVSTSGFDNVVVRG
333990175YP_004522789.1 transmembrane ABC transporter ATP-binding protein [Mycobacterium spMARGLQGAILRGFGARDHVVTVLETSRITPHFIRIWMHSPTLFTEASVEP
AAWLRFWFPDPDGSDTEFQRAYTIAEGDAATGRFAIDMVLHEPAGPASRW
ARTVEPGATIAAVSLMGSSRFEAPEADAQPAGYLLMGDSASIPGINGIIG
TVAPEIPIELYLEQHHDDDLLIPLREHPRLRVHWVPRRDASSLAAAIEAR
DWSDWYAWATPEAATLKALRTRLRNEFGFPKSEVHAQAYWTAGRAMGTQR
GPTETSLTLPPPDKSASEVPGERRVNTKGAWRAQAAGRLLAPLKAPLIVS
GVLQAVITLLQLAPFVLLVELARLLVAGADESRLWTLAIAAVSLLGLGTL
LGAGLTLWLHVVDARFASALRTRLLSKLSRLPLGWFTARGSGSIKQLVAD
DTLSLHYLVTHAIPDAVAAVVAPVAVLVYLFVVDWRVALVLFVPVLIYLV
LMSVMMTQSGPKISQAQRWAERMNGEAGTYLEGQPVIRVFGGAAASSFRR
RLDEYINFLVDWQRPFIGKKTLMDLVTRPSTFLWLIMLTGTPLIVLGRMD
PVSLLPFLLLGTTFGARLLGIGLGVGGIRGGMLAARRLQIALDEAELAVT
EPASPAVEDPQPAGTVRFEAVSFGYRPGVPVIRDVSLTLRPGTVTALVGP
SGSGKSTLAALLARFHDVQEGAITVDGQDIRSLSADDLYHRVGFVLQETQ
LVHGSVRDNIALAVPDATDQQVHHAARQAQIHDRILRLPNGYDTVLGAAA
ALSGGERQRLTIARAILADTGVLILDEATAFADPESEYLVQQALNQLTKD
RTVLVIAHRLHTVTGADQIVVLDHGAVVEQGRHDQLLAAGGRYLQLWETG
RRAVGVGAEATP
333990173YP_004522787.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MTDVTAGPDIATYRALLDEVFGQQVADWTAEAEATERFPRDLIEHLGRSG
VFAGKWSNGQHPDVAKLVALAFKLGQLRSAGIGVGVSLHDSAIAILRRFG
RSEYLKDICEQAIRGEAVLCIAASEESGGSDLQIVETEVRSARDGFDVRG
RKKFVSLSPIADHIVVVARGMDHDEHSRHGNVLVIAVPTSQVHVNEPYRK
VGAGPLDTAAVDIDTWVPADALIARPGTGLAAISWGLAHERMSIAGQVAA
SCQLVLGLTHARMMRRRQFGATLFEHQALRMRVADLQARVDLLRHALNGI
AADGRLDLRTAAAMKVTAARLGEEVFSECMHIFGGSGYLVDETPIGRWWR
DMKLARVGGGTDEVLWELVAAGMRPDYDGYDELFDSGSSSG
333990171YP_004522785.1 acyl carrier protein [Mycobacterium sp. JDM601]MSASPSDAVSVALREILRDDLNVDLTKVTPESRLVDEVGLDSVAFAIGMV
AIEDRLGVALSEEDLLTCDTVGDLEAAIRAKAPADA
333990169YP_004522783.1 phenyloxazoline synthase MbtB [Mycobacterium sp. JDM601]MRGGATPSQSVRDEVAELLGVSPDTIDPAQDLIASGLDSIRMMSLSGRWR
KRGIDVDFATLAADPTVAAWSDLVAAHAPGADALDAAPDGGASSADHGGP
AAPFPLAPLQHAYWVGRNDQQQLGGVAAHLYVEFDGTGVDPGRLAAAAAE
LAVRHPMLRVEIMSDGTQRIGDRELPVKISDLRELDAEAVERQLLATREA
KSHQLLDGEVLELSLSLLPGGRTRLHVDLDMQAGDAVSYRRFMSDLAVLY
AGGTPPQLDYTYREYRAAMSRLEAARSAQDQPWWSERIPSLPGPPSLPLV
PTSEQSDPRRSVRRWHWFDAAAREALFAAARSHGVTPAMAFAASYAGTLA
RWSTSRRFLLNLPMFGREPFHPQVDMLVGDFTSSLMLDVDLTQADSPLSR
AVAVQQALHSSARHLGYSGLSVLRDLSRHRGVQTLAPFVFTSGLGLGDLF
GGEVTEIFGAPVWTISQGPQVLLDAQVTPLGGGLLVNWDVREEAFQPGVV
DAMFGHQLDELHRLADPDAWTTPDSPEVPESQRVVRAAVNSTVAGPSGEA
LHTGFFRQAERQPDAPAVFARSGDLSYRQLRDQALAVAAALRAEGVRAGD
TIAVLGPKNAEQVPAVLGILAAGAVYLPIGADQPRERAERLLQTGSVRLA
LLSGAQQTPSSVPALRLAEVLSGPTSPDESISVASDPEALAYVLFTSGST
GEPKGVELTHDAVMNTVEFLLRHFDIGASDRWLSLATLESDMSVPDIFAN
LRAGGAIVVVDEDQRRDPDAWASLIHAHRVTALNFMPGWLEMLLAVGDGR
LSSLRAVAVGGDWVRPELARRLRLQAPRARFAGLGGATETAVHATIFEVD
EAAGLLPNGSSVPYGVPLPNMACRVVSESGSDCPDWVIGELWVTGRGIAR
GYRGRPDLTGERFVEYPLHGVTRSWYRTGDLARYWPDGTLEFVGRADHRT
KISGYRVELGEVEAALGRIPGVHAAVAAVLPAAGGSDGLAALVRVDDDSG
LTAGRIRDALIDLVPAHMIPRWISPVDRIPFTDGGKIDRAAVACRLDQEF
GQLGGATGSVTGPRSTLERALCHIVAGVLGRDGDAMDVHDDFFSLGGDSV
LATKAVAEIRVWLDSPRTMVSDMFAARTVAALAEVLIGRESDTGRMESVA
EAYLEVAAMSEADVMVALDAGSANE
333990167YP_004522781.1 phenolpthiocerol synthesis type-I polyketide synthase PpsD [MycobacMTTHGAHRHAIPSNDTAEPIAIIGMGCRLAGDVTTPADFWRFLLDGRSAV
RQVPAERWEPYLRRDPRNAAVLRDTTPWGTFLDDLAGFDAEFFGVSPREA
ELMDPQQRLALEVCWEALEHAGIAPRSLAGSDTAVLMGVNADDYGKLIME
DLPGIEAWAGIGTALCGVANRVSHLLDLRGPSVALDAACAASLVAVHQAC
QQLRTGETSLALAGGVSALIGPGLTRVLDQAGATAPDGRSKTFDMAADGY
GRGEGAAVVVLKRLGDARRDGNPVLAVVRGGAVAHDGNTPGIMSPNGRAQ
EDLFRLACASAGIEPTSVDFVEAHGTGTPVGDRVELAALAAVYGAGRPSN
APCLIGSVKPNTGHLEGGAGVVGLIKAALALHQETIPPTAGISKLTTAID
WADSCLRVATEVEAWPRQPDSRRRAAVCSYGYGGTIAHIILEEAPPRPAE
HLGPVTAPAAVPVVIPISARTHARLARQADALADHLRARDCSVDQVAATL
WTRRSHERIRAAVLADNCDELVGGLDSLANDGQQPAVVTGAVVSGAPDGA
VWVFSGHGSHWEGMGSELLAHEPAFAAVIDEIDPVFQAELGFSARQALST
GELGATDRVQALTFAIQAGLAALLADRGVRPAAIIGHSVGEVAACVAAGV
LDLAQGAKVACYRARGFRRVAGHGAMALVGLSLEEAQRRLCQRSDVVAAI
SATPESAVVSGTVEAIDQICQRCSDDGISARRVNTDVAFHSPQMDALTDD
LARLTAGLPPADEPAVPLYTTALADPRSTAPRDSRYWVANLRGQVRFAEA
VIAAAEDGHRLFLEISAHPVVSHSIAETLSHLGLDEHGVVPTLRRQQPEL
RAVTRALASLYCHGAPFPHGVTATSPWTDNLPVTQWEHQHLWRTPTPPPS
GGGIHDVDSHTLLGGQVDITSAVPTRMWQTRLDMSNRPYPGDHPVQGTEI
VPAAVLLNTMLTAATTDLANVRLRTPVAPGRTRDIQVVLQEHCLSLASRL
VDSDDAPTAGGWLTHCTAVAEINNDGAAPVFELPAVQRRCTEVLPSTHVT
DLLESLGVTAMGFEWEILELRCGDGELLARVNAEPDGSTPATWAGLLDAA
TSTASVLFSDPGRLKMPARIERVAVHGPPCGEALLHARRRAAGAITDVVI
TDRAGTVLASMTGLAFEDLERSTERESSRLVHRLAWHPTPWRDTDRPDHV
TLIGGTDETRAWCTRDLAAAGVPTRSVADPAELPSGDAGSGSGAVVLVLT
EPRDEPRVSIELVLRTLKCLVGQGSKARLWVLTRNVHEGTDIEQAPLWGL
SRVAAAEHPQLWGGVLDLFEELSEPHLPVPALSSLTGHGVVVVRDGIAYT
ARLASAPCVGESMHCSPGGTYLITGGTGALGRQMAHRLVDLGARRLVLVS
RSGMPDRTVADAPTNPGLVQTVRSLEERGVFVRVAATDIGAAGAAAALQH
ALRDLPPVLGVVHAAGIETGALLTDTTLAQVDASMHAKVTGARVLDEVFP
PGTLNWMLLFSSCGYLTGFPGQGAYACGNAFLDAFARQRRNLGDRTISVA
WTAWRGLGMGSTSEYVAAQLESMGMETISADDAMWALDLAMRDDQANTVV
LPVTPLAASVAMLADIAPAESDVVESQDPVQAGLPEDPAEASDWVAERVS
AAIAGQLGLPDDGVDPHLPLIEMGVDSIMTVAVRRRLEKQIGLTLSPTLL
WEHPTAAAVTKKILELLA
333990165YP_004522779.1 hypothetical protein JDM601_1525 [Mycobacterium sp. JDM601]MSNAYDVLRDHHNVLRGLGGRFKAAPVGSVERQAILDELLREFTIHMRIE
DDIYYPALAAASRLIAIAHAEHRQIYDQLAVALRTPAHSPRHVDEWNSFL
IVLEAHADEEERDLVPPPAPIDLTDAELDELGNRMLAEMERQRNSRFEQL
HVKARAKFLALMPG
333990163YP_004522777.1 hypothetical protein JDM601_1523 [Mycobacterium sp. JDM601]MGSMFIATAAAAIAVAPTGVMAMSAPAVVAQPHGAVGPDGNGGGSGCGHD
AGWQGCGGFIPGQGGFGHGCIGGVCGSWDGGRGWFSG
333990161YP_004522775.1 resuscitation-promoting factor-like protein [Mycobacterium sp. JDM6MRKLTALAAGALLIGTAELTAAAHAEPINWEAIANCESGGDWAADSGNGG
YGGLQISAATWDANGGVGLPSDASRQQQIAVAKRIMASEGPGAWPACASR
GAAATTGAGAAPVGSLTHYLSALFEDSGGPGVPAD
333990159YP_004522773.1 ferredoxin-dependent nitrite reductase NirA [Mycobacterium sp. JDM6MTATPSAPSKGRQRSEAQWALGETEPVNSNEQFKKDDPALNVQARIIDVY
SKQGFDSIPKDDLRGRFRWMGLYTQREQGYDGTFTGDENADLLEAKYFMM
RVRCDGKALSATAMRTLGQISVDYARGTADITDRQNLQYHWIEIEKVPEI
WDQLAAVGLQTLEACGDCPRGMLGSPLAGESLDEVLDASPALDEIVRRYI
GKAEYANLPRKYKTAVSGLQDVAHEINDISFIGVNHPEHGPGLDLWVGGG
LSTNPMLAKRLGAWVPLDEVPDVWEAVTRVFRDYGYRRLRSKARLKFLVK
DWGVEKFREVLETEYLGRKLIDGPAPTQPTATIDHVGVQKLRNGHNAVGV
APISGRVNGATLLKIAELMEQVGTDRARFTPYQKLIILDVPDEKLDGLLA
ELDALGLPADPSPWRRNLMACTGLEFCKLSFVETRVRAQSLVPELEQRLD
DLNALLDVPVTVNINGCPNSCARIQVADIGFKGQMIDDGNGNSVPGFQVH
LGGSLGADSGFGRKLRQHKVFNDDLGDYIDRVVRNFIKQRNAGERFAQWA
VRAEEDDLR
333990157YP_004522771.1 hypothetical protein JDM601_1517 [Mycobacterium sp. JDM601]MVLTAHGSRDPRSAANTRAIAGHLRRVAPEHDVRVAFCEHNAPNLRDVLA
DVGDDAIVVPFLLASAYHARIDIPGMIEESGAAVRVAPTLGEDRRLVQVL
GERLTSAGASRFDPQLGVVAVAVGSSDAAANAGTARVADRLSRGTRWAGV
EMAFATMAGSVPQAVERLQARGAERLMIAPWFLAHGTITDGIAEYARREG
IPMAEPLGAHRLVAATVLDRVETALADRLAA
333990155YP_004522769.1 sulfate-transport ABC transporter ATP-binding protein CysA1 [MycobaMTDAITVRGANKRYGDFVALDNVDFAVPSGSLTALLGPSGSGKSTLLRAI
AGLDHPDSGTVTINGVDVTGVPPQRRGIGFVFQHYAAFKHMTVRDNVAFG
LKIRKRPKSEVKEKVDNLLEVVGLSGFQARYPNQLSGGQRQRMALARALA
VDPQVLLLDEPFGALDAKVREDLRAWLRRLHEEVHVTTVLVTHDQAEALD
VADRIAVLNQGRIEQLGSPTEVYDAPANAFVMSFLGAVSSLNGALVRPHD
IRVGRTPEMAVAAAGDTDEASAVLRAVVHRVVALGFEVRVELINAATHAP
FIAQITRGDAEALALVEGDTVYVRATRVPPLAETPITDASVTA
333990153YP_004522767.1 sulfate-transport integral membrane protein ABC transporter CysT [MMTEIVVTEATRTGGDEPPVHTGVHREGVSLRVGAAVVWLSLIVLAPLAAV
SWQAAGGGWQAFRLAVTSHAALESFRVTLTIATGVTVVNLAFGLLIAWVL
VRDDFVGKRFIDVIIDLPFALPTIVASLVMLALYGPASPVNVHLQHTAWG
VGLALAFVTLPFVVRAVQPVLLEIDREVEEAAASLGASGATIFRSVVLPS
LTPALLTGAGLAFSRAIGEFGSVVLIGGAVPGKTEVSSQWIRTLIENDDR
TGAAAISLVLLTVSFLVLLALRVLGARVAKRQERS
333990151YP_004522765.1 hypothetical protein JDM601_1511 [Mycobacterium sp. JDM601]MVGFLSWWDGVELWLSGLGFVIQTAVVMPVVLALAYILAVVLDAMLGQGI
RVLERVRPDDGEAR
333990149YP_004522763.1 hypothetical protein JDM601_1509 [Mycobacterium sp. JDM601]MANRAGRTAASAAALALLASGCTTVVSGTVRPAPGLAPTPVTGIAVRQVL
LDDAELSKLIGQPFRSDPSLPPRFGGVDSLPDAWDTAGPEDCVGAAVGGQ
QAVYKSAGVQDVAHEFWDSTSTTGDSALTGVGEAVIALATPADADALFEK
FTQQWGRCDGVTVTRGDEADGEASGEIIDVSTSDTVLTATVRTTVDGEVG
LRVSRAVAVLVNCIVDVDVFWFVGEEDHADAPPAGDSTAADLARAMLDKV
RNLSG
333990147YP_004522761.1 hypothetical protein JDM601_1507 [Mycobacterium sp. JDM601]MNIRKIGVVGAFAAGAAFALAPLAAAETGDTPAPPDFSNILVGQVQSMNW
LFGAQATASGVDSDLITAGDPTTENPLSFSTISADDLTDNPAFAAMLFGP
NWEDEMSSDPGAYSLFNGALTQFYDASNVLTYALLTGGGEIDVADAGDYL
FGSEAGIADGLAGDGFFADFGNFFQAGVADLFGYFGLGALDM
333990145YP_004522759.1 transcriptional regulator [Mycobacterium sp. JDM601]MRIADVLRNKGAAVVTIHPDATVMELLAGLAEHNIGAMVVIGTDGLQGVA
SERDVVRQLHVHGASLLARPVSAIMTRLVATCTKSDTADEVSVLMTEHRA
RHIPVLEDGRLAGIVSIGDVVKSRMEELQAEHAQLRSYISQG
333990143YP_004522757.1 30S ribosomal protein S20 [Mycobacterium sp. JDM601]MANIKSQVKRNRTNERARLRNQSVKSAVRTAIRAFREAAEAGDKEKAGEL
LLSTGRKLDKAASKGVIHKNQAANKKSALARALNKL
333990141YP_004522755.1 membrane metal-binding protein ComEC [Mycobacterium sp. JDM601]MAQPPAPAPPAARLDVRLVPAALTGWAVTAAGIQWQIGGTLAALCALIGV
SAALLWRHGGRTRRPGYRLAGAVLAAASTVGVGFGWAVALRTESLSHHPI
TAAFGRTAPVTVTPSESPLPAGARRLMFRATLQYLDGAESSGRVVVFASN
IEFGDVMVGRSMAFRAKIARPTRRDLTAAVLTATGEPTWGDPGLVARSAH
QVRARFAAAAGRVLPGEQARMLPALVLGDTSAITAATGREFRAAGLTHLM
AVSGANVTIVCGAVLFSARLVGPRAAAVLAGVALLGFVIVVQPTASVVRA
AVMGAIALLAVLSARRRQAIPSLAASVLVLLALAPQLAVDVGFALSVVAT
AALVLIAPVWTARLVARGWPEPLAAAVAVAWAANLVTAPLIAGISGRLSL
VSTLANLAVAVLVAPITVLGSAAAALCGWWPAAAELLIRFTGPELWWLGH
VAHWTAGVPAATVSVPAGAAGVFGVGAAAVAIVRCWRWRCCRRMLTVLVV
CLLAWSVTEVLTGWAVVGAA
333990139YP_004522753.1 hypothetical protein JDM601_1499 [Mycobacterium sp. JDM601]MFALCVLLSAVSCSPEPAKPAEPAPRPSESPAAKPAAHIGQTLDLMRIGG
QKIAVTLTEVIDPATVPNGWGEAGKTYVAAKLRIENAGTTTIVGNSNSDV
SVVGSDDHDYQADFATVTECQDVGYGWFLIAAGSSSTGCVVFALPSGVTA
TKVRYSPSSGISQDVGEWLNP
333990137YP_004522751.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MDFQLSDEQVLLRDTTRSMLSGYDTETRNDVIEADPGFNPQVWKQLADTG
ILGLGFDPDESGPLEIMVVLTEMGRRLAPEPVIHGALGPGALIAERGTAD
QRELLDAVAGGEHILAFAHTEPGMRGVAAQVSTTAVRQGDSWVLSGRKNP
VLTGDRADTLVVSAALPDGGTGLFVVDGSADGLTRRPYRTFDGQRGAQID
LDDAPGSPLGEATDATGAIEHAMIRISSAVCAEAVGAMEEALRLTTDYLK
TRKQFGVTLNTFQTLTQRAADMYVSLELARSMNLYAAMSITDGNLDPVIA
ARTKLQVGRSGRHIAQESIQLHGGIGVTWEYPVGHLAARLTAIEHTLGSS
QDQLHVLMDNLGSYDLAKL
333990135YP_004522749.1 hypothetical protein JDM601_1495 [Mycobacterium sp. JDM601]MNTPLRVIQWTTGNIGQRSLHAIIGRPDMELVGVYAHGKDKVGVDAAELA
GCAAETGPTGITATNDIDALIALKPDACCYNPLWPSIDELVRLLEAGVNV
CSTAAWITGGKQTPQDRNRIEDACRAGNSTMFGSGAHPGLTNMVGMVLSG
ACERVDEILITESVDCSTYESAATMAAMGFGQDPGIPGLAESVRVESEVF
AESAAMMADAIGAQLDKMTFDVQFTAATGDSDLGFMKIPAGTVGSVFGYH
RGWAGDRNVVSVGFNWIMGSHVTPPKPVAHGHVIQVFGLPNMRTVINCLP
PKDWSEPNLNGLGSIYTAMPVTNAVPAVVAAPPGIVTLADLPPVTGRAAE
R
333990133YP_004522747.1 hypothetical protein JDM601_1493 [Mycobacterium sp. JDM601]MKTIPIGGILRRYWIPLVFIVVIFVSSVIVTRLHKVFASQELNPHAGAGI
EIVQFNPKYVAYEAFGPPGTRADINYWDAEANVHQINDVPLPWSYTVVTV
LPAVQANMIVQGNSGEIGCRIKIDDRLLDERRATGINAQTFCLVKSG
333990131YP_004522745.1 hypothetical protein JDM601_1491 [Mycobacterium sp. JDM601]MTVTVITDSSACLPVELRDRWGIRVVPLHILLDGADLRDGIDEVPEDIYA
RDGVSTAGTNPEELTDAYRAALADSGGDGVVAVHISAALSGTFGAAEHVA
TQFSGVRVVDSRSAAMGTGFAALAAARAAAGGADIDAVVAAADAAVLRSH
AYLVVHRLDNLRRSGRIGSAAAWLGTALSLKPLLAVDDGKLVLAQRIRTV
GKAVASMIDRVCEVVGDRPAALAVHHVANPEGAREVADALAERLPACAPA
LITGLGSTLALHVGAGAVAVCVDVDPTAGPGQV
333990129YP_004522743.1 phosphoglycerate mutase Gpm [Mycobacterium sp. JDM601]MRVRRLILLRHGQTEFNAGSRMQGQLDTVLSDLGRAQAEAAAEVLRKRHP
LLIVSSDLWRAYDTATVLAEHNGLPVRVDTRLRETHLGDWQGLTHEEVDA
AAPGARLAWRDDARWAPHGGESRVDVAARSEPLVAELVAGEPAWGSADEA
DRPAVLVAHGGLIAALTAALLRLPVENWPALGGMANASWTQLSGYSDDSG
GADDFADVRWRLDVWNASAQVAGDVL
333990127YP_004522741.1 nicotinate-nucleotide adenylyltransferase NadD [Mycobacterium sp. JMGGTFDPIHYGHLVAASEVAHKFALDEVVFVPSGQPWQKDRHVSAAEDRY
LMTVIATASNPRFSVSRVDIDRAGPTYTRDTLQDLHALNPDSELYFITGA
DALASILSWQGWEELFDLARFVGVSRPGYELRHDHITGVLGELEEHALTL
VEIPALAISSTDCRERAEQRRPLWYLMPDGVVQYVSKRRLYRGGDGSDAN
KAVGRSTSLAAGNNA
333990125YP_004522739.1 hypothetical protein JDM601_1485 [Mycobacterium sp. JDM601]MRTTAETSSAWPIVGRDDELRAALATLGPDSEYQGIALVGDSGVGKSTLA
RALGARLTAAGRAVRFVLGTQTGFDVPLGAFSRSVTVDATCEPAAMLAIA
HQNLAAAERPVIVVDDAQLLDPLSATLIYQLAAEGTAQLIVVIRSGETLL
DAVTALLKEQLLLNMRINPFTREQTGELARRVLGGVVSAQVVNRLHDRSG
GSPLYLRGLLRAGRDDGVLVLDEYGWQLKGPLHADQELSVLLGFRLQALT
PDELEALEILAVAELLDWEVFRELCSSEAVSGLERHRLIHLTSDGGGTLV
QVTHPIFGEAVLERIGVVRSRRLNGLLFNAFDKYLRRGGRRLRLPDVRGR
IRMAQFMICSDLEPDFELIIGAAVRAAAMSNLAHAEELARFAFDRDGGLP
AALVLGDTLLWQGRGDEAESVLTDVDLDGADSVSIVDWGCVRASNLFWNC
GEIDSAQQVLAEAKGRAHSEVSTALVHALETAFAFFTGDLATALRAGPSF
CEADVSPTATALAALPTAHALAKTGRFGEVTGIAQIGLHAAARSRSGMIR
FGLGVAEVTALVDAGDYSAAERAAERYATMAAGVPEPDAMVGVLVGLVHL
ARGQLPLAASLFQDSTPVLTNAAPSLWPMLANAWSAQAEAARGNAVSASI
ALRHCEEAYGPQIAAFLPEVELARAWERVAHGQTSDARSLALRAAQIARR
SGMAAVEMRALHTAVRFGDRSHADRLADLAETLDAPLPNAIAAHARGLAD
RNADLLSATSDRFAIMGAFASAADAAAQASSEYGRAGQRGKQLELSTRTQ
WLAGQGEIRTPAVAAVTQPLPITDREREIAMLVAAGLANRQIADRLSVSV
RTVDGHLYRMFAKLGITRRDELIRLLDGVQSRA
333990123YP_004522737.1 hypothetical protein JDM601_1483 [Mycobacterium sp. JDM601]MVRRIRPPQPLAPHGIPGHLVGFVEALRDQGISVGPSETVDAGRVLAALG
LADREVLREGLACAVLRRPDHRDTYDAMFDLWFPAALGGRTVVVSDEPQS
ADDIPLPEDAEQMRAMLVDLLTANPDLAETDARLSAMIAAIVGAYGQYRS
SRGPSYSAYQALKALELDELEGRLLAGLLAPYGDEPSPTQEQIAKSVAAQ
RIAQLRKLVDAETKRRTAEQLGREHVQMYGIPQLSENVEFLRASGEQLRQ
MRRVVAPLARTLATRLAARRRRSRAGTIDLRKTLRRSMSTGGVPIDVVLR
KPRPARPELVVLCDVSGSVAGFSHFTLLLVHALRQQFSRVRVFAFIDTTD
EVTHLFGPEADLAVAIQRITRESGVYTRDGHSDYGNAFVSFAEKYPSVVS
PRSSLLVLGDGRTNYRDPGVGVLSHLVTASRHAHWLNPEPRHLWGSGDSA
VPRYEDVITMHECRSAKQLATVIDQLLPV
333990121YP_004522735.1 gamma-glutamyl phosphate reductase ProA [Mycobacterium sp. JDM601]MSVPVLPDLRQEVHDAARRARIASRALTSLSTVAKNSALNAAADALLAHA
DDVLAANVEDLAAARAAGTPEAMLDRLALNPQRVEGIAAGLRQVAGLPDP
VGEVLRGYTLPNGLQLRQQRVPLGVVGMVYEGRPNVTVDAFGLTLKSGNA
ALLRGSSSAAHSNRALVEVLRKALTDEDLPADAVQLLSAADRATVTHLIQ
ARGLVDVVIPRGGAGLIEAVVRDALVPTIETGVGNCHVYVHEAADLDIAE
EVLLNSKTRRPSVCNAAETLLIDRAIAGSAVPRLVDALTAAGVAVHGDAG
AAAAEDDLRREYLAMDIALSVVDGLEDAIDHINEYGTGHTEAIVTSNMAA
AQRFSEQVDAAAVMVNASTAFTDGEQFGFGAEIGISTQKLHARGPMGLPE
LTSTKWIVWGDGHTRPV
333990119YP_004522733.1 adenylate or guanylate cyclase [Mycobacterium sp. JDM601]MESAPSAAADDTANVERRRRWLPSRLSIQTKLMLILLLTSIVSVGVVGFV
EFQYGAAELQRSATSKLVQAREAQRRAVSSLFAEMTSSLIIFSGGAMASN
ALHAFTAGFDELARATVTPEQQRAIVGHYRDNFIEQLAERTGERADIAAL
LPASTAQRYLQAHYTAGYTGESDKPEDAGDGSAWSAANAEFNSFFAEIVK
RNEYLDALLLDTRGNVVYSANKGVDLGTNVLTGPYRESVLRDAYRKALAS
NAVNFVWITDYQPYQPNLDTPTAWLVSPVGVKGTVEGVLALPLPSAKVNR
IMTANRDWKAAQVGRTTETYLAGPDDLMRSDSRLFLEDPERYRSEAVAAG
TPVATVDRALKLGTTTLVQPVSSPGLRAAQRGQTGTLNTGYDYLGNRELA
AYAPLTIPNSDLQWSILATRDYSDAYAGVTSFSKRVVLATTGVIVAICVL
AMLLARLFLRPIRRLQAAAQRISAGDYTAAVPSGTADEIGDLTKAFNDMG
RSLRTKEELLNEQRKQNDELLLSLMPESVVRRYRGGEQAIAEEHHNVSVV
YAELQGIDQLSGEVAANELVTVVDELVRQFDAAAEVVGVERIRTMYNGYL
AGCGLTTPRLDGVHRIVEFASEMQRIVDRFNVKSGHRLSLWAGVNTGEVV
SGLVGRSGVTYDLWGSAVNLAYQLRRGTPQSGIYVTGAVRDMLGGGGEFT
PAGTVAIGDTEEQAWRLSEPT
333990117YP_004522731.1 hypothetical protein JDM601_1477 [Mycobacterium sp. JDM601]MPTVLIEVRRRYSQAEEVAIIDAVHGALVAAFQTPADDKNVRLVVHEPHR
FAVPEKFTRPEYRTLVSIDCFTGRTLEAKRKLYAEIVERLATLGIPIDHV
MITLHEVDRENWGIRGGQAASDVELGFNVRV
333990115YP_004522729.1 EntB protein [Mycobacterium sp. JDM601]MQLSGITRAMSDTAVAVVDMLNAYRHPDAAQLADNVAKIIEPLADLVERS
RADEQVDLIYVNDNHGDFTAGFTDIIGSALEGARPELVRPIVPTSGDRAV
SKVRHSAFYSTPLEYLLGRLGTRRLILTGQVTEQCILYTALDAYVRHLPV
VIPVDAVAHIDAALGDAALEMMCRNMAAERSTAAQCLR
333990113YP_004522727.1 sialic acid-transport integral membrane protein NanT [MycobacteriumMKQRLTSDQRNSFLAALLGWSMDAFDYFIVVFVYADIAKTFGHTKTEVAF
LTTATLAMRPVGALLFGLWADRVGRRIPLMVNVIFYSTVGFLCAFAPTFT
VLVVLRLLYGIGMGGEWGLGAALAMEKIPPERRGFFSGLLQEGYLFGYLA
ASLASLLVNDWLGLSWRWLFGLSILPAMISLLIRYRVTESEVWQATQDRM
RLTRTRIRDVFTDAKVIRRFCYLVLLMTAFNWMSHGTHDIYPTFLSSNDG
AGLSHVTAKWIAVIYNIGGIIGGLIFGSLSQRLGRRYAIIWAAVMGLPIV
PLFALSHSAGMLCLGSFLLQVCVQGAWGVIPAHLTEMSPDAIRGFYPGVT
YQLGNLLAAFNLPIQEHLAAANGYPFALVVTVVPALIAVVVLTAVGRDAT
GRSFGPT
333990111YP_004522725.1 cytochrome P450 [Mycobacterium sp. JDM601]MSAPSLSTRSYDAVDLSSRAFWSTTAVERERSFAVLRAERPVSWHPPVED
AMLNDPDDPGFWAVTRHADIVTVSRTNEVFLSGKGVMFENFPAELLETTQ
SFLAMDPPRHTKLRKLATAAFTPRQIRRIEDAIKASATAIVAELKAAGSG
ADFVECCAKELPLRTLADMVGIPESEREAVARAADALVSTNDPVFLDGRD
PLAVMGENIMYLHQLAGSLAAARRDKPGDDLFSSLVNAEVDGDRLTDAEI
AAYFVLLCVAGNDTTRQTTSHAVKALTDYPAQRGWLLEDFDRRIGVAVEE
FIRYATPVMTFRRTAATDCELGGQTIRAGEKVAMFYASGNWDETVFAGPD
SLDLSRDPNPHVGFGGGGQHYCLGTHVARAQLRAIFGELLRELPGIEAGD
PEYLAGSFIHGIRAMPCTF
333990109YP_004522723.1 hypothetical protein JDM601_1470 [Mycobacterium sp. JDM601]MSTVFTIDGAGWSGLLRFMCRGAVTRGKRIRNVKYPNTYVDGLRYVPAVE
AVKRGAQALDDMLTAHFDGHPDADDVLVYGVSMGAQVACKWLRERGPTST
VPVGKVSFLLLANPEQPFHGIYRADPKLVKFMTLPDYGGVGVPQHTPFAV
TDLCRQYDGMADFPNRPAAQVNSLAMRNALLGLVTVHNNYFRVDIQARDN
LRVRRGNITYVLCPTRRKRRQRIESSYDRSAWGGPASAR
333990107YP_004522721.1 GTP1/OBGfamily GTP-binding protein Obg [Mycobacterium sp. JDM601]MSRFVDRVVIHVRAGDGGNGCASIHREKFKPLGGPDGGNGGRGGSVVLVV
DPGVHTLLDFHFRPHIKAASGKQGQGSNKDGAAGSDLEIKVPDGTVVLDE
HGRLLADLVGAGARFEAAGGGRGGLGNAALVSRARKAPGFALLGEKGETR
DLTLELKTVADVGLIGFPSAGKSALVSVISAAKPKIADYPFTTLAPNLGV
VSAGDNTFTTADVPGLIPGASAGRGLGLDFLRHIERCAVLVHIVDCATAE
PGRDPLSDIEAIEAELAAYTPTMQGDSVLGDLVDRPRAVVLNKIDVPEAR
EMAEFVRDDIVAERGWPVFLVSTVSREGLRPLVFALAEMVTAYRAAQPEP
VARRPVIRPIRAGETGFSVEPDGDGGFVVRGSRPERWVHQTNFDNDEAVG
YLGDRLARLGVEDELLRLGATPGCAVTIGEMTFDWEPATPAGVDVTLSGR
GTDSRLERTERVGAAERKIARRQRREQSDEA
333990105YP_004522719.1 50S ribosomal protein L27 [Mycobacterium sp. JDM601]MAHKKGASSSRNGRDSNAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGIN
VGRGGDDTLFATAPGAVEFGLKRGRKTVNIVPVARVES
333990103YP_004522717.1 ribonuclease E Rne [Mycobacterium sp. JDM601]MPTEQEELPDRLRVHSLARVLGTTSKRVLDALTELDGRARSAHSSVDRVE
AVRVRDLLGSTEPPTTEVPGESGDAVDEPESRLLLETAPEAANARVDYMP
LFVAPQPVTFEPSPPRESDSESDDDDDLGSDGDDENGDRPASRRRRRGRR
GRGRGRGSDGAASDDVADAADTDDDSEDDDSAAESDETSDAEDTGDDDGD
AADESGSRRRRRRRRRKTGNGDDEDTGSSDDPPNTVVHERTPRKTTRSTK
SEKSSSDDEIQGITGSTRLEAKRQRRRDGRDAGRRRPPILSEAEFLARRE
AVERRMVVRDRVRTEPPHTGARYTQIAVLEDGVMVEHFVTSAASTSLVGN
VYLGIVQNVLPSMEAAFVDIGRGRNGVLYAGEVNWEAAGLGGANRKIEQA
LKPGDYVVVQVSKDPIGHKGARLTTQVSLAGRYLVYVPGASSTGISRKLP
DTERQRLKEILREVVPPDAGVIIRTASEGVKEEDIRADVERLQERWNQIE
ATAAETKSKAAGAAVALYEEPDVLVKVIRDLFNEDFSELVVSGDDAWATI
NDYVGSVAPELVSKLTRYTATEGPEGQAGPDVFAVHRIDEQLAKAMDRKV
WLPSGGTLVIDRTEAMTVVDVNTGKFTGSGGNLEETVTKNNLEAAEEIVR
QLRLRDIGGIIVIDFIDMVLESNRDLVLRRLTEALGRDRTRHQVSEVTSL
GLVQLTRKRLGTGLIEAFSTSCQHCAGRGIMLHADPVDSAAPGRRSEPSS
RRSRRSKKPKADEPVVAKVPAHTPGDHPMFKAMAAASDRGDDESDDDTEV
EATAASAAGEPRPAVEHEPQLPGTALAEDTDDADDAEDTDYTDDADDSYD
GEDSDDADDTDDGEDTEDTDEEVEVDLDDDDDDFDDDLDVIDEADDADDD
ESGQETLAAAAPYERPRRRRAAARPAGPPS
333990101YP_004522715.1 hypothetical protein JDM601_1461 [Mycobacterium sp. JDM601]MSDPTAAPDPWRGFRGVMSATLILEAIVVLLALPVVHVVGGGLSPVSLAY
LLGLALVLLLFTGIQGRPWAIWANLGLQLVLVAGFVVYPAVGIMGLVFAV
VWGLIAHFRAEVLRRQ
333990099YP_004522713.1 valyl-tRNA synthetase [Mycobacterium sp. JDM601]MTATPDAANTEHLPKSWEPSAVEDAIYQRWVDAGYFTADPASTKPGYSIV
LPPPNVTGSLHMGHALDHTLMDALTRRKRMQGYEVLWLPGMDHAGIATQS
VVERRLNAAGQTKEELGREGFVEQVWDWKRESGGTIGTQMRRIGDGVDWS
RERFTMDDGLSRAVRVIFKRLYDAGLIYQAERLVNWSPVLETAISDLEVK
YDDIEGELVSFRYGSLDDSQPHIVVATTRLETMLGDTAIAVHPDDDRYRD
LVGTSLPHPFLDREVGVVADAHVDPEFGTGAVKVTPAHDPNDFEIGLRHQ
LAMPTILDTKGRITGTGTQFDGMDRFEARVAVREALAGQGRIVAEKRPYL
HSVGHSERSGEVIEPRLSMQWWVNVSSLAKAAGDAVRNGDTVIHPKSLEP
RWFSWVDDMHDWCISRQLWWGHRIPIWHGPNGEKVCVGPDETPPEGWEQD
PDVLDTWFSSALWPFSTMGWPDATAELEKFYPTTVLVTGYDILFFWVARM
MMFGTFVADDPALQGGKVPFENVFLHGLIRDEHGRKMSKSRGNGIDPLDW
VDAFGADALRFTLARGASPGGDLSIGEDHARASRNFVTKLFNATRFALIN
GARPAPLPALDELTDADRWILGRLEEVRAEVDSAFEGYEFGRACEALYHF
AWDEFCDWYVELAKTQLGQGLAHTTAVLAAVLDTLLRLLHPVIPFVTETL
WQELTGAESLVIADWPEPSGIILDRVAAQRITDMQKLVTEVRRFRSDQGL
RDRQKVPARLSGIDDADLATQVAAVTSQAWLTEPGAHFAPSATVEVRLGA
AHSTSTVVVELDTSGTVDVAAERRRLEKDLAAAEKELVATAAKLGNEAFL
AKAPEAVVDKIRGRQQLARDEVDRITARLSALA
333990097YP_004522711.1 hypothetical protein JDM601_1457 [Mycobacterium sp. JDM601]MNPAPSPSSEPGAAGSVGSMSETPRELDVIVYGATGFVGKLTAQYLARVG
GETRVGLAGRSAERLRAVRDEIGSAAQDWPIVVADADKPASLEAMAARTR
VVITTVGPYTRYGMPLVAACAAAGTDYVDLTGEAMFVRESIDTYQKQAVD
NRARIVHACGFDSIPSDLSVYALYRAARDDGAGELLNTDFVVRGFSGGLS
GGTIASMTEVLRTASTDADARRQLFDPYTLSDDRGAEPDLGAQPDLPWRR
GRDIAPELTGIWTAGFVMAPYNTRIVRRSNGLLEWAYGRRFRYAEHMSVG
SSAVAPALSGLATGISAVTVGLGSRFFRLLPRRLVERVLPKPGTGPSQSR
RENGYYRVETYTTTSTGARYVADMAQQGDPGYQATSVLLAESGLALALNR
DALPDRFGVLTPAAAMGDALLARLRAAGVTLDVSRLN
333990095YP_004522709.1 hypothetical protein JDM601_1455 [Mycobacterium sp. JDM601]MPSRSGTTAGARAARRDDTRHRGSIHGPARGPAHTRFRGFNLFALHSGEG
KLTKRSCEKSNRMTRAFRRDNETITPARGMVSPGHLLLLVFLSVCRPDCF
S
333990093YP_004522707.1 pyruvate:ferredoxin oxidoreductase PorB subunit beta [MycobacteriumMTTTEPASSLVGTELGLTALTGVPTTDEPQKSKDFTSDQEVRWCPGCGDY
AILNSIRNFLPELGVRRENVVFVSGIGCSSRFPYYMNTYGVHSIHGRGPT
FATGLATARPDLSVFLVTGDGDALSIGGNHLIHTLRRNVNLTILLFNNRI
YGLTKGQYSPTSETGKITKSTPFGSLDNPFNPVSLAIGAEATFVGRALDS
DRKGLTEVLRGAMEHRGSALVEILQDCPVFNDGSFDLLRKEGAENRIINV
RQGEKITFGAEDEYCVIKSGFGLEVAKTANVSAEQIVVHDATLADSSYAF
ALSRLSEQDLSHFPMGIFRKINKPTYDDLARAQVAEARQASSHDTAALQA
LLRGRDTWTVD
333990091YP_004522705.1 linoleoyl-CoA desaturase [Mycobacterium sp. JDM601]MAISQVANYAHLSESDVEALGLELDAIRRAVEASLGAKDAAYIHRTIMFQ
RVLDVAARLVIHRSKTVLGWTVGTAALAVAKCVENMEIGHNVTHGQWDWM
NDPEIHSNTWEWDMTAVSSQWRYSHNYSHHVFTNIIGMDEDMGFGIMRVS
RDQPWGPGNLLQPLANLVLAAMFQWGVALHTLASGRSRALTDAEKSAATR
MFFRKAARQVTKEYLLFPALGGRRWRRTLAANAGANLIRNVWAYLVIFCG
HFPDGAEKFDPAVLKRETRSEWYLRQMLGSANFDAGPVLGYLSGNLCYQI
EHHLFPDLPSNRLPEIAVQVRALCDKYDLPYTTGPLPRQYLMVARTIVKL
ALPDRLPAAGPKSRDSRRRRLRAAPKP
333990089YP_004522703.1 homocysteine methyltransferase [Mycobacterium sp. JDM601]MANVGFAVPDDTVIVADGGLATELEARGFDLSGDLSDPLWSARLLLDAPD
DVAAVHAAFFAAGAAIATTASYQASFDGFAARGIDRRTAERLLRRSVDLA
RLAGGGARGHRVAASVGPYGAARADGSEYVGRYGLSVSELTAWHRPRLEV
LADAGADVLALETVPDVDEAEALMRLVSEAGVPAWLSYTIEGTSTRAGQP
LTDAFAVAAGVPQIVAVGVNCCAPDDVLPAIEIAREITGKPVIVYPNSGE
SWDGHRWVGPKTFSARFAAQWVAAGARIVGGCCRVGPADIAAAAAALRRT
CTQRENPAGDSQ
333990087YP_004522701.1 ATP-dependent Clp protease proteolytic subunit [Mycobacterium sp. JMSQPGLNLVDSVYERLLRERIIFLGSQVDDDIANRLCAQILLLAAEDPTK
DISLYINSPGGSISAGMAIYDTMVLAPCDVATYAMGMAASMGEFLLAAGT
KGKRYALPHARILMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFT
GQPIERIEADSDRDRWFTAQEALEYGFVDHIITRAHVNGDAS
333990085YP_004522699.1 esterase [Mycobacterium sp. JDM601]MGGTQHVRIHGSCSPRFERVRYEFERNFTLRDELGAAVAAYVDGELVVNL
WAGSADVDGQRPWQEDTLSTVLSGTKGLTSTCVHRLAEGGELDLRRPVAH
YWPEFGQAGKGDISLAMVLAHRSGAIGPREPMHWRDVTDWDLVCQRLAAA
EPWWRPGTAQGYHMTTYGFIIGEVVRRVTGMTVGQYLHSEVAGPLGAEVH
IGVPADQQPYRCADPVGKPTIREMLASAGAPKRPTSLDHHSKAGLAVAMG
FAPDDEIATNDLTLWRQLEFPGTNAQVSALGMATFYNALVQEKLLSRPTM
DRLRVLQGGTETDLVLGPRVAEHGWGMGYMLNAQGVNGPNRRIFGHGGLG
GSFAFVDLEHRIGYGYVMNRFDHTQANADPRSVVLSNEIYRALGVPIRPR
RETVYDD
333990083YP_004522697.1 ribose/galactose isomerase RpiB [Mycobacterium sp. JDM601]MTAMRVYLGCDHAGYELKEQILEHLKQAGHEPVDCGAFAYDAEDDYPAFC
IAAAARTVADPGSLGIVIGGSGNGEQIAANKVPGARCALAWSTETAKLAR
EHNNAQLIGIGGRMHSTAEALAIVDAFLSTPWSEAERHQRRIDILAAYER
SHEAPPVPGAPA
333990081YP_004522695.1 aminopeptidase [Mycobacterium sp. JDM601]MALPNLTRDQAAERAASITVDNYRIALDLTDGSGNPGERTFRSTTTVTFE
ALPGANTVIDIAARTIRAATLNGRALDVSAYDESIGIELTGLAERNVVEV
DADCYYSNTGEGLHRFVDPVDDEVYLYSQFETADAKRMFACFDQPDLKAT
FDIAVTAPRHWQVVSNGATIAVEDGVHTFATTPKLSTYLVALIAGPYARW
DDVYRDEHGEIPLGLFCRASLAEHMDAERLFTETKQGFGFYHRNFGVPYA
FGKYDQLFVPEFNAGAMENAGAVTFLEDYVFRSKVTRASYERRAETVLHE
MAHMWFGDLVTMRWWDDLWLNESFATFASVLCQSEATEYTSAWTTFANAE
KSWAYRQDQLPSTHPIAADIGDLAAVEVNFDGITYAKGASVLKQLVAYVG
LDHFLAGLRDYFAAHAFGNATFDDLLAALEKASGRDLSDWGRQWLKTTGL
NTLRANFDLDDAGKFTRFAVTQDGAAPGEGETRVHRLAIGIYDDDGAGRL
VRTHREELDVEGPATAVPALEGVSRGKLILVNDDDLTYCALRLDEESLAT
ALERIADIAEPLPRTLVWSAAWEMTREAELRARDFLALVQGGIQAETEVG
VASRLLLQAQTALGFYAEPGWAAEHGWPAFADRLLELARAAEPGSDHQLA
YVNALCTSVLSERHTVVLAALLDADPADQGLAGLAVDTDLRWRIAVALAR
GGLLDSEAIDAEIRRDPTAAGKRQGAQASAARPLPEVKQAAWQQVIEDDT
LANITGRAIIAGIVQPGQGELLAPFTEKYFAAIRGVWERRSSEVAQTVVV
GLYPGWDVSQAGLDAAEAFLADPAVPPALRRLVLEGRAGVERSLRARTFD
AACTDTAGTDSA
333990079YP_004522693.1 hypothetical protein JDM601_1439 [Mycobacterium sp. JDM601]MATGEVATIDPADLPYGSAITYSGRISGVTEPGEASLHYPFPIKELVALD
DALTYGSRQTNARFAVYIGDLGSDTAAQAREILAKVPTPNDAVLIAVSPD
QRAIEVVYGAGVADRIAPVAAPQGVAAAAAAFSDGNLIDGLVSAVQVLSA
GITPA
333990077YP_004522691.1 hypothetical protein JDM601_1437 [Mycobacterium sp. JDM601]MIMVLAAAVQLEAVLGDVSANLAACERLADEAGRAGAEIIALPEFFTTGI
GFDESLATAALPPDGAATELLTALARRHRALVGGSFLCRDPDGHVRNAYL
LAGPPGGSARLDEGEPKLGPPHQHRGSARLDEGEPKLGPPHEHSGSARLD
EGEPKLGPPHEPGVVGRHDKDLPTMWENAFYTTGDDDGVLATAGHTVGAA
VCWELMRTQTVRRLRGRVDLMMTGSGWWSIPRWVPHRLFDRLERNNAGTA
RRAAASFAQYVGAPMVHAAHAGTLTCAMPWLPLTYRGHFEGATLIAGADG
TVVAERRADEGEGIVLGEITLGRQPPRLDPPAGFWLHRRGTLPTAVWHYQ
RWHGRRWYRHYVVQAT
333990075YP_004522689.1 globin (oxygen-binding protein) GlbO [Mycobacterium sp. JDM601]MVAMQPIEEPSFYDAVGGAETFHAIVSRFYQLVAQDAILRPMYPADDMDG
AEERLRMFLEQYWGGPRTYSERRGHPRLRMRHIPYRIGPLQRDAWLRCMV
TAINEIDGDTLDDARRAELLDYLHSAADFLVNAPI
333990073YP_004522687.1 hypothetical protein JDM601_1433 [Mycobacterium sp. JDM601]MTGSTAATGFVAAVPVRWSDIDMYQHVNHATMVTILEEARVPFLSPAFAV
DITSVGLLIAEVKVTYKGQLRLTDSPLQVTMWISRLRTVDFTIGYEVRSV
SAAPDSKPAVVAESQLAAFSIDEQKLVRLSPQHREYLQRWTR
333990071YP_004522685.1 ABC transporter ATP-binding protein [Mycobacterium sp. JDM601]MAEFIYTMRKVRKAHGDKVILDDVTLSFLPGAKIGVVGPNGAGKSSVLRI
MAGLDTPNNGDAFLSPGASVGILQQEPPLNEEKTVRGNVEEGLGDIKVKL
DRFNEVAELMATDYSDELMEEMGRLQEELDHANAWDIDSQLEQAMDALRC
PPPDEPVTNLSGGERRRVALCKLLLSKPDLLLLDEPTNHLDAESVQWLES
HLASYPGAILAVTHDRYFLDNVAEWILELDRGRAYPYEGNYSTYLEKKAE
RIAVAGRKDAKLQKRLQEELAWVRSGAKARQAKNKARLQRYEEMVAEAEK
TRKLDFEEIQIPTGPRLGSQVVEVEHLDKGFGGRMLIKDLSFTLPRNGIV
GVIGPNGVGKTTLFKTIVGLEEPDSGTVKVGETVKLSYVDQSRAGIDPKK
TVWEVVSDGLDHIQVGQNEIPSRAYVSAFGFKGPDQQKPAGVLSGGERNR
LNLALTLKEGGNLILLDEPTNDLDVETLGSLENALVNFPGCAVVISHDRW
FLDRTCTHILAWEGDADDEAKWFWFEGNFGAYEENKIERLGAEAARPHRV
THRRLTRD
333990069YP_004522683.1 hypothetical protein JDM601_1429 [Mycobacterium sp. JDM601]MAITALDGDVTRQPAEAAKGYAKIRYRGAPAYVEFVVFGGDLYVSQDDGR
WIDYGPAANFYDVASILSPDTGLAEMLTEFIDPEVEGRETIDLGTDEVHT
VRISGQVSARAAKKIVPQLQATKRTSCTVWIQETGDHHLVALKLASGADE
SVVITFSNWNAPVNVGKPRV
333990067YP_004522681.1 ABC transporter permease [Mycobacterium sp. JDM601]MQRSIAGTAVGNFMEWYDFGIYGFLATTLAQVFYPGDSSSAVGLIATFGT
LAAAFAVRPFGGIFFGALGDRIGRKKVLIMTVSLMAIGTTITGLLPSYEA
IGIWAPILLIITKLMQGFSTGGEYVGAMTYVSEHAPDRSRGALTGYLPLG
TLGGYITGAGVVTLIQSQLPVSDMLHWGWRVPFLLGVPLAIVTLYMRLRI
DESPAFEELGQAGEDNSVAGETGWQQFRQTVVGQRSGLLICMGLVLAENV
TNYMLTGYLPTYFKQVGGISGSRGLTMIVVALVMMLIVVMPLARLSDRIG
RKPLLWTGSALLIFGSVPAFLLIRHGGSYPIRLLGVLLIGLMLVCFNSTT
PSTLPALFPTQVRFFAVAIGFNISVSLFGGTTPLVAETLVSGTGNVMLPA
FILMAAGVVGAITLWFTPETAGKVLPGSGPSVATEQEADAIARTGLRE
333990065YP_004522679.1 glycerol-3-phosphate acyltransferase [Mycobacterium sp. JDM601]MTTSPATDPADHSGSIMTGDTLVLAFVSSEVEAGLVRDWLDRYRQANPEV
HAELFPLEPDRPPSTMARLVGQLERDEQRSILPVRVFWMPRAGASALSRV
AALLPGRNPYRPGERQQRQIVRTDSTLARVVAGEPASVAHLREQWSENTV
GDNPRDFAHFVTRRAVLALERAEYRILGPQYKSPRLVKPEILASTRFREG
LKAIPGATLEEAGKMLDELSTGWSRVSVDLVGVLTRMLSRGFDPEIDYDE
YQVAALRTALESHPAVLLFSHRSYIDGAVMPVAMAENRLPPVHVFAGINL
SFGLMGPLLRRSGVIFIRRSIGNNPLYKYVLKEYVGYVMEKRFNLSWSIE
GTRSRTGKMLPPKLGLMTYVADAYLDDRTDDVLLQGVSISFDQLHETDEY
AAYARGGEKTPEGARWLYRFIKAQGERNYGKIYVRFPEAVSMRQYLGAPD
GPAATDPDAKRLAMQKMAIEVAWRIQRVTPISATGLVSALLLTTHGLALT
LDQIHHSLQDGLDFLERKQTPISTSALRLRSRDGVRAAVDAMSNGHPVTR
VDGGRESVWRIAPEDEHAASFYRNSVIHAFLETSIVELALAHARRGGGDR
LDAFWTQAMRLRDLLKFDFYFADSATFRDNIAEEMSWFSDWESRVAAGGA
EVDGILSEKTPVTSDVMLRVFFEAYEIVADVLCDAPPDIGEQELTQSALG
VGRQYVAQGRVRSSESVSTLLFATACQVVADQKLLENTPDLAERRRAFRA
ELRSILKDSDHIARIARQAFAARDTEMRRHRRGVAGQ
333990063YP_004522677.1 hypothetical protein JDM601_1423 [Mycobacterium sp. JDM601]MGDLVDAAGLPTELGAVDYLLHRGEANPRTRSGIMGLELLDTTPDWNRFR
GLFENVSRRVLRLRQKVVVPTLPTAAPRWVVDPDFNLDFHVRRLRVPEPG
GLREVLDLAEVSLQSPLDIQRPLWSATLVEGLDGGRAATLLHLSHAVTDG
VGGAAMFGQIYDLERDPPARAMPPQPVPQDLSANDLMRDGINQLPATVLG
GTRDVLFGALSMATRTVRDPLSAVAGAIGYARSSARVMSQAAEPSPLLRR
RSLTSRTQAIDIRLSDLHRAAKAGGGSINDAYLAALSGALGRYHRALGVP
IATLPMAIPVNLRAEADPAGGNRFTGVNLAAPIGVADPVERMKRIRSQMT
RRREEPAMDVIGSVAPLLSVIPTPVLEKMTESVVGADVQASNVAFYPGDT
YIAGAKVLRHYGIGPLPGVAMMVVLISRGGECTITVRYDRAAVRDEKLFG
ACLVQGFDEVLALAGEPAPRCVAASFDPGAES
333990061YP_004522675.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MTQSDLVLFSVTERVALITVNDPDRRNAVTGVMSAQLRAAVQRAEADPNV
HAVVVTGAGRAFCAGADLSALGAATEDGLLALYDGFMAVAQCTLPTVAAV
NGAAVGAGLNLALAADVRIAGPAAVFDARFQQLGLHPGGGATWMLHRAVG
PQVARAALLFGMRFDAQAAVQHGLALHVADDPVDAAITLAAGPASAPREV
VLATKATMRATASPGAVEGEQHEFAKRTELGPQAATVESPEFASRLAAAR
RR
333990059YP_004522673.1 pyruvate dehydrogenase E1 component subunit PdhB [Mycobacterium sp.MTQILEPPTRSPATAPTAGSNPGAEQLTMVQALNRALRDAMDADPKVLVF
GTDVGVQGGVFRVTEGLAETFGEQRCFDTPLAESAMIGIAVGLAVRGFVP
VPEIQFDGFSYPALDQMVSHLAKYRTRTRGEIPMPVTVRIPSFGGIGAAE
HHSESTETYWAHTAGLKVVVPADPSDAYWLLRHAISAPDPVIFLEPKRRY
WARGTVDTARPQPGIGRAAVRRTGTDVTVLTYGGGVATALAAAEIGARQH
GWSLEVVDLRSLVPLDFDTVAASVRRTGRCVVLHEGPRNLGYGAELAARI
QEELFYELEAPVLRATGFDTPYPPARLERLWLPGPDRLLDCVQRVLEAP
333990057YP_004522671.1 GntR family transcriptional regulator [Mycobacterium sp. JDM601]MTVQYSITGAGAESIAASIEDGISDGQLAPGSALPPIRDLAGRLAVNPNT
VAAAYRLLRDRGAVETAGRRGTRVRDRPATTPRSLRGLTVPAGVRDLSTG
NPNPALLPIAGARLSPPATPVLYGQPPVSPELADHARAALEADGVAAEHL
AVASGALDAIERVLAAHLRPGDRVAVEDPGWANLLDLLGALGLAVEPVGG
DDDGPLVTDLARALRRGVRAVVVTSRAQNPTGGAMSAERAAALRAVLAES
ATDVLLIEDDHCAGVAGMALHPLAGVVRDWAFVRSVAKAYGPDLRLALVA
GDRRTIERVQGRQRLGPGWVSRLLQDVVVGMWRDRAATRLVADAEAVYTD
RRTRLCAALAERGLACHGRSGLNVWIPVPDESAAITRLFAAGWAAAPGSR
YRIGSPPGIRITISDLAAAEIGPLADAVADSLSGTGTVSV
333990055YP_004522669.1 multicopper oxidase type 3 [Mycobacterium sp. JDM601]MFLGANIVVLVWLAVSVALLIGHNAIAHPIWLPVHALLLGAATNAIVIWS
GHFTTTLCRVPDPPHWHLVAKLAVLNTGVIAALAGVTWNTEALTGIGGAV
VAVVGVAHGAELIAMKKSALSARFDYLVGFYLAALVALLIGSAAGATMAF
GVARWYARLWTTHVHVMLYGWIGLTVVGTLFTLWPTTIREKITPRSFAMA
RRALPTLTAGLAIATAGLLADSWWLAAAGLAGYAIGAGLAIVGLWPGRSF
TGPAAWMLVGATGWLGVAVVTEVVALIAGRSVDVLPAFVEHTLLPLLAVG
FVAQILLGALSQLLPILVAHGPPIRKAVIAYLDQGWQVRVAAINVAVPLV
AGPWRGPLPIVGWVLAAVAVASFVLLALRLALPVALRGPIDVEAIKPHSA
AVTGAVAVAAVAAVASALILGAPASSEVADVAGEAHTVEVTLNNMRFSPD
VLEVAAGTRLVLRVTNIDGLPHDLHVDTGEHTPRLSRGQTAVLDLGVIRQ
DRDVWCDVPGHRAAGMTMTIHAVGGVPRHEHTGGDHGGGVPVPATLNLAA
DPSPGWRPYDAVLAPATPGVHRVELRAVDRELEVAPGRREIRWTFGGSEP
APTLHGRVGDTFEITLINDSTMGHGIDFHAGALAPDQPMRTLEPGERLVY
RFTARRAGAWLYHCSTPPMTLHIANGMYGAVIIDPPGLPAVDREYALVGA
QLYAGAPDADAKTTAIRAGQPDGWMFNGTAAQYMHAPLPARAGERVRVWV
VNAGPGDTIAFHIVGTQFDTVYKEGAWLLRPPHQPGGPGGSQVLDLAPAQ
GGFVELTFPEPGHYPFMDHDMRHAENGAHGIFEVAG
333990053YP_004522667.1 hypothetical protein JDM601_1413 [Mycobacterium sp. JDM601]MSAATRPGAIRLEDLANPVFPEAARPMREGLAGYGAVLQLTPEALLQAAT
ERTGLDNWGDNAFRERLDVLCGSLVDEAELSGVGRAMAFEQLAGHLVNRL
RLEDLIATNPEIEDVAIERPIIICGLPRTGTTHLHNLIAADPALRYLPYW
ESLEPIATPGEPDPQARRDRCAVGLDLINTSMPEFKRMHDMTVDHAHEEI
QLLGNDISGMLFECSYFLPTFAQHYKATTRPRHTPT
333990051YP_004522665.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MGNDDRVTAPQSAPTARGRPRNPRTEQAIAEAARRLLARDGYDQVSIEAI
AREADVSRPTVYRRWPSKTHLVFDAVFGSTVGDLLTSSGDFEADLRRFVA
GVFAFWRSPEVAAAALGILADRHRDSELFIRTQQLLDEQTRTAFGELIST
GIDQGVLDADVDVEIAYDLLVGTSFYIAQVLAADTVDSAADRLCSLVLQG
MRKKENRDG
333990049YP_004522663.1 ketopantoate reductase ApbA [Mycobacterium sp. JDM601]MKIAVIGCGAMGSIYAGRLAAAGNDVLALDRSPAHVEAINRDGLRISGPQ
SDQVVAMRAAAEAPAEPMGLVVLAVKAADVAAGATQALPLLGEDTPVLTI
QNGLGSADTVADIVGAERVAVGIASGFGASRPAPGHAHHNAMRAVRFGAY
AALPFSAVEEIARVWTDAGFDAAAVADIAAMQWEKLICNVAYSAPCALTG
MTVGQVMDDADMGPVSRAAATEAWAVARAAGIDIAVADPVAHVRAFGAQL
PDAKPSALLDHLARRVSEIDVINGAVVRQAAQVEQQAPVNMTLTALVKAV
ERQWMTPED
333990047YP_004522661.1 citrate (pro-3s)-lyase subunit beta CitE [Mycobacterium sp. JDM601]MNLLSTGPAWLFCPADRPERYAKAAAVADVVILDLEDGVAAADRPAAREA
LRDNPLDPERTVVRINPAGTEDQSRDLAALADTAYTTVMLAKTESAAQVD
ALAPRQVVALAETPRGVVFATEIAAARACAAMMWGAEDLVAAMGGGSSRH
ADGRYRDFARHARSTVLLAASAFERAALDAVYLNIGDLDGLRAEALDGAA
VGFAATVCIHPTQVPVVRDAYRPAEDKIDWARRVLAAAQHERGVFAFEGQ
MVDSPVLRHAEAILRRAE
333990045YP_004522659.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MTTIMAGELPKEYQDLQHTVAEFARTVVAPVSAKHDEEHSFPYEVIAKMG
EMGLFGLPFPEEYGGMGGDFFALTLALEELGKVDQSVAMTLEAGVGLGAM
PIYRFGTEEQKQTWLPDLVAGRALAGFGLTEPGAGSDAGGTRTTARLDGD
EWVINGAKQFITNSGTDITSLVTVTAVTGTAPDGRKEISTIIVPSGTPGF
TVEPAYNKVGWNASDTHPLTFADARVPQANLLGEQGRGYANFLSILDEGR
IAIAAVATGVAQGCVDESVKYAGEREAFGQPIGSYQAISFKIARMEARAH
VARTAYYDAAAKMLAGKPFKKEAAIAKMISSEAAMDNARDATQIHGGYGF
INEYPVARHYRDSKILEIGEGTTEVQLMLIARSLGL
333990043YP_004522657.1 acetyl-/propionyl-CoA carboxylase subunit beta AccD [Mycobacterium MTAPAFADEHRRLVAELNTKLATAALGGSEQSRQRHVSRGKLLPRDRVDR
LLDPGSPFLELAPLAADGMYDDECPGAGIITGIGRVSGRECVIVANDATV
KGGTYYPVTVKKHLRAQEVALGNRLPCIYLVDSGGAFLPRQDEVFPDREH
FGRIFYNQATMSAAGIPQIAAVLGSCTAGGAYVPAMSDEAVIVREQGTIF
LGGPPLVKAATGEVVTAEELGGGDLHSKVSGVTDYLADDDEHALRIVRQI
AQTFGPRPESPWEIKRSVDPHHDPAELYDVVPPDPRVPYDVRQVITRIVD
GSEFSEFKAEYGKTLVTAFARIHGHPVGIIANNGVLFGESALKGAHFIEL
CDKRSIPLVFLQNIAGFMVGRDYEAGGIAKHGAKMVTAVACARVPKLTVV
IGGSYGAGNYSMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVRGDQL
DAAGKPWSAEDEEAFKAPIRDQYEAQGNPYYSTARLWDDGIIDPADTRTV
LGLALSACANAPLDPVSYGVFRM
333990041YP_004522655.1 succinyl-CoA:3-ketoacid-coenzyme A transferase subunit alpha ScoA [MAMDKVVATAAAAVADVTDGASLAVGGFGLCGIPEALINAVLQLGVTDLE
TVSNNCGVDGIGLGVLLEHKRIRRTVSSYVGENKEFARQFLSGELEVELT
PQGTLAERLRAGGAGIPAFYTPTGVGTQVADGGLPWRYDGAGGVAVASPR
KETRDFDGRTYVLERAIRTDFALVHAWKGDRHGNLVYREAAANFNPDCAA
AGRITIAQVEHLVEPGEICPAEVHTPGIHVHRVVHVPNPEKRIERETVR
333990039YP_004522653.1 regulatory protein [Mycobacterium sp. JDM601]MAASAPAGPAGNDEPANRRSRLKSDRRSQLLTAAERLFAQRGFLAVRLED
IGAAAGVSGPAIYRHFANKEALLVELLVGISTRLLAGARAVESGGRSPDA
VLDGLIEFHLDFALGEPDLIRIQDRDLAHLPAGAQRQVRSAQRQYVEVWV
GVLCARHAGLAEADARLMAHAVFGLLNSTPYSVKPAGAKSAAPERSRAVL
RAMTISALGAAGISMG
333990037YP_004522651.1 integral membrane leucine and alanine rich protein [Mycobacterium sMAWALWDTGAAAVSAIAVTFVFSVYLTSSVGRDLPGSVSPASWLGRTLAI
SGLTVAVVAPVVGVWVAAPHRRRVTLTVLTGTAVVLIASMSMIRDSPAYL
APGLLLLALTAACGDLASVPYNAMLRQLSTPQNSGRISGFGWAAGYAGSV
VLLLVVYVGFISGSGPERGLLGVPVEDGQNVRAAMWLTAAWLAVFALPLL
FTAHRFAGADGPRPPRLGLFGGYRQLWRDITGEWRRDRNLVFYLVASAIF
RDGLAGVFAFGAVLGVNVYGISAGDVLIFGVAASVVAAVGAVAGGLLDDR
IGSKTVIVGSLAAMVAAGTTLMTLSGPGAFWACGLLLCLFIGPTQSSART
LLLRMAQEGREGFEGVAFGLYTMTGRAVSFLAPWLFSVFVDVFHSDRAGM
GGLCTVLVLGLLAMLGVRAPRRAA
333990035YP_004522649.1 hypothetical protein JDM601_1395 [Mycobacterium sp. JDM601]MSPDSAANAAQQIAAGYTAEGQALELGTVVIDGTADPTAQVRIPLATLNR
HGLVAGATGTGKTKTLQVIAEQLSAAGVPVVMADVKGDLSGLSRPGESGN
KISERATDTGDEWTPTEFPTEFLSLGTDGIGVPVRATISSFGPILLSKVL
GLNATQESTLGLIFHWADQNGYLLLDLKDLRSVISYLTSDQGKPALKQLG
AVSPATAGVILRALVNLEAEGADTFFGEPELDPNDLIRLDSQGRGIISLL
ELGDQAARPVLFSTFLMWVLADLFTFLPEVGDLDKPKLVFVFDEAHLLFS
DASKAFLEQVEQTVKLIRSKGVGVLFCTQLPTDVPNAVLSQLGARIQHAL
RAFTPDDQKALSKTVRTYPKTKVYELESALTSLGIGEAIVTVLSERGAPT
PVAWTRLRAPRSLMAAIGADAVAAAAKASSLQSTYGPTVDRESAYELLSE
KLAAGQGSRPPQGDGAAVPEPKRLRWWQRFGRWLSHFLSTREGKRVVSAV
TTVVVGQITRGAMGTGRRKR
333990033YP_004522647.1 hypothetical protein JDM601_1393 [Mycobacterium sp. JDM601]MPAPQALPPGIANERGMQVKTILLSRSISEAFPQVHNMIGVRPDGQRWHP
SGLAIDIMIPNPGSPEGIALGDEIVAYALRNAGRFALQDAIWRGTYYTPA
GPSGGGNGHYDHVHITTFGGGYPNGSEEYLREEGEPAPA
333990031YP_004522645.1 hypothetical protein JDM601_1391 [Mycobacterium sp. JDM601]MDRVERYPVRLSSASLVAVVVSAIDSPHVRFARRVKWR
333990029YP_004522643.1 hypothetical protein JDM601_1389 [Mycobacterium sp. JDM601]MEFVLHLDTTRRSAGQATRIAAAGIALAGAGLIAVNPVAPALQDFRHHAV
QLTGWESLFERTNESIAALTENSNVNALLDQYASNQSDYLQLIMGMENVP
LDMRPQDLPDGRTITSGFAGIERAVDLLINGDGGQAMAEGHFKYPGLEEL
MSQISGSENSFEAFNYVNIWLLYGIEEAGKALGPVLSIPALEAMNQSSLL
NEFIGPLVGWAFIKQASDALMAPTIGAIYQLVENIGAASGGDLEALFNLP
ADVLNSYLNGYVVPETGDVFTGLLTEGGIVDLLTNEWAARAAEAITVGTA
HLPVNAVDVPDPGEAGADLFDGDFLSSLFDGSIWGA
333990027YP_004522641.1 bacterioferritin comigratory protein Bcp [Mycobacterium sp. JDM601]MEDRATESVRLTPGDEAPAFSLPDADGNTVSLADYRGRRVVVYFYPAAST
PGCTKQACDFRDDLGDFNDAGLDVVGISPDKPAKLAKFRDAEGLTFPLLS
DPDRTVLAAWGAFGEKKMYGKTVQGVIRSTFVVDEQGKIAVAQYNVRATG
HVAKLRRDLSV
333990025YP_004522639.1 acetylornithine deacetylase ArgE [Mycobacterium sp. JDM601]MSDLVQRVHDILPSVRADLEELVRIESVWADPARRPEVQRSAQLSADLLS
QAGFPDVRIVAEGGAPAVIARYPAPQGAPTVLLYAHHDVQPEGDATQWAS
PPFEPTERDGRLYGRGSADDKAGIATHLAAFRAHDGRPPVGVTVFVEGEE
ESGSPSLGALLAAHRDALRADVIVIADSDNWSTEVPALTVSLRGLADCVV
EVATLDHGLHSGLWGGVVPDALSVLVRLLASLHDDDGNVAVAGLHEEGRG
PSDFPAYPPERVRADTGLLDGVAEIGSGSVPQRLWAKPAITVIGIDTTSI
AASSNTLIPRARAKISMRVAPGGDAAKHLDALKSHLEQHVPWGAQLTVTP
GDIGQPYAIDATGPVYEAARAAFRQAWGVEPVDMGMGGSIPFIAEFAAAY
PQATILVTGVEDPAAQAHSINESLHLGVLERAATAEALLLAKLGTSTG
333990023YP_004522637.1 fatty acid synthase Fas [Mycobacterium sp. JDM601]MTIHEHDRVSAGGTGSGPFANASSALVDRLTAGEPYAVAFGGQGSAWLES
LEELVSSAGIETELATLAGEADLLLEPVAKELVVVRPIGFEPLQWVRALA
AEDPIPSAKQLTSAAVSVPGVLLTQIAAVRALERQGLDLAAAPPVAAAGH
SQGVLAVESLKAGGTADVQLLAIAQLVGAAGTLVARRRGISILGDRPPMV
SVNNADPERIQELLEEFATDVRTVLPPVLSIRNGRRAVVITGTPEQLSRF
ELYCEQIADKEAAERKNKLRGGAVFAPVFEPVQVEVGFHSPRLSDGIEIV
GKWAAQIGFDADGVALARSMAESILVDQVDWVDEITALHDAGARWILDLG
PGDILTRLTAPVIRGLGIGIVPVATRGGQRNLFTIGAVPEVARPWTSYAP
SVVQLPDGRIKLDTKFTRLTGRSPILLAGMTPTTVDAKIVAAAANAGHWS
ELAGGGQVTEEIFNDRVAELTTLLEPGRTVQFNSLFLDPYLWKLQVGGKR
LVQKARQSGAPFDGLVISAGIPELEEAVELIGELNEAGISHVVFKPGTVE
QIRSVIRIAAEVPTTPVIAHVEGGRAGGHHSWEDLDDLLLATYSELRSQP
NITLCVGGGIGTPERAAEYLSGRWSQDHGFPLMPVDGILVGTAAMATKEA
TTSPAVKQMLVDTTGTDHWIGAGKAQGGMASSRSQLGADIHEIDNTASRC
GRLLDEVAGDADAVTARRDEIIAALADTAKPYFGDVTEMTYAQWLRRYVE
LAIGDGDSTADTASPGSPWLADTWRERFGSMLQRAEARLNEVESGPIETL
FTVGDAALLERPADAIAALVARYPDAETVVLHPADAPFFTQLCKTPGKPV
NFVPVIDKDVRRWWRSDSLWQAHDARYTAEQVCIIPGITAVAGITRVDEP
VGELLDRFEQAAIDQVLAASKNDGVQPRPVTARRQGRLDVTGPLAVLLDA
PDVLWAGRTATNPVHRIGASDEWQVQENRAATHPTTGARLEVSSDRNVEL
SVPLSGVWITIRFTVPPSVADGATPLVSTEDAAAAMRAVLAIAAGVDGPG
ALPPVVDGAATVTVEWNPEQVADHTGVTATFGAPLAPGLSTVPDALVGRC
WPAVFAAIGAATTDAGFPVVEGLLSLVHLDHAAHLLAALPAEPAELSVTA
TASAATDTEVGRVVPVSVTVAAADGTVLATLEERFAIRGRTGAAELTDPV
RAGGAVSDNATDTPRRRRRDVTVTAPVDMRPFAVVSGDHNPIHTDRAAAL
LAGLAGPNGEGGPIVHGMWLSAAAQHVVTATDGQARPPARLVGWTARFLG
MVKPGDDVDFRVDRVGIDLGAEVLEVSARIGSDLVMSATARLTAPKTVYA
FPGQGIQHKGMGMEVRARSKAARKVWDSADKFTRETLGFSVLHVVRDNPT
SLIASGVHYQHPEGVLYLTQFTQVAMATVAAAQVAEMREQGAFVEGAIAC
GHSVGEYTALACVSGVYELEALLEVVFHRGSKMHDIVPRDALGRSNYRLA
AIRPSQIDLDDADVTAFVAEIAERTGEFLQIVNFNLRGSQYAIAGTVAGL
EALEEEVERRREISGGKRSFILVPGIDVPFHSSVLRIGVDDFRRSLERVM
PRDKDPDLIIGRYIPNLVPKPFSLDREFIQEIRDLVPAEPLDEVLADYDT
WRNEKPAELCRKVVIELLAWQFASPVRWIETQDLLFIEEAAGGLGVERFV
EIGVKSAPTVAGLATNTLKLPEYAHSTVEVLNAERDAAVLFATDEDPEPE
DEPVAEDSDAGAPEGRTEPDAAPAVAAAAPAAPSGGPRPDDIGFDAADAT
LALIALSAKMRIDQIEALDSIESITDGASSRRNQLLVDLGSELNLGAIDG
AAEADLAGLKSQVTKLARTYKPYGPVLTDAINDQLRTVLGPSGKRPAAIA
ERVKKTWELGDGWAKHVTVEVALGTREGSSVRGGALGGLHEGALADAAAV
DKVVDSAVAAVAARHGVSVGLPSAGGRAATVDAAALGEFTEQITGRDGVL
ASAARLVLGQLGLDDAVIAPDSASDSELIDLVSAELGSDWPRLVAPVFDG
RKAVLFDDRWASAREDLVKLWLTDEGDIDADWPRLAERFEGTGHVVATQA
TWWQGKALAAGRQIHASLFARIAAGAENPGKGRYAHEVAVVTGASKGSIA
ASVVGQLLDGGATVIATTSKLDDDRLGFYRNLYRDHARFGAALWVVPANM
ASYADIDALVEWVGTEQSENLGPQSIHLKDAQTPTLLFPFAAPRVAGDLS
EAGARAEMEMKVLLWAVQRLIGGLSKIGAERDIASRLHVVLPGSPNRGMF
GGDGAYGEAKAALDAVVARWKAESSWASRVSLAHALIGWTRGTGLMGHND
VIVDAVEEAGVTTYSTEQMAAMLLGLCDVESKVAAANAPIEADLTGGLAE
ANLDMAELAAKAREEMTAAAGEDTAEAAESANTIAALPSPPRGYTPAPPP
AWDDLDVDLADLVVIVGGAELGPLGSSRTRFEMEVSGELSAAGVLELAWT
TGLIKWEDDPTPGWYDTETGELVDESELVERYHDTVVERVGIREFVDDGA
IDPDHASPLLVSVFLDKDFSFVVSSEADARAFVEFDPEHTVVRPVPDSSD
WQVIRKAGTEIRVPRKSKLSRTVGAQIPTGFDPTVWGISQDMATSIDRVA
LWNIVATVDAFLSAGFTPTELMRWVHPSLVASTQGTGMGGMTSMQTMYHG
NLLGRSKPNDILQEVLPNVVAAHVVQSYVGSYGAMIHPVAACATAAVSVE
EGVDKIRLGKAELVVTGGYDDLTLEAIIGFGDMAATADTEMMRAKGISDS
KFSRANDRRRLGFVEAQGGGTILLARGDLAAKMGLPVQAVVAYAQSFADG
VHTSIPAPGLGALGAGRGGKDSLLARSLAKLGVGPDDVAVVSKHDTSTLA
NDPNETELHERLADSMGRSDGAPLFVISQKSLTGHAKGGAAVFQLMGLCQ
VLRDGVIPPNRSLDCVDDELATAGHFVWVREPLHLGEKFPLKAGLVTSLG
FGHVSGLVALVHPAAFLAALDPSQREAYLEQASSRVLDGQRRLASAIAGG
RPMYERPADRRFDHDTSEKRQESAMLLNPAARLGDGDVYIG
333990021YP_004522635.1 major facilitator superfamily transporter [Mycobacterium sp. JDM601MWGTGLLSYVVAVLDRTTFGVSGLDAADRFSTGPSTLSSFVILQLIVYAS
MQIPAGVLLDRFGPKAMIAAGVAVLSAAQLTLSLTHSLPIAIGAYGVVGL
GDAFVFISVIRLLPNWFAPDRVPLLTQLTGICGQFGQLLSAVPFLAILLH
QGWTAAYLSAAALGVLAVALTLAVCRDAPPGAPITMQPRTFRAAFGEVKT
VWSRPGTKLGFFTHLGTPFSANVFALMWGVPYLTTAQGLSRALAGAFLTL
SVATFVVVGLLVGTLSARRPQHRTGLVLAMIALTACTWAVLLALPSPAPH
WLLALLIVVISAGQPVSILAFDFARTYNPPAALGTAQGMVNTGGFIATLV
IMQAMGIVIAMAGGFSFSAFRVAWTVQYVIWALAAVGVVVNARKARDSGA
LGEAQARIVAGEP
333990019YP_004522633.1 hypothetical protein JDM601_1379 [Mycobacterium sp. JDM601]MRGPTIADLRRETGGVDVSRLHAQPEAERPWYLAESILVGIIQLSGKALD
AHQLAQDGGF
333990017YP_004522631.1 hypothetical protein JDM601_1377 [Mycobacterium sp. JDM601]MTAEKGWIGEPQPPKQWHESRASAARRWVQNEQRRRQQRGDYSPVTVEW
333990015YP_004522629.1 hypothetical protein JDM601_1375 [Mycobacterium sp. JDM601]MTTKPGVYPRFRVTRWGLTGVAAFAIAIGLASPTSASAGGDTKGYIKALD
AAGLMSHGGSTCNIIDGICHGQFPDGPAALQTGMRVCRQVQNGQSRASIV
YELSHGEGLMPSSYNAPIIYDAATKYLC
333990013YP_004522627.1 hypothetical protein JDM601_1373 [Mycobacterium sp. JDM601]MDALVVRRTLEPPMPRWGRAGVPSVRTVWALRGVLVLWPRALLHRRQRLL
RG
333990011YP_004522625.1 transposase ISMyma01_aa1-like protein [Mycobacterium sp. JDM601]MASKKRRRHTPDQIIRKLAEGNKLLGTGQELSEVCRHLEITESTWHRWVA
QYGGMKASDAKRLKELEAENARLKKLVANQALDIDMLKEISEGNF
333990009YP_004522623.1 hypothetical protein JDM601_1369 [Mycobacterium sp. JDM601]MSPLLVLDSVMESEAEAREHCKRGRDFKGIDGEKHSSTPEWEYEWYRRNL
RPYHELLRQWCGHRSVTFYERLTAAEAEVRRLDVLAARLIDIIKEDHAVE
AGVFEREHNEERIRAETIRPVVDRPRSPWEMPVVEMPARRRARWW
333990007YP_004522621.1 site-specific recombinase PinR [Mycobacterium sp. JDM601]MSNGQVVGYIRVSTTDQNTARQLDGIELDEVFTDHASGKDTNRPELQRCL
KHVRKGDELVVHSMDRLARSLVDLRRTVDDLTNRGVRVRFVKENMTFGDI
NDPCAVLMLSVMGAVAEFERALLLERQREGIEVAKRAGKYTGRKPSLSDE
QAQQLVDRLAAGESAAALAKEFGISRAGVYVYKNRLQDEVATK
333990005YP_004522619.1 glycosylase [Mycobacterium sp. JDM601]MCPGLNIPGDTESAPGYGSLSSPVALVGQSLCEQCMAVQEPFFEKSGNVL
QAAIDRAQVDKSDLFITNAVHCHPPKNRPSRPYEIENCRPFLRRELELVQ
PRLVVALGKDARDSAVAIYPQARAVWWEDDGLPTRRPRRGSPVVWCTHHP
GSLWRNRTADQRREVTEAWTEALAHAIAWGFGAGR
333990003YP_004522617.1 type I restriction/modification system DNA methylase HsdM [MycobactMAQTNAQAQNHANLIWKIADLLRGPYQPNQYGDVILPFTILRRLDCILEP
TKDQVLAEYKKISATKVDPDVLLKAKFKLPFYNTSRWSFASLISDPEGVA
DNLIDYIEHFSPNVRDVFEGFGMLDEIANLAKTDRLYLIVKEFAAVDLHP
DVVTQHDMGYVFEELIRKFADSNATQAGDHFTPREVIALMVDILFLTEDD
ALTKPGTVRTIYDPAAGTGGMLSVAYDHLVAMNPMARPVLYGQDVNPRSY
ALCKSDMIVKGQDVDNIYLGDTLTDDGHRTKTFDFLLSNPPFGVDWKTQQ
KTVTDEHEQRGFAGRFGPGLPRVSDGSMLFLLHLISKMQPVKGGEGGSRL
AIVLNGSPLFTGGAGSGESNIRQWIIENDLLDAIIALPTDMFYNTGIATY
IWILDNNKPTKRRGKVQLINAVEMYGKMRKSLGSKRKELRPKDIERICHL
YESYRNEHATDEHPAHSKVFKGEEFGYSTITVERPLQLRFTPTDANIEEV
LAHKSITKLKTGEQATIRNALTGLIGWEWKDRDEFVTELKAALHKAGLVK
PPAPAIKAIWSTIGEHDDTATIVTDAKGNPEPDTALRDTENVPLTEDIEE
YFAREVLPHVPDAWIDHQKTKIGYEIPFTRHFYRYTPPRPLEDIQKDLRV
LVDEIQVMLAEVGA
333990001YP_004522615.1 type III restriction enzyme res subunit [Mycobacterium sp. JDM601]MVALQHHESVFETEICEHLAAHGWLYSPTDDGYDRELALFPEDVFGWLAD
TQPDQLAKRVKPELNGDARTKARAGVLATLVKALGADPKANGGTLSVLRR
GFKDLNAQFQMCQFRPNTTLNETTAKKYAAVRLRVMRQVHYSTQNHNSID
LVFFVNGIPVATAELKTDLSVQNITDAVLQYKHHRPPKGEPLLAFGSRAL
VHFAVSNSEVQMTTKLAGKDTVFLPFNRGDHGHAGNPPNPHGSKTSYLWQ
QILARDTWLDILGRFMHLQIDETIDPTTGKKIRKQTMLFPRFHQWEAVTR
LVEAAHEQGPGHRYLIQHSAGSGKTNSISWLAHRLSVLHDDANAAVFDSV
IVITDRTVLDTQLQEAIRQIDRTPGVVAHIAGLGGAKSQELADALSGGTK
IIIVTIQTFPHALTLIQEQSDLAGKSFAIIADEAHSSQAGEASKRLKAAL
SATEIAELADGGTVDAQDVLAAEMAARAESKNLSFFAFTATPKAKTLELF
GHKGLDGTPHPFHLYSMQQAIEEGFILDVLRNYTPYKTAFRLTHNGQTYE
SEDTANAGTIAVTGSTDGELVDKSAAIKSLMNWVRLHPTNIAQKVQIIVE
HFRANVAPRLDGRAKAMVVTSSRKAAVRYKIAIDKYVTAQGYTDVAALVA
FSGEVSDPESGIEKATETSTLMNPGLKGRDLRDAFATDEFNVMLVANKFQ
TGFDQPLLVAMYVDKRLSGVAAVQTLSRLNRTAPGKDQTFVIDFANTAED
IVEAFEPYYEATTLADVTDPNIVHQTMNKLDSAGIYQESEIDGLVSDYLK
GKGHEALNKWVGPARDRFRDRERTAFDRNDQHGLDELELFRKDVGTFLRQ
YDFLSQIINYEDVSLEKLSIYLRHLAPAISSEQLHHEIDLSTVDFDYIAQ
RQQDTTSAKLTGDVPLEPPKEAGTGIVRDPEMVALDEVIAQINDLFSGDH
PDSSVRNVVTHIRDRLEESETLQQQAQSNTLAQFSASPDLQNEFVGAVIG
AMASSEDLSAQILNNPELSQKLLGELVPLIYKGLKVTA
333989999YP_004522613.1 hypothetical protein JDM601_1359 [Mycobacterium sp. JDM601]MKLAHQAVIAEQVHLFFRDHRGIYWWRDADGQLSEQPPPVAANGDGKTRI
QQIEDSLGEGPSDAGIGVLAPKRLTDSEAT
333989997YP_004522611.1 hypothetical protein JDM601_1357 [Mycobacterium sp. JDM601]MAKAWVIRSGRYGERDAWALQNNCSGGGWKAVPDLTACITREDVAAVVAE
AFKGKSDNTLANFTGQLWALRGRIKPGDLIVMPMKTSKQIALGRVTGPYE
YRSDEADLQQRHVIPVDWQRDDLPRSEVKQDLLFILGSALTIFSPSKNDA
LTRLEHLLKCGTDPGQVAHPADQLIGPGTDHGDEVDEPELATDIEQVAYD
QIVKKIAEEFTGHELATLVTALLEVAGWRCDQSPPGPDGGVDIIAGRGLL
GLDDPLLVQVKSGAQVGAPVVTQLHGVMTTYGAQQGLLVAWGGLSKPGHV
ALKNQLRVRVWESSDVVDRVLDNYSQLDPDIRNRLPLKQVWMLSNTES
333989995YP_004522609.1 hypothetical protein JDM601_1355 [Mycobacterium sp. JDM601]MMIALGRIRREAGVTQAEMAARLDITQGSVSQLERRGDVLLSTLSEYLAT
LGAEARITVTIGDRTFEHDLTGGQQ
333989993YP_004522607.1 ATP-binding protein [Mycobacterium sp. JDM601]MTNDDRDELTTAYSGDDVPDMRAYRNPPEELDIAEEPEAANEIGDHQTEG
DDDGDEVNSRPSIATQLVTMAREHYAFGVDENGETFARDTEVPHLTLSMS
NSSRRGLKGRLLDQWWVINERVAPGGAATDAINTLDGAAQREPITPVHTR
IADHEGQVYIDCADEENRVIVIGGGCWRVADEEVPVMFRRSSTMLPYPVP
DVAGDLDRLWGHLNIDSADREVVLGWVVAALILENAPHPILCLGGEHGTA
KTSAARTIQSLVDPTPLDARSLPADEGAWATSIRSGWVLTFDNLSELGRG
VSDGLCKLSTGDAIVRRALYTNDDVSATKAYRALIITTMGLKGVEPDLED
RMVRVELSAIPPEARRPHSEVEAAWARDRPAVVAGLLDLAAKVHHRLPDV
ATTGGLSRMADFNRVLVAIDEIRGTYGAARYRDSAAQVALDTLSEHPLPN
AIVNGRREFASQTAGEIRLAMSLLKKEGGSRGRWPEDAREASEQLRRAAP
AMRSLGWTVQDEGRANKAKVKKYTIIPPPHEIDPGGESAGINPAQAGMAT
SVGGHDGQAPDQQKAGAAGAAGVPGEPSLIACRFCGDGLTVGYATERGYC
TKSECSSARAREHQQTRNESPPTPRDVANMGRRTADRSVI
333989991YP_004522605.1 hypothetical protein JDM601_1351 [Mycobacterium sp. JDM601]MIADLLTLALLLGVVVLVTICGYDTATDRRGSHKNSHPRGLVRRSAVDVV
NDWPMT
333989989YP_004522603.1 hypothetical protein JDM601_1349 [Mycobacterium sp. JDM601]MDNATTDPGQFYNSRGLAIENVNIDRDRLYTSAELAPLIKLADRQTLDGW
RHQNIGPPYRRVGPRRVVYLGSDVLKWLDGSLVVPGGGAR
333989987YP_004522601.1 hypothetical protein JDM601_1347 [Mycobacterium sp. JDM601]MLVIVAACACLALGWWQWTRFQEINGNFQNLGYALQWPLFAWFCVYAYRK
FVRYEEAPPEPHRPDTVTEIPAGLLPERPGPAATPTDDAALRDYNAYLAE
LTENDRKNRNTA
333989985YP_004522599.1 anchored-membrane serine/threonine-protein kinase PknF [MycobacteriMPLALGAEFAGYRIERLLGSGAMGEVYLARHPRLPRRDALKVLPAGLTTD
AEFRQRFQLEADLAATLFHPNIVGVHDRGEFDGQLWIAMDYVAGTDAARF
VADRYPNGMPEDEALPIVGAIAEALDHAHQRGLLHRDVKPANILIADPEG
GSQRILLADFGIVRQLGTVGGLTATNFTVGTVSYAAPEQLRGDDLDGRAD
QYALAATAFHLLTGAPPFGDGNPVTVISRHLTAAPPRLSERRPELAHLDA
VLATGLAKDPAGRFGGCRAFARALAEADAGEPAIATPGTGRRRWPWVVGG
VAVLAGVAGVLGVADSGDEHTGVVSPPPTTTVHPTQTVTVTESPSPPAPL
MSPPAPVPSPTIVPPPATSIEVVAPPATSIEVVAPPAGASAVCRDGTYSF
SKRRSGSCSRHGGVERWVNPPAN
333989983YP_004522597.1 ribonuclease RphA [Mycobacterium sp. JDM601]MSKREDGRLDDELRPVVITRGFTSNPAGSVLVEFGDTRVMCTASVTEGVP
RWRKGSGRGWLTAEYAMLPAATHTRSDRESVRGKVGGRTQEISRLVGRSL
RACIDLAALGENTIALDCDVLQADGGTRTAAITGAYVALADAVTYLSAAG
KLSDPRPLSCAISAVSVGVVDGRVRVDLPYEEDSRAEVDMNVVATDTGTL
VEIQGTGEGATFPRSTLDKMLDAALSACEKLFVVQREALALPYPGVLPEG
PAPKKAFGSD
333989981YP_004522595.1 glutamate racemase MurI [Mycobacterium sp. JDM601]MIGIFDSGVGGLTVARSIIDQLPDEDIVYVGDTANGPYGPLTIPEVRAHA
LAIGDDLVERGVKALVIACNTASAACLRDARERYDVPVVEVILPAVRRAV
ATTRNGRIGVIGTQATITSHAYQDAFAAARDTEITGVACPRFVDFVERGI
TSGRQVLGLAEGYLEPLQRAGVDTLVLGCTHYPLLSGLIQLAMGEQVTLV
SSAEETAKELLRVLTERDLLRPHGTPPATRLFEATGDPEAFAALATRFLG
PAITGVGAVRRHAPLSRS
333989979YP_004522593.1 L-aminopeptidase/D-esterase DmpA [Mycobacterium sp. JDM601]MTDTGSITDVAGIRVGHHHRLDPDATLGSGWASGVTVVLAPPGTVGAVDS
RGGAPGSRETDLLDPANSVRWVDAVVLAGGSAYGLASADGVMTWLEEQGR
GVALDGGVVPIVPAAVIFDLPVGGWDRRPTAEFGYAAAAAAAGPDGARPA
TGCVGAGVGARAGVFKGGVGTASITLELGEHGEHSVTVGALVVVNPSGEV
IDATTGLPWSAYLVEEFGLTAPPSEELAVLAGLEPKSRSLNTTIAVVATD
AALSPAGCRRMAIAAQDGLSRTIRPSHTPVDGDTVFALATGAVEVPELAD
TPAAMSPETGLVAEVGAAAADCLARAVLAGVLAADPVAGIPTYGGTLPGA
FGSKPAGSTGRS
333989977YP_004522591.1 ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium sp. MKPQGTGQRHADPVEDTASPWVTIVWDDPVNLMTYVTYVFQKLFGYSEPH
ATKLMLQVHHEGKAVVSAGSRESMEVDVSKLHAAGLWATMQQDR
333989975YP_004522589.1 twitching motility protein PilT [Mycobacterium sp. JDM601]MDGFMRLTLTRFPADWLRPRIWELRDNLSAYDATYVALAELVDATALLTT
DARLANAPGPRCRVDLL
333989973YP_004522587.1 hypothetical protein JDM601_1333 [Mycobacterium sp. JDM601]MPGGAVHELPADLRDGLLVSSTALAAWESITPLARNEFICWVEDAKQQAT
RERRIRRTREELEEGKRRPCCWPGCKHRERTGS
333989971YP_004522585.1 lipoprotein peptidase [Mycobacterium sp. JDM601]MRRRHRALATACTLVLLLSGCARMLEGTPVSIFADPFRVGGLQAVDGPTG
LRPDAPPPSREVEGTDGGRIDQLAAQSVSDLEAFWTTSFPNTFDGDFEPV
RALLSWDPGQLRGTFCKSRTFLLINAAYCYLDDTIGWDRRLLLPALRSIY
GDMAITMVLAHEYGHAIARAAGITKRRQTPTLVAEQQADCLAGVYLRWVA
HGDSPRFTLSTGDGLNAVLAAMLALRDPLLNPGETVGDNEHGSAFERISA
FQFGFTDGAGSCKAIDAQEIEQRRGELPVQLQQNETGEVPVSEDSVRVIV
DAMNIAFDPDKPPQLTFDAAAASSCTDARPSPPASYCPATNTIAVDLPAL
QAMGTPSKDQKLATLSGDNTAYSVLVSRYLQAVQIEHGGLVLDNAAAALR
TACLTGVATTRLSQGVTTSNGSTITLTAGDLDEAVAGLLTNGLAAGDING
ESVPAGFSRIDAYRTGVLGDFDRCLQRFP
333989969YP_004522583.1 glycosidase [Mycobacterium sp. JDM601]MPGRVEIDDVEPVISCGRYPAKAVVGETVPVKATVWREGHDAVAATLVVS
YLGRRYPHPGESAGAPPVAGAAPLHIPMHTGFDDYVFHAAFTPDSVGLWA
FRVEGWGDPLQSWRNAVTAKLEAGQGETELSNDLLVGADLFDRAAAGIPP
AQRRPVQEAAAALRAPGDPVARAAPALSTEVEELLAGHPLRELVTRGENH
QVWVDRPLARRGAWYEMFPRSTGGWDTDGNPVHGTFATAAAALPRIAAMG
FDVVYLPPIHPIGHVHRKGRNNSTTAEPGDVGSPWAIGSAEGGHDAVHPA
LGTIDDFDDFVAAAHRLDLEVALDLALQCAPDHPWASQHREWFTELPDGT
IAYAENPPKKYQDIYPLNFDNDPAGLYAEVLRVVRFWMVHGVKVFRVDNP
HTKPPDFWIWLIAAVKNIDPDVLFLSEAFTPPARQYGLAKLGFTQSYTYF
TWRTSKSELTEFGQQIAELADYRRPNLFVNTPDILHASLQSGGPGMFAIR
AVLAATLGPTWGVYSGFELFEDRALREGSEEYLDSEKYQLRPRDFAAAVA
EGRSLEPFIARLNEIRRMHPALSQLRTVHFHSVDNDALLAYSKFDPDSGD
TVLVVVNLNPFVPEHATLRLDMWALGMEDYQRFWVRDQISGEDYHWGREN
WVRLDPARAVAHIVNMPPINAQARTALLRRR
333989967YP_004522581.1 thioredoxin [Mycobacterium sp. JDM601]MTRPRPPIGPALAGAVDLSGLKQPPGGAGGDGSAPPGATEITEANFEDEV
LVRSNQVPVVVLLWSPRSEACIKLADTLGALATSDGGTWSLATVNVDVAP
RVAQVFGVEAVPTVVALAAGQPITSFQGVQPPDQLRRWVDSLLSATAGKL
SGGVETEQPEQVDPALARARDQLDAGDFAAARDSYQELLAADPDHVEAKA
ALRQLTFLERATGRQPDAPALADAAPDDIEAAFAAADVQILNQDVTAAFD
RLIALVRRTSGDERSTVRARLVELFELFDPADPEVVAGRRNLANALY
333989965YP_004522579.1 glyoxalase [Mycobacterium sp. JDM601]MTTDSVTDPFEVRSALASALVTAIDHVGIAVPDLEAAKKWYHDQLGMIVL
HEEVNDEQGIVEAMLAVRGAPVGSAQLQLMAPIDESSTIAKFLDKRGPGL
QQLAYRTSDIDALSQRLRDQGVRLLYDAPRRGTSNSRINFIHPKDAGGVL
VELVEPAGDTAAVH
333989963YP_004522577.1 hypothetical protein JDM601_1323 [Mycobacterium sp. JDM601]MRLVIAQCTVDYVGRLTAHLPSARRLLLLKADGSVSVHADDRAYKPLNWM
SPPCRLTEERAGEFAVWVVTNKTGDQLRITIEEIEHDSSHELGVDPGLVK
DGVEAQLQALLAEHVELLGEGYSLVRREYMTAIGPVDLLCRDEQGRSVAV
EIKRRGEIDGVEQLTRYLELLNRDSLLAPVSGVFAAQQIKPQARTLATDR
GIRCVTLDYDAMRGMNSDEYRLF
333989961YP_004522575.1 glutaminase [Mycobacterium sp. JDM601]MAALVQRYLDGILAEHAEVNVGALASYIPELARVDPTGFGLSLSSSDGYV
YESGDAEAQFTMQSISKPFTYALALDQLGHADVDARIGVEPSGEGFNRIS
VDQVTQVPKNPMINAGAIVACSLIPGATADDRFALVREFYSACAGRGLDF
DEDVYRSEKASGSRNRGIAYLLDSFGALDADPDDALDVYIRQCSLKVTST
DLARMAATLARGGYNPLTGRQVTDAAVVRRTLSVMVTCGMYDAAGEWVSA
VGMPAKSGVGGGIVAVLPGQLGIGVYSPRIDAKGNSVRGVLVCRSLSQQL
GLHFLTVSSEAHSAIRGMYTPRPGVRVYEVHGDLLFAGAEQVARTATGDC
GDFGVAILDVSRLHAISDPARALLAGLAHELQSLGKRGLLVDPGGALTSD
PATRGTLVFATVDDALAASEKWVT
333989959YP_004522573.1 methylated-DNA-protein-cysteine methyltransferase Ogt [MycobacteriuMIYQRTIDSPIGPLTLAGANGKLSHLLMLDHSHAPDRTGWRRDDSAFPDV
VEQLAAYFAGDLTEFELTYEMAGTEFQRRVWTALLTIPYGQTRSYGELAT
QIGAPTASRAVGLANGRNPISIIVPCHRVIGSNGSLTGYGGGIDRKRTLL
DLERRHSHATLFD
333989957YP_004522571.1 hypothetical protein JDM601_1317 [Mycobacterium sp. JDM601]MTLSNGWPSLSEVRAASWDYLKASGESWSRLADTWENAFAEVRNASVRP
333989955YP_004522569.1 transposase ISMyma01_aa1-like protein [Mycobacterium sp. JDM601]MASKKRRRHTPDQIIRKLAEGNKLLGTGQELSEVCRHLEITESTWHRWVA
QYGGMKASDAKRLKELEAENARLKKLVANQALDIDMLKEISEGNF
333989953YP_004522567.1 UDP-N-acetylglucosamine 1- carboxyvinyltransferase MurA [MycobacterMGERFVVTGGNRLSGEVAVGGAKNSVLKLMAAALLAEGTSTITNCPDILD
VPLMAEVLRGLGANVELDGTTVRITSPDEPKYDADFAAVRQFRASVCVLG
PLVGRCLRAKVALPGGDAIGSRPLDMHQAGLRQLGATCNIEHGCVVAHAE
ALHGAEIQLEFPSVGATENILMAAVLAEGVTTIHNAAREPDVADLCTMLN
QMGAQIEGAGSPTLKITGVPRLYPTEHEVIGDRIVAATWAIAAVMTRGDI
AVTGVDPAHLQLVLHKLHDAGATVTQHDNGFRVVQYDRPKAVNVATLPFP
GFPTDLQPMAIGLAAIADGTSMITENVFEARFRFVEEMIRLGADARTDGH
HAVVRGLPQLSSAPVWASDIRAGAGLVLAGLVADGDTEVHDIYHIDRGYP
LFVEYLAGLGAEIERVR
333989951YP_004522565.1 hypothetical protein JDM601_1311 [Mycobacterium sp. JDM601]MSTPIVCMAVLVAVLFGAVLALSYRLWKLRQGGTAAIMRDLPAVGGHGWR
HGVVRYRGGEAAFYRLSSVRLWPDRRLSRRGVDVVSRRAPRGDEFDIMTD
EIVVLELRDTTQDRRVGFEIALDRGARTAFLSWLEARPSPRSRRHSY
333989949YP_004522563.1 ATP synthase subunit AtpD [Mycobacterium sp. JDM601]MVDVEFPRGAVPGLFNALHADIAFEELAKTLTLEVAQHLGDNLVRCISMQ
PTDGLVRGTEVSDTGKAISVPVGHEVKGHVFNALGHCLDKPGYGEDFEHW
GIHRKPPAFNELEPRTEMLETGLKVVDLLTPYVRGGKIALFGGAGVGKTV
LIQEMINRIARNFGGTSVFAGVGERTREGNDLWVELEDANVLKDTALVFG
QMDEPPGTRMRVALSALTMAEWFRDEAGQDVLLFIDNIFRFTQAGSEVST
LLGRMPSAVGYQPTLADEMGELQERITSTRGRSITSMQAVYVPADDYTDP
APATTFAHLDATTELSRAVFSKGIFPAVDPLASSSTILDPAIVGDDHYRV
AQEVIRILQRYKDLQDIIAILGIDELSEEDKQLVGRARRIERFLSQNMMA
AEQFTGQPGSTVPLKETIEAFDRLTKGDFDHLPEQAFFLIGGLDDLAKKA
ESLGAKL
333989947YP_004522561.1 ATP synthase subunit AtpA [Mycobacterium sp. JDM601]MAELTISSDDIQGAIEEYVGSFSADTAREEVGTVIDAGDGIAHVEGLPSV
MTQELLEFPGGVLGVALNLDEHNVGAVILGNFENIEEGQQVKRTGEVLSV
PVGDGFLGRVVNPLGQPIDARGEIESETRRPLEMQAPSVVQRQSVSEPLQ
TGVKAVDAMTPIGRGQRQLIIGDRKTGKTALCVDTILNQRQNWETGDPKQ
QVRCVYVAIGQKGTTIASVRRALEEGGAMDYTTIVAAPASDSAGFKWLAP
YTGSAIAQHWMYQGKHVLIVFDDLTKQAEAYRAISLLLRRPPGREAYPGD
VFYLHSRLLERCAKLSDELGGGSLTGLPIIETKANDISAYIPTNVISITD
GQCFLESDLFNQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQY
RELEAFAAFASDLDATSKAQLERGARLVELLKQPQYAPMPVEEQVVAVFL
GTEGHLDSVPVEDVARFESEFLDHIRASESDILAGIRESKKLSEEATEKL
VASIGQFKKGFAATDGSSVVPDERVEALDEDELAKEAVQVRKAPPAKKK
333989945YP_004522559.1 ATP synthase subunit AtpF [Mycobacterium sp. JDM601]MGDMSVVVLAATRQVAAGAEEGESANFLLPNGTFFVVLGIFLVVLGVIGT
FVVPPIMRVLRERDNMVTKTLADNRESAEQFAAADADYEKQMAAARLEAT
TVRDEARAEGRKAIDEQRSAAEAEVATTLQAATEQLKQEGDAVSEQLQAR
VATLSATLAGRILGVEAETLSAANTGR
333989943YP_004522557.1 ATP synthase subunit AtpB [Mycobacterium sp. JDM601]MIETTLAEAAIEVGHHETAVWPVLGTVNIDTITSSAIAAVVVIALAFYLR
AKVTSTGVPGGVQLFFEAITVQMRNQIEGAIGMRIAPFVLPLAVTIFVFI
LVSNWMGVFPVQYSDASGTKELFAPPASDINYVLALAMFVFFCYHLAGFW
RRGFLGHPWRVLKGHVAILAPINLVEEIAKPVSLSLRLFGNIFAGGILVA
LIAMFPPYIMWAPNAIWKAFDLFVGLIQAFIFALLTILYFAQAMEMDEHA
DH
333989941YP_004522555.1 UDP-phosphate alpha-N- acetylglucosaminyltransferase [MycobacteriumMTSLLALADRGAGVPLRELALVGLTAAIITYFTTGPVRWLATRIGAVAYP
RERDVHVQPTPRMGGLAMYVGIVAAIFLASQLPALTRGFVYSTGMPAVVL
AGGVIMGIGLLDDKWGLDALTKFAGQITAASVLVTMGVAWSVLYIPIGGV
GTVVLDQVSSILLTLALTVSIVNAMNFVDGLDGLAAGLGLITALAICMFS
VGVLQDHGGDVLFYPPALISVVLAGACLGFLPHNFSPAKIFMGDSGSMLI
GLMLAAASTTAAGPISQTAYGARDVFGLLAPFLLVAAVVCVPALDVLLAI
IRRTRAGRSPFSPDKMHLHHRLLQIGHTERRVVLLIYLWTAIVAFGAAGT
IFFDPRYTGAVMLGAMLIAIVVTLIPLLRRGDGLEDSPYDTR
333989939YP_004522553.1 modification methylase HemK [Mycobacterium sp. JDM601]MRDAIDSAAALFVDAGIDSARYDAEELAAHAAGTQRGRLALLDPPDDEFF
GRYRELVAARSSRVPLQHLIGTAAFGPETLQVGPGVFIPRPETEAMLEWA
LAQPLRLRPVIVDACTGSGALAVALSRARPGARVLAVDDSEPALNYARRN
CAGTPVELLRADVTTPGVLSELYGQVDLVVANPPYIPEGADLDPEVAQHD
PSHALFGGPDGMSVIAPLTVLAARLLRPGGLFAVEHDDTTSAATVAIVRG
TGCFDDVVARSDLAGRPRFVTAVRNDQR
333989937YP_004522551.1 50S ribosomal protein L31 [Mycobacterium sp. JDM601]MKTGIHPTYGETTVVCGCGNSFTTRSTKESGHIVVEVCSQCHPFYTGKQK
ILDSGGRVARFEKRYGKRKAAADAAEAADK
333989935YP_004522549.1 homoserine kinase ThrB [Mycobacterium sp. JDM601]MVQLLPTGLTASVAVAASSANLGPGFDSLGLALGLYDEIIVETIDSGLVV
HVEGEGAGQVPLTADHLVVQSIRRGLQEVGADVPGMVVRCRNAIPHQRGL
GSSAAAVVGGLAAVNGLVAQLDQPGLSESRLVQLASEFEGHPDNAAAAVL
GGAVVAWTANRADGRGTAYSAVPLRLHPDIHLFPAIPQLRSSTAETRMLL
PEQVSHRDARFNVSRTALLVVALTERPDLLLEATEDLLHQPQRAAAQPES
AQYLQLLRQRGIAGVLSGAGPAVIALSTAPELPAEVLEAPAARGFTVTQL
RVGDAVKWNSGVVVRG
333989933YP_004522547.1 homoserine dehydrogenase [Mycobacterium sp. JDM601]MGVAVLGLGNVGSEVVRILEASADDLAARIGAPLVLRGVGVRRVADDRGV
PVELLTDDVDSLVSRSDVDIVVELMGPVEPARNAILSAIKHGKSVITANK
ALLSRSTGELAEAAETARVDMYFEASVAGAIPVIRPLTQSLAGDTVLRVA
GIVNGTTNYILSEMDSTGADYASALADASALGYAEADPTADVEGYDAAAK
AAILASIAFHTRVTADDVYREGITNITPEDAAAARALGCTIKLLAICERI
SSRGGQQRVSARVYPALVPLEHPLATVNGAFNAVVVEAEAAGRLMFYGQG
AGGSPTASAVMGDLVMAARNRVQGGRGPRESKYAQLAIAPIGDVQTRYYV
SMDVADKPGVLATVAAEFAAHEVSIAEVRQEGVTDEEGQPIGARIVVVTH
RAAESALSETVAALAELDAVQQVASVLRLEGTDQ
333989931YP_004522545.1 arginyl-tRNA synthetase [Mycobacterium sp. JDM601]MTPADLAELLKTTAAAVLAEHDLDTAALPATVTVERPRNPEHGDYATNLA
LQLGKKVGVNPRELAGWLAEALTEADEIASADTAGPGFVNIRLDASAQGT
IVANIVEAGQSYGHSQEFDGLNVNLEFVSANPTGPIHIGGTRWAAVGDAL
GRLLSTQGAAVTREYYFNDHGAQIDRFANSLIAAAKGEPAPEDGYAGAYI
TDIAAQIQAKAPDALSGPDSQETFRAIGVDLMFSHIKESLHDFGTDFDVY
THEDSMHTSGRVEQAIERLRANDNIYEKDGATWLRTSAYGDDKDRVVIKS
DGKPAYIAGDLAYYLDKRERGFNLCIYMLGADHHGYIARLKAAAAAFGDD
PATVEVLIGQMVNLVRDGQPVKMSKRAGTVITLDDLVEAIGVDAARYSLI
RSSVDTPIDIDLALWSSASNENPVYYVQYAHARLSALARNAAELGLAPDT
ANLGLLTHDKEGTLIRNLGEFPRVLKTAAALREPHRVCRYLEDLAGDYHR
FYDSCRVLPQGDEAPAELHTARLALCQATRQVIANGLGILGVSAPERM
333989929YP_004522543.1 hypothetical protein JDM601_1289 [Mycobacterium sp. JDM601]MQEHETDFARPWAPHRLRIYTGVALFVLGMFLLLTIAVSLRIIPASFQVD
VIANIVFGIPVMLLPFVILWDAPGEQRTRLDRAAELTLFYIPFTAASQIG
YELMFLIGQPLGWWGPTDDPGFKWLWWQYGLADTRYVSGNPWVFALEVVG
VSTGITVFVMWTKLLRSSLPLESRIRCLWVVAVGISVLMSSTAVYFLSEV
GAGFADIGQGSWGFWFKFIGENVPFIVLPPLVVYATYLQIDHLTRRADVR
DGG
333989927YP_004522541.1 PPE family protein PPE51 [Mycobacterium sp. JDM601]MLDFGILPPEVISTQMYTGPGSGPLLASAAAWDALSGQLNAFALGYSTTL
TGLQDEGWTGASSQAMLAAAAPYIAWVSQTATQAEHAATQSRAAAAAYES
ARAATVPPAVVTTNRTQLANLVATNIFGQNTALISALEAAYAQMWAQDAA
AMHGYATTAYTATQLAPFQEPPQTTNSAAAASQALAPAAALGTAAASQGS
QSAADGVIDGASTFNTLSGPVGFATAMSRTVTNAGSFFTALAKAVGGSAP
KAAAAAVPAVLPAAGMASAVQAGPSLVRSTASMGTASPIGQLSVPKAWAD
TAPIATASEEPLFLSEAELAATGSWEEAPASGMMAAPAAAMGAAAGGAGR
STVSSILRVGPKRFAMPRPSVGG
333989925YP_004522539.1 hypothetical protein JDM601_1285 [Mycobacterium sp. JDM601]MSATRAIVSAAMVPAVALGMVLATEFAPPASAATCNAPEANIEPPPGSPT
TGAGQLPTGRRPRGTNDSAPLPKLGPLIAALINPNGAIRQQAAVVPPVPS
PDGQVAPNAAQPVQPVPNAGADPGLSTADAAGAIAGSQTSLVEWVTGPNS
PNQTLQRFGISGTDLGIPWDNGDPANRQILMAFGDTFGYCRIPGHQWRQN
VLFRTQDNNLADGITVGPGGIGNKYSGSPLRQANFSKQILPAVQLAPHQE
GMIPTAAIGIAGNQYMSFMSIKQWGRDGEWSTNYSAIAVSNDNGETWGVY
PGTVRSTSPENVPRARFIPGNENFQMGAFLRGGDGYLYSYGTPAGRGGSA
YLARVPERTIPDLTTYQYWNGDSGSWVPNNPAAATPVIPGPVGEMSVQYN
TYLRQYLALYGNGGNDVVARTAPTPQGPWSAEQTLIPTGQIPGGIYAPYV
HPWSTGKEVYFTLSLWNAYDVMLMRTVLG
333989923YP_004522537.1 hypothetical protein JDM601_1283 [Mycobacterium sp. JDM601]MSISFNHTIVAAHDKQESAAFLAELFGLPDPQPFGHFMVVGLDHEASLDY
AEVPGDEEIPPQHYAFLVSEDDFDAIYAKIASRGLAHWADPRGGRPGEIN
RRDGGRGVYFRDPSGHAMEILTRPYGSRP
333989921YP_004522535.1 monophosphatase [Mycobacterium sp. JDM601]MNDHQLAAQLATDAGRLLLTVRNELADAPQAERKAAGDKRSHDYLMTALA
TERPADAVLSEEGADNPVRLQADRVWIVDPLDGTREFSELDRDDWAVHVA
LWQAGELTAGAVALPARGITLATPTVAAPPEHPGPARIAVSRSRPPAVAQ
AIRDHLDGELVAMGSAGVKVAAVIQGAADVYVHAGGQYEWDSAAPVAVAR
AAGLHTSRIDGSPLVYNRPDPLLPDLVVCRPEYADAVLAAIG
333989919YP_004522533.1 sulfate adenylyltransferase subunit 2 [Mycobacterium sp. JDM601]MTSNITAPPEPSAPLQAGRYQLTHLRTLEAEAIHIIREVAAEFERPVLLF
SGGKDSIVMLHLAVKAFAPGRLPFPVMHVDTGHNFDEVLAARDELVARTG
VRLVVASVQDDIDAGRVVDDGPSRNPLQTVTLLRAIRENKFDAAFGGARR
DEEKARAKERVFSFRDEFGQWDPKAQRPELWNLYNGRHRAGEHIRVFPLS
NWTEFDIWSYIGAEEILLPSIYFAHRRKVFRRDGMLLADHEFLRPADGED
VFETTVRFRTVGDVTCTGCVESTAATVEDVIAETAVSRLTERGATRADDR
ISEAGMEDRKRQGYF
333989917YP_004522531.1 peptide ABC transporter permease [Mycobacterium sp. JDM601]MMRFLAGRALNYLVLLGLASFLTFCLTSLAFAPLDSLMQRNPRPPQAVID
AKAAELGLDKPIPLRYAHWASHAVRGDFGVTVTGQPVSDELGRRIGVSLR
LLLVGSLAGTVIGVVAGAWGAVRQYRLSDRVITMAALLVLSVPTFVLANL
VILGALRVNWALGAQLFDYTGETSPGLVTGFWPGLLDRLQHLVLPSLTLA
LGAAASFSRYQRNAMLDVLGQDFIRTARAKGLTRRRALFKHGLRTALIPM
ATLFAYGVAGLVTGAVFVEKIFGWHGMGEWVVQGVATQDTNIVAAITVFS
GAVVLLAGLLSDVIYALLDPRVRVS
333989915YP_004522529.1 peptide ABC transporter ATP-binding protein [Mycobacterium sp. JDM6MNALLEVADLAVTFGAGRDAVQAVRGISYRVDPGEVVAMVGESGSGKSAA
AMAVMGLLPEHAQVSGSVRLAGTQLIGLGDTAMSKFRGASIGMVFQDPMS
ALTPVYTVGDQIAEAIEVHQPRIGRAAARRRAVELLELVGISRPQERARA
FPHELSGGERQRVVIAIAISCDPDLLICDEPTTALDVTVQAQILEVLKTA
RDVTGAGVLIITHDLGVVAEFADRALVMYAGRVVEAAPVAALYADRQMPY
TVGLLGSVPRLDAPQGTRLVPIPGAPPSLAGIEPGCPFAPRCPLVTDECR
AQEPELLNVGVSHTAACIHTDQVAGRSAADIYRVPTAVTAPAVTDSGTVL
RVRDLVKTYPLTKGVLRRRVGEVRAVSRVSFALQQGRTLGIVGESGSGKS
TTLHQILELAAPQAGSIEVLGSDVAALTRDGRRALRRDLQVVFQDPVASL
DPRLPVFEVLAEPLRANGFDKAMTHARVAELLELVGLRRGDALRYPAEFS
GGQKQRIGIARALALQPKILALDEPVSALDVSIQAGIINLLLDLQQQFGL
SYLFVSHDLSVVKHLAHTVAVMFAGEIVEQGEAGQVFARPEHDYTRRLLA
AVPQPVVGS
333989913YP_004522527.1 hydrolase [Mycobacterium sp. JDM601]MRLHRLTLTNYRGVAHREIDFPDHGVVVVAGANEIGKSSMIEALDLLLES
KDRSAKKDVKQVKPTHADVGAEVTAEISTGPYRFVYHKRFHKAPRTQLTV
LEPRREQLTGDEAHERVRAMLDETMDTGLWQAQRVLQAASTAAVDLSGCD
ALSRALDVAAGDTATPSGTEPVLIERIDAEYARYFTPTGRPTGEWAAAVA
ALATADAEVARCTDLVAEVDDRVLRHTELSEQLARLTDDRVAAEARHSAA
KAAGDTIAALRDQLRDAQLVATAADATGAAAQAAHAERQRLCAELESRAA
AIALLDSELAEATQAHDTADTEATTAEGAATEAERLLAAATEHAETSRRI
VDQLAARDEADRLETRLVRIDATEHDLEQAVAELAAITVTEPVLRQIEDA
AAALDRAQAALAAISATLEVTAAADVELLIGGEHTSLAAGQSWSAPVAAG
AEVALPGLLSVRVRPGDSAREASTKHAAAQEELATALAAGGVADLAAARR
CDQRRRELQGSRDQLAATLVALRGDDAVEELRTRLAQLRGEHAEVGAGIT
LEEARAERDTAEAQRTRAHADCETLRRAASESAARRTAAATSVTLLQNKG
ATQRAELESVTQRLTDERASVGDEDLAGAAESSGQALQAAQQRLAEVSEQ
LAAAAPELVDAELADAAQQVQALSDRHTETARELHQVEVELAVFGTEGRK
GQLDAAQTAREHAVAEHDRIGRRARAAALLRSTMIRHRDDTRLRYVEPFR
AEIQRLGVHVFGADFEVEVDTDLKICARTLDGRTVPYESLSGGAKEQLGI
LTRLAGAALVAKEDSVPVVIDDALGFTDPDRLEKMGAVFDAVGAQGQVIV
LTCSPDRYRSVKDAHRIDLSA
333989911YP_004522525.1 phosphohistidine phosphatase SixA [Mycobacterium sp. JDM601]MNAAPRTLILLRHAKSDYPPGVADHGRPLAKRGIREAALAGDWLRANAPR
IDQVLCSTATRTRNTLERTGLNAPVSYLDELYDAVPGTVIATINTVGDEV
RTLLVIGHEPAMSSVALGLSGAPGTDTAAVQRISEKFPTSGIAVLHVAGS
WSGLELGSAALVGFHTPR
333989909YP_004522523.1 hypothetical protein JDM601_1269 [Mycobacterium sp. JDM601]MVIPKALRERSGITPGEVEISVDGAGVRIESVAVDELLEEDGLLLLPDGG
TELDADAVRELRLADQR
333989907YP_004522521.1 hypothetical protein JDM601_1267 [Mycobacterium sp. JDM601]MLIDAFDKLADGQGMFSQHGSQILQADWSIAQFPWRAQ
333989905YP_004522519.1 hypothetical protein JDM601_1265 [Mycobacterium sp. JDM601]MTRDTVERQRAFTGLLAHPVLDRWRYPELFALVRNTRHRTVLVDWFKARL
DYDLVVTESAARLFRRPIGKSVVAPPRYGAPGRRVLTLAVLGAAVAEDAE
DLTTTQELSDRVRVLTRRDDVGLAEYDADRFVDRSQFVKAVGLLVDAGVL
RPVDRNDEDRREGWAHHKDAVGGAYEVVRQLLLRLVDPAALAAALGESSD
DVDAAAVSDATSRHLIMRRLVELPVCLIADLGEAERAYLVNQRHRIVSWC
AEMTGWIVEQRAEGLALIAPEEADTDLPFPRLRAVDFASLMVLDELRTLA
DEHGRVSEDQLMVAVAEVRFRYPKAMTKELETDLATRDRAVELLRALDLL
RPVHDGGWWLSPASARFRNPSVVSVTARLGDNEAP
333989903YP_004522517.1 hypothetical protein JDM601_1263 [Mycobacterium sp. JDM601]MMSSYSDRRAQILAELDPEDRAAFDEAYAIAGLAMELAETVYRARETAGL
TQAELARKMGTTQSAIASIESGARTPTVELLEGLARACGQRLTIRIAAA
333989901YP_004522515.1 twitching motility protein PilT [Mycobacterium sp. JDM601]MSEPTSGLLDTSVVIDWHDPKVVAALPDEVAISAITAAELAAGPLLATSA
VEAARRQARLDFAGLNDLIRVVAV
333989899YP_004522513.1 PemK protein [Mycobacterium sp. JDM601]MLVDQIRSIDTHYVVGDPVDYLTRDQLVEVELALVHYLGVQEAIPPRSS
333989897YP_004522511.1 CopG family transcriptional regulator [Mycobacterium sp. JDM601]MAQTLTIRLNADDRAVLEAAARKQGKGLSAFVRELAEAQARQTRREMIRA
DGERVMAHLAEHPDARSELDELGTPLTDLP
333989895YP_004522509.1 hypothetical protein JDM601_1255 [Mycobacterium sp. JDM601]MTSNRAVGFGVSAEIFTTLDYGVCQLWAAALRRAGFGGIRYWARHDLEHT
AACVAVFGAAGAPGEGVRDPLQSPVTEHLSARPDLIAAFESATGVTVLPV
PDVDAIISRGDARDG
333989893YP_004522507.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MAHVVVERVEQIAGQLTATAQESERLGTLSPQSVALIRQAGVMRMLQPSD
FGGYAAHPRDYAEAVMAVAKACGSTGWVCGVVGVHPWQMALMDRRLQTEV
WGRDPETWIASPYAAQGVATPVDGGYQLNGRWSFSSGTDHCDWIVLGARV
GETLLPRVLHVVLPRSDYTVVDDSWDVIGLSGTGSKDIVVDAAFVPHYRT
IDFGHVASQMSPAERAGRTETLYRLPFWAMFSLGVTAAVIGIAEGALAAH
LGYQRDQVAVTGARINDDPAGPGVISEAAAEIAASRDQLLDAISRLFDVA
QAGEVISCDERSLVPRNQLRCAQRAVAAVDAIFAGSGGNAACKSNPLQRF
WRDAHVGLGHAVHLSDMIYQSSALTAMGGQAP
333989891YP_004522505.1 transcriptional regulator MarR family protein [Mycobacterium sp. JDMLNRELTDTHKLSLADVQLLALLDDSPADGLQMGDLAEALPSPPSRLTRQ
IRRLEDQGLVMRAASQHDRRRVLARITGPGRTLVEQAMTTYETEVRTHFL
GPLTRPQIAAMAASCRQISDGLKRSK
333989889YP_004522503.1 GNAT family acetyltransferase [Mycobacterium sp. JDM601]MGGPLLFDAYHRVSAATHTVAARYLVVDAIDHDAARFYEHYGFPRSPAEP
SLRMVRKLSDIQADVGLR
333989887YP_004522501.1 hypothetical protein JDM601_1247 [Mycobacterium sp. JDM601]MGAGEKSTAGTDGAVAAIAADTPVSAVSADGCTTPATVATDTAEGLDGVV
VGATVAASTTDSAVATGSGVADTALTTDTAIAGDTLNTGGTAGGTARATR
TADTAGVKAADLAADTTCAAVAALGDSGAAGTTRTTVAAVSVGALTTGST
GAAVAAGQALTADPTCAAGTGRSID
333989885YP_004522499.1 hypothetical protein JDM601_1245 [Mycobacterium sp. JDM601]MGASLIAVTPAAAPLTGIHSVIDVGLAADGSPLGDLLDPWTQIFGTATDN
VNTLTQSYYLAPNVAIQQALANFSGYMQQIVDDPANLTQVTNEMQENWKA
AMSAITLMNANQDTVDAVIRHTMDGSFGAGHSTMFSQIAGYLPPDQADSI
MPIINFLASPWGGVVMGALGPGISPWVALMNSITEGDSFGQIMASPLDGL
LNGATLDLSSLTPMINGLGLFPGGMAMTHLDIAFGGLLSPGGQVSASPFN
VIDDTGNSVGEVTAVGGSIFNSVGITFTGLPVIGTLALQSDAVGPLGAWM
GLAQVIATQLGWGSWDGSAYDVPALSPGTDIDFPTNFDELFSDFFPADGL
DG
333989883YP_004522497.1 MarR family transcriptional regulator [Mycobacterium sp. JDM601]MPSLPGLDGVEQRSWQQFLGCSLNLVAALNGRLKGTHNLSIRDVLLLELL
SKPNRQARRLCALAETLRVSQGQLSTQIRRLEGQGLITRSPSKRDPRGIL
PRITAEGHMRLHAVLETYAQGVRMHYLDQLHYEQLVGLVDSCRRINGSLK
AQD
333989881YP_004522495.1 MarR family transcriptional regulator [Mycobacterium sp. JDM601]MAVLPGRDGIERLCWQPFLNGPDSVTAALDIRLRGAHGVTLRDVLLLELL
TRPDRQAHRICALAQTLGVSPSRLATQVRRLEGRGLVTRRPSRRDPRGML
PRITREGNMRLHAVLQTYGQRPVRAAATNSFAGKRDG
333989879YP_004522493.1 hypothetical protein JDM601_1239 [Mycobacterium sp. JDM601]MSRRILTVFAVLALLIAPTGCSRQVGGTAVKAGAGDTQRNNNSERQYPNL
LKECEVLTTDILAKTVGADPLDIQSTFVGAICRWQAANPAGLIDITRFWF
EQGSLDNERKVAEFLQYQIENKSIVGVPSIVMRPADPNGSCGVASDAAGV
VGWWVNPQAPGIDACEQAIKLMELTLQTNS
333989877YP_004522491.1 transmembrane ABC transporter ATP-binding protein [Mycobacterium spMLLALLRCYITPYRWPVAAVMTLQLISSLASLYLPTVNASIIDDGVVRGD
TAVITRLGAVMLAVTGLQVLCAVAAVYFGARTGTGFGRDLRRAVFTRVIG
FSERETTRFGTPTLLTRTTNDVRQIQLVVQLGVTVLVAAPIMSIGGVAMA
LHQDAGLAWLLAVAVPVLAGANYAIVVRMLPLFRRMQMLIDNINRVLRDQ
LTGIRVIRAFAREAHEQDRFAAANHALSDASLAVGNLQALMLPATTLIIN
ASSVALIWFGGLRIDAGHMQVGSLIAFLSYFMQILMAVLMATMVVAILPR
ASVCAERITEVLSTEPTIGTPAHPVTPAVATGEVRLAGVGYRYPGADRAV
LRDVSFVASPGTTTAIVGSTGSGKSTLVSLICRLRDVTEGAVLIDGVDVR
DRDPEQLWSGIGLVPQRGYLFSGTVADNLRYGAPAGVEVRDEQLWEALRV
AAAAGFVAAHPDGLAMPVAQGGINLSGGQRQRLAIARAVIRRPSIYLFDD
AFSALDTRTDAAVRAALGEVAAAATVIIVAQRISTVTRADQVIVVDDGRV
VGAGTHQQLLAECPAYVELAESQSLAGEPA
333989875YP_004522489.1 hypothetical protein JDM601_1235 [Mycobacterium sp. JDM601]MPDTMVDLEVLTEAVRLACRAPSLHNSQPWRWVAERGRLELFLEPSRAVH
GDRSAREALISCGAVLDHLRVAMAAAGFTAEVQRFPDAQQPDHLASIEFT
PGGRVSDMQRYRANAILLRRTDRLPFMAPRNWEPFEAVLRDSVEDPVRLC
VLGDDVRPKLAEVSQLSEALRMYDAAYHAEINWWTAPFEVRDGIPRSALV
SAAESDRVDIGRAFPVTRNRERRVEVGDDHATIVLLSTATDSPSDTLACG
EALSAVLLECTMAGLATCPVTHVTEVPAGRAMLAGVAGRDDLPQVLIRIG
GAPALEKAPEPTPRRALAEVLHVKV
333989873YP_004522487.1 aminotransferase [Mycobacterium sp. JDM601]MAEVFDSLTDELLRARNTIKWNHYGPDVLPLWIAEMDFPTAPAVLDGVRA
CVTSEEFGYPALGSDALPVATARWCKQRYGWAVRPEWVRTVPDVLKGMEV
VIAFLTRPESPVVLPVPAYMPFFDLLQVSGRQRVEIPMLQQDSGRYVIDL
DALDAAFAAGAGSLILCNPNNPLGTAFTAAEISAIVEIAARHGARVIADE
IHAPLVYDGRHVPAASVSEAAADTVVTLMSASKGWNLPGLMCAQVILSNQ
RDVDAWRKINMLHVMGAATVGIRANIAAYTHGADWLDGLLAYLRVNRDHL
SRVLPAAVPGLRVNRPEATYLAWVDFRELALPAEPADYLLANARVALSPG
IPFGAGPGFARLNFGTTRAILDRAIDAMAAALNG
333989871YP_004522485.1 hypothetical protein JDM601_1231 [Mycobacterium sp. JDM601]MDISRWVEDQLGVRLLRLHDKLYQGSNGRIGHRFPGVPPSLLLHTVGAKT
GQARTNSLTYARDGDTYLIVASMGGAPRSPGWYHNLKAHPDAEINVGPRR
FAVTARPVLPDDPDYARLWRIVNANNAHRYEAYQRRTTRPIPVVVLTSVP
ST
333989869YP_004522483.1 monooxygenase [Mycobacterium sp. JDM601]MRLSVLDLVPVRTDQSTADALAATVRLAQAADRLGFTRYWVAEHHNMPSV
GATSPPVLLAYLAAQTARVRLGSGGVMLPNHAPLAVAEQFALLEAAAPGR
VDLGIGRAPGSDPVTSFMLRSGRGDEDIANFPDYLDQVRAMMSSRGVQVQ
LRDGDYLLKATPAATSEPRLWLLGSSMYSARLAAAKGLPYVFAHHFSGHG
TEEALTYYREHFTASEVCPEPTTFLTVNAAVAETSDEATALMLPNLQMMA
RLRTGRPLGAVDLVEDAQAARISDAEQRIVDGGLRRAVVGAPAEAADQLK
ELAAHFDVDEVMVNPVASARRGTDPATAPGREQTCELLAKELF
333989867YP_004522481.1 transcriptional regulator [Mycobacterium sp. JDM601]MAVSRPAPLTGVNGNPYTATQLAAAEPLSVSYLAAPVFDNGEATYELQLG
PLRRDVSAADRDRYIREIRATAQQLSS
333989865YP_004522479.1 hypothetical protein JDM601_1225 [Mycobacterium sp. JDM601]MRPIHIAQLDRARPVLILTHEVVRPHLTNVTVAPITTTVRGLSTEFPVGA
ANGLNQPSVVSCDNIQTVPVADLGRQIGYLFDSQEPALADAIGNAFDLDW
ATS
333989863YP_004522477.1 cytochrome P450 [Mycobacterium sp. JDM601]MMSRPKFVPCNAETWPNPYPMYAALREHDPVHRVIPDGHPDQDYYVLSRH
ADVWAAAADHETFSSAKGLTINYNDLEMIGLADNPPMVMQDPPRHTEFRK
LVARAFTPAHVKRLESQVREFVVERIERLRAAGSGDIVTELFKPLPSMVV
AHFLGVPQADRAQFDRWTDAIVAATVSEDGVASAGDAVVEMMAYFSGLIE
RRRTDQEEDTISHLVAAGMGAPGDDAGIFAILAFAFTMVTGGNDTTTGML
GGSAQLLHRHPDQRRLLIDDPSLIHEAVEELLRMTSPVQGLARTATRDVT
MGDTTIPAGRRALLLYGSANRDEQQFGPTAGELDVLRKPRQILTFGYGAH
HCIGNQAARMQARVALEELLARCPDFTVDEAGIRWAGGAYVRRPLSVPFT
AGA
333989861YP_004522475.1 integral membrane acyltransferase [Mycobacterium sp. JDM601]MTLPKEEVAQGGLEQVAHVDRVASLTGVRAVAAILVVGTHAAYTTGKYTH
GYAGLLGSRMEIGVPIFFVLSGFLLFRPWVRATAFGRPAPSVRRYAWHRV
RRIMPAYVVTVALAYLIYHFRTAGPNPGHNWIGLLRNLTLTQIYTDNYMF
GYLHQGLTQMWSLAVEVAFYVVLPGLAYLTLVWLCRRQWRPVRLLAALAA
LALISPAWLVLVHTTDFLPDGARLWLPTYLLWFLGGMALAVLQAMGVRCY
GFVAIPLALICYLIASTPIAGEPTTSPTGTSEALVKAVFYAAIATLAVAP
LALGNEGWYARLLASRPMVWLGEISYEIFLVHLVLMEVVMVEVLRAPVYT
GSMLNLFVLTMVVTIPVSWLLHRFTRVRS
333989859YP_004522473.1 hypothetical protein JDM601_1219 [Mycobacterium sp. JDM601]MFAARPLGLFAGLGALSAALLAGCGSGDSTVAKTPQNTSPTATAAPPVTT
STPAGSPAPADPCAVDLAAPAIAKAVSELPKDPRSGQPWSPEPLAGNYSE
CADLSAVIVKANTNAEKPSTRAVLFHRGAFLPQSVPDTYGFNGIDLAHCT
TDTVALQNASGIAGLTGLVKFHWNGAGVEIIGNTTR
333989857YP_004522471.1 hypothetical protein JDM601_1217 [Mycobacterium sp. JDM601]MGIFRRRRSAQEPAPAPGGEKPGMTARVLSRVIESSEKVQGPAVRAYIER
LRHRDPGVGPAQVVKKLERRYLAAATASGAAVGATAAVPAIGTLLALSAV
AGETAVFLEATAFFVLCVAEVHGIPVDNRERRRALVLAVLVGDQGKGAMA
DLLGSGRTSGAWLAQGTAALPLPAVSELNSRLLRYFVKRFTLRRGALAFG
KLLPVGLGAVIGALGNRFIGKKIVGNARKAFGPAADRWPVTLHLLPALPD
DDVRPAQPSA
333989855YP_004522469.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MQGFAGKVAVVTGAGSGIGRALAVELARAGAQLAISDVDTEGLAQTEQRL
TALGVRVKADRLDVTEREVFIGYADEVKDHFGKVNQIYNNAGIAFSGDVE
VSEFKDIERVMDVDFWGVVNGTKAFLPHLIASGDGHVINISSLFGLLSMP
GQAAYNAAKFAVRGFTEALHQEMAIAKHPVKVTTVHPGGIKTAIARNATT
VEGVDHAAMADFFDRRLASTSAEEAARVILDGVSKNRARVLIGNDARALD
LLVRLTGSRYQRLFSFVIPRFGPR
333989853YP_004522467.1 (NAD) dependent malate oxidoreductase Mez [Mycobacterium sp. JDM601MDNSPIVIGDEEIFEAHMGGKISVDLKAPLDSQRALSIAYTPGVAQVSRA
IAADHTLAARYTWAHRLVAVVSDGTSVLGLGDLGPSASLPVMEGKAALFK
TFAGLDSIPIVLDTKDPDEIVETLVRLRPSFGAVNLEDISAPRCFEIERR
VIEALDCPVMHDDQHGTAIVALAALMGAAKVLGRDISSLRVVVSGAGAAG
VACANILMSVGISEIIVLDSQGVLHPERTDMNDVKTELAQRTNPGGRTGG
LAEALVGADVFLGASGGVVPEELIASMNPGGVVFALSNPDPEIHPELAAK
YAAVVATGRSDFPNQINNVLAFPGVFRGALDAGAERITEEMKLAAAEAIY
SVVADDLAPERVVPSPLDPRVEPAVAAAVAAAAGSSS
333989851YP_004522465.1 magnesium and cobalt transport transmembrane protein CorA [MycobactMTALRGPVPRVLVDCGVYDGGDRVPGDFTPAGAMAKVREIEASGRDGFVW
VGLHEPDESQMQAVAATFDLHELTVEDAVHAHQRPKLERYDETLFLVLKT
VNYVPHESVGLPRQIVETGEIMIFVGKNFVVTVRHGEHSGLSEVRKRMDA
DPEHLRLGPYAVMHAIADYVVDRYVEVTNLMETDIDAIEEVAFAPGTRTD
VEPIYQIKREVVELRRAVAPLSIPFQRMQTDYKDLISKEVRRYLRDVADH
QIRAAEQIASYDEMLSSLVQAALARVGMQQNTDMRKMSAWAGIIAVPTMI
AGIYGMNFDHMPALHWTFSYPTVLLGMAGISTVLYRAFRRNGWL
333989849YP_004522463.1 sugar ABC transporter [Mycobacterium sp. JDM601]MAEIELLHITKSYPDGAVAVKDLSLTIADGEFIILVGPSGCGKSTTLNMI
AGLEEISSGELRIGGERVNERAPKDRDIAMVFQSYALYPHMTVRGNIAFP
LTLAKMKKPQIAEKVAEVAKILDLSEFLDRKPSQLSGGQRQRVAMGRAIV
RQPKAFLMDEPLSNLDAKLRVQMRSEIARLQRRLGTTTVYVTHDQTEAMT
LGDRVVVMHGGIAQQIGTPDELYERPANLFVAGFVGSPAMNFFPGTLTST
GARLPFGEVPLAAAVRDTIGRHPGSHNDVVIGVRPEHLGDAGLLGDAERA
RAVTFSARVDLVESLGADKYLYFTPNEAAGTSTENGLVARVPAASKAAGG
QPIELALDAAKVVVFDAASGVNLTVPPAER
333989847YP_004522461.1 sugar ABC transporter permease [Mycobacterium sp. JDM601]MTSRADERSQRRLALLLIAPAVVLMLAVTAYPIGYAIWLSLLRYNLATPD
DTAFVGLANYQTTLTDSYWWTAFAVTLGITVVSVAIEFVLGLALALVMHR
SLFAKGTVRTAVLVPYGIVTVAAAYSWYYAWTPGTGYLANLLPAGSAPLT
QQLPSLGIVILAEVWKTTPFMALLLLAGLALVPEDLLKAAQVDGAGAWRR
LVSVILPMMKPAILVALLFRTLDAFRIFDNIYVLTNGSNNTGSVSILGYD
NLFKGFNVGLGSAISVLIFVCVALIAVLFVKVFGAAAPGSEQK
333989845YP_004522459.1 hypothetical protein JDM601_1205 [Mycobacterium sp. JDM601]MTSPFQSGQAPDPLGAAAAGRRDVARLPTPPKGWPIGAYPTYAEAQRAVD
YLSDQQFPVHQVTIVGVDLMQVERVTGRLTWPKVLGGGVLTGAWLGLFIG
LVLGIFSDNPAQALVTGLIAGVFFGLITSSVPYAMARGTRDFSSTMQLVA
GRYDVLCDPQSAEQGRDLLAKLTL
333989843YP_004522457.1 citrate (pro-3s)-lyase subunit beta CitE [Mycobacterium sp. JDM601]MTNAYRPRRTCLSVPGSSQKMIDKAKGLPADQIFLDLEDAVAPAAKEQAR
ARVAEALTASDWSAPLLGVRVNDWTTPWTHADLIEVVSAVGAAAGARLDV
VVLPKVSDASHVQALDLLLTQLETVHGLPAGQIGIDAQIEDARGLTNINA
IAAVPRVQALVLGPADLMASLNTRTLEVGEQPEGYTEGDAYHHVLMTILV
AARAHGIAAVDGPYLKVRDVEAFRRVAGRSAALGFDGKWVLHPDQIAAGN
EIFSPRQAEYDHAELILEAYAWHTSQAGGARGAVMLGDEMLDEASRKMAL
VVAGKGRAAGMRREAPPFEPPSA
333989841YP_004522455.1 hypothetical protein JDM601_1201 [Mycobacterium sp. JDM601]MTDRSPLQRLSTPRTSRFPALRMDPDALGRFTESVARFFGTGRYLAIQTI
LVVGWILLNVYAVSLKWDPYPFILLNLAFSTQAAYAAPLILLAQNRQENR
DRVSLDEDRRRAAQTKADTEYLARELASLRLAVGEVPTRDYLHHELERVR
ELLDELRPKPDTAGGDSGTGRPV
333989839YP_004522453.1 Mrp-like protein [Mycobacterium sp. JDM601]MSKTPDDTAALHEAIYAALGTVLDPDIQRPITELGMVKSIEIADDHSVHV
TIYLTIAGCPMKAEITNMVTRAVNDVPGTGPVKVSLDVFSDEQRAELRKQ
LRGDAKEPVIPFAQPGSLTKVYAIASGKGGVGKSSVTVNLAVALAERGLS
VGVLDADIYGHSVPRMMGVTALPTQVDSMIMPPIGYGVKVISIAMFTKGN
TPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDIAISVAQLVPP
AEILVVTTPQQAAAEVAERAGAIALQTRQQVVGVVENMAGLAMPDGSTMH
LFGEGGGEQVAERLTRAMGRDVPLLGQVPIDSEMVTGGDSGSPVVLSPDS
VAGKELRRIAEQLATRGRGLVGMSLGLNTGSTQR
333989837YP_004522451.1 serine protease HtrA (DegP protein) [Mycobacterium sp. JDM601]MDNASQKAFGRPDGVPGSFIPAEVRPKKYREQGEFTPRDLPPDPVLREAF
GRPFGSGPSLQRHPADAGALQRNGKPDEFTETDDPWRDPAAGVALGGPAV
VPPAPLARGEVGGRLGVRDVLFGDRISYRALATLAAIALAIGMVGGWVGR
TTAQVVEAFTSSKVTLSTKGNAEEPAGRFAKVAEAIANSVVTIESVSDDQ
GMQGSGVVIDGKGYIVTNNHVISEAANNPSKFKTTVVFNDGKEVLANLVG
RDPKTDLAVLKVDNVDNLSVARLGDSDKIRVGDEVIAAGAPLGLRSTVTH
GIISAVHRPVPLSGEDSDTDTVIDAVQTDASINHGNSGGALIDMDAQLVG
INTAGKSLSDSASGLGFAIPVNEMKIVAEALIRDGKIVHPTLGVSARSVS
NAIASGAQIANVKVGSPAEKGGILENDVVVKIGDRTVANADEFVVAVRNL
TIGKEAPVEVVRDGRHVTLMVTPTPDG
333989835YP_004522449.1 RNA polymerase sigma factor SigE [Mycobacterium sp. JDM601]MPSPDGGSETEDVTITTLLPPVAMSHPTTHSDRYSDTEWVEPSEEPQGTA
VFDATGDVAAMPSWDELVRQHADRVYRLAYRLSGSQQDAEDLTQETFIRV
FRSVHNYQPGTFEGWLHRITTNLFLDMVRRRGRVRMEALPEDYDRVPADE
PDPEQIYHDARLDPDLQAALDSLAPEFRAAVVLCDIEGLSYEEVGATLGV
KLGTVRSRIHRGRQALRDYLANRSGQRDGAAFGGVAAG
333989833YP_004522447.1 transcriptional regulator [Mycobacterium sp. JDM601]MRSADLTASAKIRDAAIEQFGRHGFGVSVRAIAEAAGVSAALVMHHFGSK
EGLRRACDEFVAEEIRSGKSEAMRSADPATWFAAMAEIESYAPLMAYLVR
TMQSGGELATTLWRRMVDNAEEYLDEGVRAGTLKPSRDPKARARYVAITG
GGAFLMYLQMHENPTDLRAVLRDYSRDMVLPSLEIYTEGLLADRTMYDAF
LERETDAT
333989831YP_004522445.1 tetronasin-transport integral membrane protein ABC transporter [MycMTTAAAPQASPASGPFRRGRDFAGTLGMLRLYLRRDRIVAPLWVLLLSLP
LAGVYIASVAAVYPTAADRAGLAATIMASPAQRAMYGPVYNDTLGAVGIW
KAGISHLLIAIAVILTVIRHTRADEEAGRTELIDSTAVGRYAGLTGALLL
AFGASVVTGVIGAAGLLTADVPAAGSWAFGAALACSGLVFAAVAAVAAQL
SPGARFARGAAFGALAAAFTLRAVGDAGSGGLSWLSPLGWSLQVRPYAGE
RWWVLLLHLVTTAALTWLAYRLAARRDVGAGLLADRPGPRRAAPTLAGAF
GLAWRLDRGALLLWTTALLLYGLLVGSVTHGIGDELGSDSARDIVIRLGG
TEALEQAFVAVAFAMLGMVAAAFAVSLVLRLHQEESTARAETLLAGSISR
NRWLASRLVIALAGSAIAMLAAGGVAGIVYGTAAGDVTGQLGTVVGSAAV
QLPAVWLPAAVAVALFGRAPRFAPAAWAVLIGFVALNLLGTIAGLPQWIL
DLEPFGHVPLVSIGFSALPLAVLLVIDSALITFGALAFRRRDLDT
333989829YP_004522443.1 hypothetical protein JDM601_1189 [Mycobacterium sp. JDM601]MAGALGAAAVLGLTPATPASPAQADWDWGIDLIAPMAAVDTSEPGLDLGS
LMELAQTWVDQLDPATNAFFSTTIDAVLALPGPGQAFDAAAWLDQFFYAP
LHASLQEWITSPFGEFSLGLINAPFVTLFGRDLIGDGIDGYDGVNDSVFG
QWGGFGDAGDGGFLFGNGGAGIDGAGGAGGDAGFFGHGGAGGMGAIGAVG
GDGGAGGWFMGIGGTGGAGGDGDLGGDGGNGGTGGAGGWWLGSGGSGGAG
GDGGAGWADIEAGNGGAGGDGGAGGLLLGRGGDGGLGGEGGAGGLGGPGG
WLGASGISASPYVERTQWVEYDDGTSLRVYPTDTGRTEAGETGTLRQGEQ
AWSEVVNRNPDANTAGMREQFLCHWQFAEFILPGKTSWNLEPWRPVVSTL
SMLANGCNPGGAEEPF
333989827YP_004522441.1 glycosyl transferase [Mycobacterium sp. JDM601]MRVAMLTREYPPDIYGGAGVHVTNLVEALRRLCHVDVHCMGAPRPGATAH
QPDPALRDANPALGTLSADLTMADAVGTADIAHSHTWYTALAGRLAALLY
DIPHVLTAHSLEPLRPWKAEQLGGGYRVSSWVEQLATTAADAVIAVSSAM
RDDLLRVYPELRPDRVHVIYSGIDTEVWCPQPATTASSMLAELGVEPDRP
MVAFVGRITRQKGVAHLVAAAHRFHPEAQLVLCAGAPDTPEIAAEVSAAV
AALAATRSGVFWIQETLPARQIRELLSAATVFVCPSVYEPLGIVNLEAMA
CGTAVVASDVGGIPEVVTDGVTGSLVHYDPADPDGYCTGLAAAVNALIGD
PTTARRYGEAGRLRCEEVFSWPRVAEQTHAVYRQLGAG
333989825YP_004522439.1 DNA-3-methyladenine glycosylase I TagA [Mycobacterium sp. JDM601]MTGAPDDGLVRCAWSDGSALYRDYHDREWGRPVREATALFERISLEAFQS
GLSWLVILRKRENFRRAFADFDVETVARYTDADVARLMADAGIVRNRAKI
EATIANARATIALGSTDLAELLWSFAPPARPRPADLSEIPAVTPESTAMA
RELKRRGFRFVGPTTAYALMQATGMVDDHLQSCWVPTVTA
333989823YP_004522437.1 glucosyl-3-phosphoglycerate synthase [Mycobacterium sp. JDM601]MTDLVAGLGDTRLAGRTWNRPDWTVAELLAAKAETGRTVSVVLPALNEQA
TIESVIDSITPLLDNLVDELIVLDSGSTDDTEIRSIAAGARVVSREQAVP
EVAPQPGKGEALWRSLAATSGDIVVFVDSDLIDPDPMFVPNLVGPLLTGD
NVHLVKGFYRRPLKVNGTEDATGGGRVTELVARPLLTALRPDLGAVLQPL
GGEYAGSRELLASVPFAPGYGVEIGLLIDTYDRLGLDAIAQVNLGVRAHR
NRPLAELAVMSRQVVATLLSRCGVPDSGVGLTQFFAAGPDGTDYLPRTTP
LSLVDRPPMNTLRQR
333989821YP_004522435.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MSDHNSGTRIGLTDIATRLPVLVADLPAMLRGMRTGLLARPTSKASIGKV
FQDRAAKHADRVFIRFGDQQLTYREANATVNRFAAVLAARGVGHGDVVGV
MLRNSPNAVLMMLAVVKCGAIAGMVNYHQRGDVLVHSLGLLEAKLLIVES
DLVSAVHDSGATAEPVTIEEFERLAATAPADNPVSVEAVLAKDTAFYIFT
SGTTGYPKASVMTHYRWLRALATFGGIGLRLRGSDTLYCCLPLYHNNALT
VAVSSVLNSGATLALGKSFSASRFWDEVIAADATAFVYIGEVCRYLLNQP
AKPTDRAHKVRVIAGNGLRPEIWDEFTDRFGIKRVCEFYAASESNSAFLN
VLNVPRSTGLYPLPLAYVEYDHDTGQPLRGEDGWVRRVPSGQPGLLLSPV
NRLSPFDGYTDPEANEKKLVRNAFRDGDCWFNTGDLMRPQGMGHAAFVDR
LGDTFRWKGENVATTQVEAALSADESVEECAVYGVEVPDTGGRAGMAAVK
LRDGASFDGARLAATVYDRLPSYAVPLFVRLVETMAHTTTFKSRKVELRE
QGYGAGDAGIHEPLYVLAGRDEGYVPYYAEYPGEVAAGKRPRG
333989819YP_004522433.1 hypothetical protein JDM601_1179 [Mycobacterium sp. JDM601]MPIRWNVPEHSAALHRLTEALDAAGVRAGAVVLGPDGCGKSTLARLAAED
RARRHPTTRIRWVIGTPAERTVPFGALSHLIRVADIGKPAALLRAARESL
AEEARDGGELLLVVDDAHQLDILSATLVYQLALTGAARMIITGCADAAPI
AAPPVAALWGDELLARIDIAAPDEVTGAGDVDAFVAELPAPARAVLDYLA
VIEPLPLADLTQLTSAGAVGQAEELGAVEIRSRGGHGPDPVVYTAHPLFG
ERARGALGAPDGEAARRLRTEVVAVLSNRPCEHVGEQLRLAALTADSDAP
QPVGELVGAAQQALRLGDLKLGERLARSALDRSGGLPARLALAHALGWQG
RGRDADAVLAAVDPAELTEPELMAWALPRAANQFFMLGEPERAAAFLAAT
RGRVTGTTPRITLDALGATFAMNAGNIGRAAEAAAAVLADPAADDMAVAW
AGSAAALCAARAGRFDDVGALARRALDAEHPGLLRFTIGLAEITVLLMTD
RLTEAHETARQFTDFAELAQPGRAIGEVLVAQVLIAVGEFDAAAQLLAPA
AATLERTGYSWGPLSLTLLATALARQSDIAGAAKALSRAESRHGTKSALF
APELGMARAWQRAGMRDRHGAVTAARDAARMAERSGQYAVALQAWQVAVQ
LGDARAVDPLARLCEEVDCAFGREALAAARALTAGG
333989817YP_004522431.1 transferase [Mycobacterium sp. JDM601]MATLAADGSVLDTWFPTPELDGSGDPGTARLAAADVPADLAGLLGRDEDR
GTETVAVRTVIGALADKAADAYDAYLRLHLLSHRLVAPHGLNADGLFGVL
TNVVWTNHGPCAVEGFEATRARLRRRGPVTVYGVDKFPRMVDYVLPSGVR
IADADRVRLGAHLAPGTTVMHEGFVNFNAGTLGTSMVEGRISAGVVVGDG
SDVGGGASIMGTLSGGGTQVISIGQRCLLGANSGLGIPLGDDCVIEAGLY
VTAGTKVAMPDGTTVKARELAGGNNLLFRRNSSTGAVEVVARDGQGIALN
EDLHAN
333989815YP_004522429.1 transmembrane proteinm MmpS5 [Mycobacterium sp. JDM601]MKRLISRVWLPVVIVAAVTAGAVTVAQLRTVFGSHPVVITDISSDNAEDF
NPKFVTYEVFGSGTTAVINYMDLEGKPQRIPSAALPWTLTLQTTLPSVMP
NILAQSDGDSISCRVTVDDEVKQERTATGVNAETFCFVKAA
333989813YP_004522427.1 hypothetical protein JDM601_1173 [Mycobacterium sp. JDM601]MKNWTLAVGALLTGATFLLGGCSEVSKVVNKGGDTTCQEFNGHDDEKQRS
EVSKMLKDKNGNEPSNMELSATRVAVSAYCKTIGKDSDKISNAML
333989811YP_004522425.1 transcriptional regulator [Mycobacterium sp. JDM601]MHDQSDQRRGANRTRRLPRNQQRERVLRLVTCATGAVDASEIATQMGLHV
TTVRFHLDALCEDGSVARTRIKRDGVGRPRTGYVAVRDRLDYRGLAEILA
MELGDTAAERRQRAERAGRRWADRIMAQDGSDESADAARNGEPAPALDDR
TGRIADAFERMGFGPEITAPADVGDGHRECAIRLHACPVRDLARSHPEVS
CAMHLGLLRGLLSTDADGDENTALHAELEPFVEPELCIARVIGR
333989809YP_004522423.1 hypothetical protein JDM601_1169 [Mycobacterium sp. JDM601]MRVHPEVADALAAGRAVVALESTIITHGLPRPDNLRIAREIEDAVRAGGA
VPATIAIVDGRPHIGLDEPALHRIATGGTAIKVSVRDIAMVAAMGGDGAT
TVAATAHLAAAAGITVFATGGLGGVHRGARDSYDESADLVTLSRTPVLVV
CSGVKSILDIGATLERLETLSVGVIGYRTDRFPAFYLTDSGYPLDWWVQT
PKQAAAVLRARTRLRTDGCGLVLANPIPADAELDRALHDRVLADGLAAAE
AAGVRGKDVTPFLLDHFHRGTHGASVAANVALVLANARLAGEVAVAFAAR
333989807YP_004522421.1 PPE family protein PPE31 [Mycobacterium sp. JDM601]MDFGALPPEVNSARIYSGAGSSPLIAAASAWSRLAAELTSAATGYEAIVM
RLVGEDWLGPSSASMAQAATPYLEWMHATAARAEQAATRAREAAAAYDCA
VAATVHPADVDANRIQLSSLLSTNVLGQNTSAIAVTEADYGEMWARDAAA
MYQYAGESASASQVAPFSGPDPTTTGNSPSSHLVSTVQSALASLTAPASS
AAGAADASTSPLDDMLGDLYAMVGLKYTPESPIANLLAPWTSYVAPAQSS
IAIAHFSTGAINSGVSLSKALAPAAAATKAAGDGAKAAAGALPAALPAAG
LAAPLGGGSPVAAALGNAAAAGRLSVPAGWTAAGPAAGAVPPIPVSTVSA
ISPDAEGSGNLLGGMPLAGAGAGGRGSGPRYGFAPKVMARPFSAG
333989805YP_004522419.1 PPE family protein PPE51 [Mycobacterium sp. JDM601]MVMDFAALPPEINSARMYSGAGSAPLLAAATAWSAVGKELYSAAELYGSL
ISQIVEASWWGPSATTMLTAVGPYVSWMTATATEAEQAADYARAAAGAYE
IAYAATVPPSEVAANRSLLALLVATNLLGQNSSAIAATEAHYAEMWAQDA
VVMYGYAAASRVATMVTPFQTPPETTAAGGEERQRDAVTRAVGSAAQQQV
STDLVEDIRQWLQHLSASPSQYAVWEDLKANLPQMLKSSTSTVQIVQRLA
STPTNIMNIAKGILPPASSATAVPPVPSGPIPPVTAGAGGVPAAGVGRAG
TVGRLSVPPSWSGAVTETTPQPLPPPAAATSSGESQPRGILRGMPISGGG
AARRSDGYVNRYGFRYSVLTRHPAGG
333989803YP_004522417.1 hypothetical protein JDM601_1163 [Mycobacterium sp. JDM601]MALPHAILVSLSEQAGSGYELANRFDRSIGYFWSATHQQIYRTLRGMEAD
GWVVATEVAQRGRPDKKVYTVAEAGRDELARWLAAPLAGRGSSIVDNRLR
ELAVKIRGAGYGDAAAVREQAVMLRAERSARLDVYRALEKKQFPDPGSLS
GAALHQYLVLRGGIRAEESAIDWLDEVKEALR
333989801YP_004522415.1 F420 biosynthesis protein FbiC [Mycobacterium sp. JDM601]MREIPGVGAARMTNPSALRRVLRRARDGVLLNIEETAIAMSARGPDLADL
CASAARVRDAGLVSGGRRGPGGRLPVSYSRKVFIPVTHLCRDTCHYCTFV
TVPGVLRAQGKQMYLGPDEILEIARRGSELGCKEALFTLGDRPEERWPEA
RQWLDERGYDSTLAYVRAMAIRVLEETGLLPHLNPGVMSWSEMSRLKPVA
PSMGMMLETTSRRLFETKGQAHYGSPDKDPAVRLRTLADAGRLSIPFTTG
LLVGIGETLAERADTVHAIRKVHKEFGHIQEVIVQNFRAKEHTAMASTPD
AGFEEFLATVAATRLVLGPKMRVQAPPNLVSTQECLALIGAGVDDWGGVS
PLTPDHVNPERPWPALDDLAAVTGQAGYDLVQRLTAQPDYVQAGAAWIDP
RVRPHVAALADPDTGWARDVNPVGLAWQEPDEVVSAGRVDLHTAIDVDGR
ATETRSDLGSAFGDWESIREQIHQLAARAPERVDTDVLAALRSAERDPAG
CTDAEYLALATADGPALEAVAALADSLRREAVGDDVTYVVNRNINFTNIC
YVGCRFCAFAQRKGDADAFSLSNAEVGQRAYEAHLAGATEVCMQGGIDPE
LPVTGYADLVRAVKARVPSMHVHAFSPMEITNGVSKSGLSIREWLISLRE
AGLGSIPGTAAEILDDEIRWVLTKGKLPTSMWVEVVTTAHEVGLRSSSTM
MYGHIDSPRHWIGHFKVLRDIQDRTGGFTEFVPLPFVHQSSPLYLAGGAR
PGPSHRDNRAVHALARIMLHGRIPNIQTSWVKLGVERTQVMLNGGANDLG
GTLMEETISRMAGSEHGSAKTIAELVGIAEGIGRPARQRTTDYAPLLPRA
CASPADTPG
333989799YP_004522413.1 N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha- D-glucopyranoside MSDQTPRLLFVHAHPDDETLTTGATIAHYAARGADVHVVTCTLGEEGEVI
GDRWAHLAVDHADQLGGYRISELTTALRELGIGDPQFLGGAGRWRDSGMA
GTSPRRQQRFIDAADAETVPALVAVIQRVRPHVVVGYDPYGGYGHPDHVH
AHRVTTAAVAAAAADDAGPGRAWATPKFYWTVTAASAWRDARRALRDPDR
LPHWSLPGEGDTQSTVGEFPDDRIDAVIEAPGSRAAKLAAMAAHATQVAV
GPTGRAFALSNNVAQPILDSEHYVLAAGSAGPRDGRGWETDLLAGLGLAG
AGQAVSSC
333989797YP_004522411.1 hypothetical protein JDM601_1157 [Mycobacterium sp. JDM601]MMLLVLTQLTAACTVNPPPAPQSTETPKSTAPPPKRVSQIIMGIDSIGAG
FNPHLRSDLSAVTAAISALVLPSAFRPIPDAGTPTGSRWEMDPTLLVSAA
VTAEAPFTVTYRIRPEASWTDNAPIAADDFWYLWQQMVSQPGVVDPAGYD
LITGVHSVEGGKQVVVTFAKPYPAWRELFSNILPAHIVKDVPGGFPAGLA
RALPVTGGQFRVENIDPQRDAILLARNDRYWGPPAKPDLVLFRRAGSPAA
LADSIRNGDTQVAQVHGGSAAFAQLSVIPGVQTSRVVTPRVMQLALRAGQ
PKLADVRVRRAVLGLLDVGLLATVGAGSDNTVTLAQAQIRAPSDPGYVPT
APPAMSDSAALALLQAAGYRVEKDAPPSALVPPAGAEPAPPHPPEITRGR
ISKDGEQLSLVIGVAANDPTSVAVANTAADQLRNVGIAATVLPLDPVKLY
REALVTHQVDAIVGWQQAGGDLATLLASRYGCIALESTTVPTSSGPAPAP
VPAPSSPPVTGSPTPTSQAPPRPAGSGALVQAPSNVTGVCDHGIQTEIDA
ALDGGKTIGEVISAVEPRLWSMATVLPILQDTTIVAVGPSVANVSLTGAV
PVGIVGDAGTWVKRP
333989795YP_004522409.1 MarR family transcriptional regulator [Mycobacterium sp. JDM601]MALPDDVYTRLLTFRTRLRRFERWSADQAQAAGLTPAQHQLLLAIRGHAD
SRGPTVGDIAEYLLLRHHSAGELIQRAEAAGLVIRVRDNEDQRVIRLQLT
EAAAQCLQALTELHLEELERFSAESPLGL
333989793YP_004522407.1 hypothetical protein JDM601_1153 [Mycobacterium sp. JDM601]MKALAAPLGALLMLVAAGPAQADPADVDTDFLAALQAAGITYNRPDQAIV
TAKMVCRFIAEGKPSPEVLDGLKERNPGLTTEHGSMFVGIAAHSYCPDQL
VQNPVPAP
333989791YP_004522405.1 nitrate reductase subunit delta [Mycobacterium sp. JDM601]MKRFIRSLRRQPGGPSDRAVWQAASLLLAYPDEQLHQRLDTVDALLVHAD
EAPAGLLARTVTALRASDPMAAAVDYVETFDMRRRSTLFLTYWTGGDTRN
RGMQMLAFATAYRDAGAEPPPGEAPDHLPVVLEFAAQVDPQAGRRLLLAH
RVPIDVLHKSLTDAGSPYAHTIAAVCHTLPAATDQEVRNVSELMTSGPPA
EAVGLQPYSATVALGMPKVPTR
333989789YP_004522403.1 respiratory nitrate reductase subunit alpha narG [Mycobacterium sp.MTLAKPPTPRIGGPLEELLERSGRFFTPGEVSADLRTVTRRGGREADSFY
RDRWSHDKVVRSTHGVNCTGSCSWKIFVKDGIITWENQATDYPSVGPDRP
EYEPRGCPRGASFSWYSYSPTRIRYPYARGPLVQMFREAKARLGDPVLAW
ADIQADPERRRRYQQARGMGGLVRVSWAEATEMIAAAHVHTIKSYGPDRI
AGFSPIPAMSMVSFAAGSRFIQLLGGVMTSFYDWYADLPVASPQVFGDQT
DVPESGDWWDAAYLMMWGSNVPITRTPDAHWMAEVRYRGTKVVSVSPDYA
DNTKFADEWMPCAAGTDGALAMSMGHVILSECYVKQEVPFFTDYVRRYTD
LPFLIKLEERDGRLVPGKNLTAADLGGAAAASENAAFKPALLDESTDSVV
VPNGSLGYRWGDEGIGKWNLDLGEVRPALTVLDTTERNGHRRTALVSLPG
FDAVDGHGTVVERGVPVRQVGEHLVCTVFDLMLANYSVGRPGLPGEWPGG
YDDGTQVNTPAWQEPITGVSASQAIRIAREFARNAEESGGRSMIIMGSGI
CQWFHGDATYRAVLALLMLTGSMGRNGGGWAHYVGQEKVRPLTGWQTMAA
GNDWSRPPRQVPGTSYWYAHTDQWRYDGYGADKLTTPVGRGRFAGKHTMD
ILASATAMGWSPFYPQFDKSSLQVADEAEAAGRDAGEYVAEQLAAGELKL
SVTDPDNPVNWPRVLTVWRANLIGASGKGGEYFLKHLLGTDASVLGEPPA
DGVKPQDVRWDNDIPEGKLDLLMSIDFRMTSTTLMSDVVLPAATWYEKAD
LSSTDMHPYVHSFAAAIDPPWETRSDYDAFGAIARTFSGLAKKHLGVRND
VVLTAMLHDTADAMAYPEGSERDWLRTGETPVPGKTMPKVTVVERDYAAI
HDKWQTLGPLVETLGLTTKGYTVFPHEEVEDLAGRFGVMKSGAGQGRPAL
TTATRMADTVLALSGTTNGRIATEGFRELEKRTGQRLAHLSEGSEEKRIT
YADTQARPVPVVTSPEWSGSETGGRRYAPFTINIECLKPFHTLTGRMHFY
TAHDWIEELGEHMPVYRPPLDMARLFDAPELGEVGDGIGITVRYLTPHSK
WSFHSTYQDNLYMLSLSRGGPTMWMSPGDAAKIGVKDNDWIEAVNVNGIF
VGRAIVSQRMPDGVVFVYHVQERTVDTPRSETNNKRGGTHNSLTRIRVKP
SHLAGGYGQHAFAFNYLGPTGNQRDEVTVVRRRRNQDVRY
333989787YP_004522401.1 pterin-4-alpha-carbinolamine dehydratase [Mycobacterium sp. JDM601]MDAALPDLDGWERTDGALRRSVKFDSFLAGIEAVRRAAERAEAADHHPDI
DIRWRTVTFALVTHSEGGITDKDVAMAGEINRILAS
333989785YP_004522399.1 hypothetical protein JDM601_1145 [Mycobacterium sp. JDM601]MSRFRTLFNTTATATVAVGSSAALLFGGLPGFGAIAAADPAVPALPLPAA
GFPGLPAIEQLSPVIQQAAADPAGASQLLMAAAAAFAGNSSAPAGSRQVA
DSVAQFVQSPPEAPATLPGQHVPTAGSAPGLVAHLPSGVDPAKSVGPVPQ
AAPSAPEAVPAPAEAIPAPPESAAAAAGAVTTPPAEAVPAEAAAPEATPA
AANPGFGPDAPPTQDFMYPSIGQNCLADGGNVIATALSVAGPATIPTPGP
KAGQTAYVFTAVGTPGPAETQKLPLNVTWVNLTTGKSGSATLQPRSDINA
EGPTTLTAIVDTGSGSIMSTIFGQVSTKDHQCNFLPTIGSTVVP
333989783YP_004522397.1 hypothetical protein JDM601_1143 [Mycobacterium sp. JDM601]MPKLQLVGDTDADALLGADPFALLVGMLLDQQVPMEVAFAGPKKIADRMG
GLDPHDIAGRDPEEFAALCAEKPAVHRFPGSMAGRIQALARAVIDQYGGD
TTALWTAGEPDGAEVLKRLKALPGFGEQKARIFLALLGKQYDVTPPRWRA
AAGAYGEDGTHLSIADVVDEASLQQVRSTKKAQKQAAKQARDS
333989781YP_004522395.1 hypothetical protein JDM601_1141 [Mycobacterium sp. JDM601]MPESDSAAAENKRKFREALERKNAKSAGGSEHKDAGAKQSRSHGPLESRR
EFRRKSG
333989779YP_004522393.1 hypothetical protein JDM601_1139 [Mycobacterium sp. JDM601]MRGFAVVTIAQMVRYAAFLRGVNVGGVNLKMADVAATLTQAGFTGVRTVL
ASGNVLLESPNDAATVRTTAEAALQERFGYPARVLVYEVEAVRAIVAAYP
FEPEVPGAHSYVTFVADPAVLAELSALAGLGSDGKITPGDGVIYWQIPKG
DTLGSTLGKTMGAKRYASSTTTRNLRTLSKVLR
333989777YP_004522391.1 transcriptional regulator [Mycobacterium sp. JDM601]MQVAVFSGAGISAESGVPTFRDDEKGLWSQYDPYEVSSIDGWNRQPELVW
GWYLWRCQLARRVEPNLGHRAVADWEQHAEVHVITQNVDNLHERGGSSRV
HHLHGRMFTFRCGDCDQPQDPEVPVMTEPVLEVAPPVCECGGLVRPDVVW
FGENLPEEPWNAAVEAIDNADVLIVVGTSGVVYPAAGLPERALELGKVVI
EVNPEPTPLSERATTYLRTTASAALPGMVQRLPFLLGQR
333989775YP_004522389.1 hypothetical protein JDM601_1135 [Mycobacterium sp. JDM601]MWIDDSSADVIKVDFEALYHGDLLVEGDTSEQLDDWHPLAS
333989773YP_004522387.1 biphenyl-23-diol 12-dioxygenase [Mycobacterium sp. JDM601]MIFGRVHLGYIVIETRKFADWRRFGRDAIGLHVDDTLADVMRFRLDDNDC
RFLLQRGAGEDVTALGWQLDDHAVFDEVVSRVTRHGVPVTEGTAEEAQLR
GVERLVRFPGPNGMAQEIFTRAGSAATPLTMAVRGGFVTGEAGIGHVAIT
TKKPHQMRGYYNTVFDARLSDFIDETLSGVKVKIRFLRVNQRHHSVAIAA
ANRAPINPIRTRIQHLNVQVADLDDMADSYQRVKQLGFRMALGVGQHTND
RELSYYAETPSGFEWEVGWNPIVVDERTWEPTTHRGISIWGHRPEGQTII
DKLTQFKAAAASLRRREDTVPALSGAGIPD
333989771YP_004522385.1 FAD-dependent oxidoreductase [Mycobacterium sp. JDM601]MRIWQSVGLADRLQRDMLPDRPLNFVDTAGVPFIDLKIRPRGTGHPPQQF
LYQPAVDHVLREGVSRFAGVDVLLEHECLRVLDGEDDVELMVADLRTDTF
KRFRASYVIAADGGSSPTRGQLGIGYTGRTYTERWVVIDTKVIKEWDAHD
RLRFHCNPARPTVDCPTPLGHHRWEYPARACEDERDLLRDDAIWKVLGDQ
GITGDHVKILRAVIYSHHVRVADRWRVGRVFLAGDAAHAMPPWIGQGMSA
GVRDVANLCWKLAAVVSGQAPDALLDSYQAERKPHVIETTRRACRVGRII
TERNRVAAVVRNHLLRALARIPGLETAAQKQMWIPHARYADGFFAAGRHR
ALGWQIPQPWVTDGHGATVRLDDLLAGQWAIVYTGLLPPGARAWTGVPAI
RISEPSLVRWLQQRKAAAAVVRPDGFIYAAAESGQQLPAPPAGFGTLTIG
AAA
333989769YP_004522383.1 transcriptional regulator [Mycobacterium sp. JDM601]MAEPAQPKRRRTRADGELSRNSILDAATEIAAERGYEGTSIALVSAKCGL
PASSIYWHFKNKDDLIAAVIARSFSSWLSAWQVPEGGTAEQRFASVATRA
AKALQDSPDFIRLGLMLALERRPVEPRARAMFLDTRIQARRQLVNDFRDF
LPELTEANVQQLADYALAGADGLFIAKEIGGDTVDLLALFELHGRAIYDT
AHRLLREQDAR
333989767YP_004522381.1 2-hydroxyhepta-2-4-diene-1-7-dioate isomerase [Mycobacterium sp. JDMTISVLRTSDGWWVRTPVGAARIESRATTTGQLLANRTAIEAAANSTDTV
PIDTLGMLSPVTAPCRVIAQMTNFASHVRDAGMNPATVPLTFFRKASASI
SGPYDDIVKPGHVNLLDYEVEIGLVIGCDIPVGATISEHDLPDLIAGLVV
TNDVSARDVQLPQTQFYEAKSYPGFTPVGPALVLLDAAELARFGELRLRL
AVNGKVRQNMTVAGDMLYGPLQALQALTRFQNLAAGDLILTGTPIGTALS
APPKPIEILGSVLPPALKWKTFFKRQAGNPKYLQDGDVIEAGVATDDGAI
DLGTQRSIVRYAAAHSPE
333989765YP_004522379.1 hypothetical protein JDM601_1125 [Mycobacterium sp. JDM601]MGMTLRTSDEQAEALRRQAAAEGRSMQAVALAAIDEYIARRTHQAKVSET
LQRVVREEAGVLERLKDA
333989763YP_004522377.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MQIKDAVAVVTGGASGLGLATTKRLLDAGAQVVVIDLRGADAVAELGDRA
RFAEANVTDAEAVTAALDVAESLGPLRINVNCAGIGNAIKTLSKNGAFPL
EEFTKVVQVNLIGTFNVLRLAAERIAKTEPVGEERGVIINTASVAAFDGQ
IGQAAYSASKGGVVGMTLPIARDLSRELIRVCTIAPGLFKTPLLGSLPEE
AQRSLGGQVPHPARLGDPDEYGALAEHIISNPMLNGEVIRLDGAIRMAPR
333989761YP_004522375.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MTTIDSGIDTLAPVEGLSVTLADGVLSVTIDRPDSLNSLTTGVLAGIADA
MEGAARDPRVRAVRLGGAGRGFSSGAGISAEDASDGVPTEIIVEANRAIR
AIVALPRPVVAVVQGPAAGVGVSLALACDLVLASDKAFFLLAFTKIGLMP
DGGASALVAAAVGRIRAMRLALLAERLPAAEALEWGLISAVYPAEEFDAE
VDKALAGLLAGPAAAFAKTKHAINAATLTELDATLDREYVGQSILLSAHD
FREGTRAFQDRRTPNFTDS
333989759YP_004522373.1 siderophore-binding protein [Mycobacterium sp. JDM601]MEGPVTGPLIIPIRGHAPQLHPESWVAPNASLIGQVSLAARASVWYSATL
RAEVEPIEIGVDTNIQDGVTIHVDKEFPVRVGARVSVGHNAVLHGCTVED
DSLIGMGAIILNGAVVGAGSLIAAGAVIPQGTVVPPRSLVSGVPGRVRRE
LSEAEIRNNRHNAAAYRRLIEVHRAN
333989757YP_004522371.1 acetyl-CoA acetyltransferase FadA6 [Mycobacterium sp. JDM601]MAEAVIVEAVRSPIGKRNGGLSGVHPAELSAQVLNGLVTRAGVDPALVDD
VIWGCVMQAGEQALDIGRTAVLAAGWPETVPGVTVDRQCGSSQQSVHFAA
AGVVAGHYDVVVAGGVESMSRTPMGSSLANGGHPYPDAFRHRYSQTPNQG
IGAEMMAEKWGLDRTALDEFALASHEKAAAAQDSGAFKDEIVGITVAGNP
DSTVDADEGIRRGTTVEKMAQLKPAFKEDGVIHAGNSSQISDGSAALLFM
SAAKARELGLTPLARVHTATLAGADPVMMLSAPIPATQKALQRSGLSVDE
IGVFEVNEAFAPVPMAWLAEIGADAKKLNPNGGAIALGHPLGGSGARIMT
TMLYHMRANGIRYGLQTMCEGGGQANATILELL
333989755YP_004522369.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MTPLRFDERVAVVTGAGRGVGRSHAKLLAAKGARVIVADHGVGIDGGGSS
PEPADEVVREISESGGRAVACYASVAEPEDAQTIIDTAIETFGRIDVVVN
NAGIHDPGLFTELSVEQFRRMLDVHYLGTVAVCRAAWPHFVAAGYGRVVN
TVSEAMLGGISELTSYGAAKGAVFGLTRNLATEGIRHGIRVNAVAPRANT
RMSASHSDSVAAQLSIPKDVMNTINASMPPELCAPAAAFLAHEDCPLNGE
VLQIGMGGVARLAVVRTAGITKSPLSAEDIAENLEQIMNISDAQVTAVTE
MVQ
333989753YP_004522367.1 NAD dependent aldehyde dehydrogenase [Mycobacterium sp. JDM601]MAEHPRFESKMMIDGALVDGQAGTFSNVNPATEEVLGEVADASAADMHRA
IDAARRAFDDTDWSVDHKFRQRCLVQLQQALEGEQEKLREELIAEAGCPR
AITYGPQLDAPLSDALRFPGQLIDDYPWETSLGDAFVSVTGANTTRMVWR
EAVGVVGAIVPWNFPFEVTIHKIGQALATGNTVVLKPAPDTPFNATRLGR
LIAENTDIPAGVVNVVTASDPLIGEELTLSPKVDMISFTGSTAVGKRIME
KGAATMKRLFLELGGKSATIVLEDADLGLGAMMGIAPCVHAGQGCANPTR
LLLPRSRYAEGVAILQGIYEGVAPGDPQDPATLCGPVISAKQRSRIRGYI
DKGIAEGAKLLVGGAEPPDGLDRGFFVKPTLFVDVDNSMTIAQEEIFGPV
LAVIPYDDENHAVRIANDSVYGLAGNVMSGSLEHGLAVAKRLRAGFLGIN
GAAGYGADTPFGGYKASGVGRQNGTAGFDQYTEIKSVAFPAVSEARRRRA
EAGPPNQAAG
333989751YP_004522365.1 hypothetical protein JDM601_1111 [Mycobacterium sp. JDM601]MTAEQTAPSSTRPAPAEPRKGSPWVWAWAAAAFGFLAFLLANAETGLSSD
RVRNAAVTETPPPRPVPVLFGFEHWLGVLEAFTVVVMLGITITYVIAWRR
HPYHPVLLMGIVTTLIVWQDPIMNWAPFAVYNPELHHLPEDWPLVSLSPT
VEPFVVLGYIMFYLLPYFPGIWLLRRIQARRPVDSFVWRHPLISLAICIL
PFGMLLDAALEITLVQTGMYIYSQVPFGSIFVGQTHQFPFIFEILAVNFV
MVPAGVLLYRDDTGRTVAEKLAQRAKIFASRPTLGMFTVMLVLINLGYFC
YGGTFALVKAAHLSRTVACAWPYPEAKIYDPQGFYEKQGQPGPYSVGIWS
TWLSGQPDGRPDVELGADGDRCGPGNG
333989749YP_004522363.1 ATPase [Mycobacterium sp. JDM601]MNDMATAVRGPRPYYVSTGNEEQVFKAAYRQGLSIVLKGPTGCGKTRFVE
AMAHDLDRPLITVACHDDLTTADLVGRFLLRGGDTEWVDGPLTRAVRDGA
ICYLDEVVEARQDTTVVLHPLADHRRQLPIERLGLTLDAAPGFGLVVSYN
PGYQSVLKDLKDSTRQRMVAIEFGFPATDVEEKIVACEAGVDHERAAELV
RLGQAIRRVETGGLREVASTRVLIAAGRLIAEGLAPREAARAAIAGPLTD
DSVVTGGLVEMIDVYLPER
333989747YP_004522361.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MIDFTDQVVVVTGAGRGLGRLYALELARRGASVVVNDLGGSMGGDGADSS
IADLVVDEITAAGGVAVASHDSVDSPAGGEAIVATAVERFGRLDAVISNA
GIFNSIAFEDISADDWRRMLRVHLDGGFYLSQPAYRVMKKQNYGRFVFIS
SSAGMFGQPLEAHYAAAKCGLIGLSNVIAIEGAPHGILANTVLPFGFSRM
VSETVGDPEVVAEASFLKAIQPELVVPIVTFLASRACESTHHNYSACAGR
FARVFAGLGPGWLADPATGPTAEDIAAHLAAVSATEPFRVPASIFDEVFG
VCEQLGITA
333989745YP_004522359.1 hypothetical protein JDM601_1105 [Mycobacterium sp. JDM601]MSQPASGSRSATATRRPRGEARRLLLDAARELFARQDYRSTTTREIARAA
GVTEPLLFRHFGSKAALFREALVEPFTSFIDEFGRTWQALDPEQTGEEEL
ARHFVGRLYDVFVGHQGLLVTLMAPDSLTDDEMVEAGIADVRRAITLLGQ
ISAEGMNLRSIGSAHPNLPAHSTVAMIAGMAALRSTYFGSRPPSRKVIVE
ELTQATLHGFLHRDNQER
333989743YP_004522357.1 hypothetical protein JDM601_1103 [Mycobacterium sp. JDM601]MAGTALLPTLLVTIPVGVTLSIQFAVLAGQVGAESLSGAANGLVVIRQGA
PLVAAILLAAAVGSAVSADLGSRTMREEIAAMEVMGVSAIRRLVVPRFAA
LILVGVALTGLATCAGFFVGYLFNVYVQSGTPGSFVATFASFATVDDLTL
AMAKAIAFGAIVAVIACHKGLDAHGGPAGVANSVNAAVVESILLLMIVNV
GMSQLYLLLFPRASL
333989741YP_004522355.1 Mce protein Mce5A [Mycobacterium sp. JDM601]MPNSFDANDGGPSNARLFFDGLGLLAIVAIAVTLMIAQSQGVLQHSVRVS
AELTNVGDGLPVKSDVKFRGVLVGFVSGVTPAAAGHPNIVRIDLRPAYAA
GIPDSVTARVVPSNVFAVSSVQLVDNGAAAAPVRPGAVIAEDQTLPTVLF
QTTLNKFRQLLAAVGRQPTADSVGWLTALGDATSGRGDRLQHAGHDLNQI
VDQLNTIVTGDEIGPSTMSALTEATAALGQAAPELLDALDGAVQPMRTLA
EKRSELLGLLSVGLGTAGTLGDAFDNNTERMIEISTNLTPVLGVLGDHAE
TTHDIAARLTTLVGRVMDVAWNYETSQLQAKAVISLNPTRTYVRSDCPRY
GDMLGPSCFTAPEVPTAPALTPSLESRGFPLPPGITENRPNYAPPRFSVP
PPAADPEAEPPQPPPPDPAPPAQPPAAVIGGNVGPVGSRNEKQQLEVILG
DQANSASEILLAPVLRGTTVRFTAGPGGGR
333989739YP_004522353.1 MCE-family protein Mce6C [Mycobacterium sp. JDM601]MTVAVLALVITALVGVGKLSLGHRGYSAEFAQAAQISPGDQVTVAGIEVG
TVADVALTGDHVTVKFTVRKGVRVGDASRAAIKLTTLLGRRYLELTPAGE
GELPSRTITLANTAVPYNLQATLADATTTFEQVDADRIAASMAELGNGLS
GMPEALPEALANVKTLAAVVASRRDQLGSLLKNVDTVTGVIRDQQADLGA
LVIQGRDLLQTVNARQAAVHRLLTGTAALVDTLKMLFNDEPAINELLANM
QQFAQMAATHDALIRNTLQVMPVAFRNLANASGSGTALDINLPAGVLIDS
WMCALSERGKQFGLAQYFTDCQPSGDPFPGWPPPDPARQPR
333989737YP_004522351.1 MCE family lipoprotein Mce6E [Mycobacterium sp. JDM601]MMRTLIAATTAVTLSGCAGGLASIPLPAPGRVDGDITLTAVFANALNLPL
KAKVKLNGADIGEVAAIRAEEFSAHVTMKISAGAPLYADTVAELRSATPL
GDIFVAVHHGPDAAADATRLRDGDTIALDHTTSAATIEDVLGSAALLVNG
GAIRRLVSTVNGAGDAVGGRGTKVAALLHNSNTLLSRLNDRSTQLDTALR
NTSDLAATLSARRNTLNTVLAAATPATGALADSATNLADMAAAGGRITRQ
LNRFPSMQGTDTRSTISDLNRLSDVFNQISMDPELNLNIWNRMITGITHI
TSGPDIHAVGTVTQLAIGALPDKNYPGDPGTHGPDGTDWHAMIGSLRYEW
NLLLGRIYGPEHRPR
333989735YP_004522349.1 Mce associated membrane protein [Mycobacterium sp. JDM601]MATRLLDDPAEADVAGTACEKAALSCEPERQPRRVMLVAATGISVTALAA
LAFLGWQYQQHRVVADASRAALASARDYATTLTSIDAGRVDDNFAKVVDG
ATGAFKDMYSQSASQLRQLLIDNKAMSKGVVVDAAVKSAAKNTVEVLLFV
DQSISNVANPAGRLDRSRVAMTMERIDGRWLASRVELK
333989733YP_004522347.1 metal-dependent amidohydrolase [Mycobacterium sp. JDM601]MNMADFVLVSVDDHLVEPPDMFDSHIPAKYKDDVPKLIQRSDGTDAWVFE
GQEATNVGLNAVAGRPPDEYGAEPTKLSEIREGCYNIHERIRDMNANGVA
AAMNFPSYPQFCGQYFARATDKDLGLAVLRAYNDWHIDEWCGAYPGRMIP
LALPPIWDPDLMADEVRRVAKKGCHAVTFSENPTKLDYPSLHDPHWDPFW
QACSDENTVVCLHIGSSSSVVITSIDAPVDTMITLQPMSIVNAAADLVWS
PTLRKFPDLRFALSEGGIGWIPYFLERVDRVYKMHRAWTHQNFGDRLPSE
VFLERVVTCFIDDSFGIENRHKLNLDMITWECDYPHSDSTWPLAPESLAG
YLDGVPDDEVDKITHENALRLFSFDMFAKLPREQLTVGALRVQSADVDLG
HRSSERLKKTGTDTVTVLDLAAKLPTGT
333989731YP_004522345.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MSGKLSGKVAFITGAARGQGRAHALAMAREGADIVAIDICRQIESNPYPL
ATPDDLAETERAVKELGRRVVARIADVRERHELRDALDAGLADLGRIDIV
VANAGILPMAMGKPDPMQFVDASDVDLVGVMNTVAVAIPHLPDGASIIVT
GSTAGMIRGTTDNPNMGPGGAGYGWSKRIVMEYVDEMSLHLAPRMIRVNA
IHPTNCNTHLLQNDGMYSMFRPDLTSQGKKATREDAEPLFTLFQAMPIPY
VEPEDMANLGVFLASDDARYITGQHIRVDAGSLLKWPNGPGG
333989729YP_004522343.1 luciferase-like protein [Mycobacterium sp. JDM601]MFTLRFDMRAPASGAPRNELYAAAVEMCAWAETRGAIAAVLSEHHGTEDG
HLPSPPLLAAAIAARTETLTIMLAAVILPFWDPVRLAEDISVLDIISNGR
VAYAFGIGHRAEEYQHFGIDSRARGRVADEKLALLLQLLRGEPVQHQGRR
IHVTPACLRAPHIMVAGASRAAARRAARHGLGLLAQANPPGLKDFYEEQC
RAHGREPGACQFPDADAPTTVFVTDDVDRAWDELGPYLLHDAMTAAAYRH
GDATVASISRATSVAELRETSGPYRIVTADDAVAQLRAGRSLPLLPLCGG
LPPALAWPYLEHAAAAVARGNEGKP
333989727YP_004522341.1 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransfeMKDQIVTAQPFTSTILGSPRIGPRRELKRATESYWAGRIGQDELRNVAAG
LRRDGWAQLAEAGLDSIPVNTFSYYDQMLDTAVLLGALPARVAGVADELD
RYFAAARGNAEIAPLEMTKWFDTNYHYIVPEIGPDTTFALNPTKVLAELA
EAKEQGFGGNVARPVIIGPVTFLLLSKAVDGAPAPIFRLDELTDVYAELL
GKLADAGAEWVQIDEPVLVTDVAADAPALAEQVYARLGGLGKRPAIFVAT
YFGDPGAALSALARTPVEAIGVDLVYGPNTKIASVPELASKALVAGVVDG
RNIWRTDLQAALAKLASLLGSAGAVAVSTSCSTLHVPYTLDGETGLDDAL
RSWLAFGAEKVGEVATLARALREGRDAIDDEIAASNAAVASRKSDPRLNN
ADVRGRIATVAGAHRGSTEARRAAQAERLHLPPLPTTTIGSFPQTVDIRK
ARAALAAGEIDQAEYTRRMKAEIAAVIKLQEDLGLDVLVHGEPERNDMVQ
YFAEQLEGFFATANGWVQSYGSRCVRPPVLFGDVSRPHPMTTEWATYAQS
LTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLESAG
IAVIQVDEPALRELLPLRKADQEAYLTWAVGAFRLSTSGVSDATQIHTHL
CYSEFGEVIGAIADLDADVTSIEAARSHMEVLDDLNAIGFSNGVGPGVYD
IHSPRVPSSDEMATSLREALDAVPAQRLWVNPDCGLKTRKTDEVTASLAN
MVKAAETARAAGAGV
333989725YP_004522339.1 metal cation transporting p-type ATPase CtpH [Mycobacterium sp. JDMMPPSIAALIDDTEPELDSLYDALAAVESHPPDDEHDEVAEGDRPRSAPAP
GDGLLAVSTAAMAGVAAVGLGISLAGRALRLPRLPASVQGAVVALDHQPR
LRRLLEERIGKRATDTALGLASTTANALALAPSMLALDLAINTLKAAETR
AVARAWSRREPALADMAAQPADAPQARTVPPPAGPVERHLERGTWIQAFG
AAVVGAVSRDPNLAGTAALVAVPKAARATLESFAATLGRGLADKNEALQL
RPDGLRRLDRVDVVILDPRVLRSDKLRLVRLRGAGEKDLAAWERAQAMLT
NDALRAGWHAVPDGRRRNGRPRTEALFALAHHPLAAATLAETQRAEVQVV
SIDDPDGLGELRPAFDEIAPLTGSSIDDALLDTLVRYQEDGHTVAVISST
ATQALSSADLGVAIVAEGDGRPQPLVADLIVDDLAGVWRVLHALPAAKAA
SRRGVQLSIGASAMGALLLIPTVRGRGPGPVVLGAASGVFSGYRMARQVV
NTPVPRPVPVDDFHAMSVEQVRAVLALSTETSAAPHAADSTQRHMVWQFI
DAVRDELSDPLTPVLGLGATATAILGSPLDALLVGSVLASNAVLAAGQRL
SAELRLNRLLADQIPPAWKVTIRPDGSRERIQVLPDQLQRGDLIEVGADD
VVPADARVVEHEKLEVDEASLTGESLPVTKQTDATPGAELAERRCMLFAG
TTVAAGRGLALVTAVGPDTEVRRAADMVASRHGDIGLGHQLGQITDRIWP
LSLMTGGLVSLLGVLRATRLQEAVAQGVSVAVAAVPEGMPVVATLAQHAS
AQRLTKSGVLVRVPRSVEALGRVDVICFDKTGTLSENRLQVTEVRAAAGH
APDEVLRCAIQATPPAREGHVDATDAAIIAAAEPAIADCPPAAADVHLPF
RSGRPFAASVTGTQLSIKGAPEVVLAACGDVAAEVYDLVEQLAHDGLRVL
AVARRELSAEQAQSLSDSADPEDQLAAMARQCAHGLRLVGFVGIADTPRA
GSAGLLAELHRREVPVRMITGDHPTTGRAIARKMGLPVTEEQVITGTEWE
SLSGKEQERAVAERVVFARMSPANKVQVVQALERSGKVSAMVGDGANDAA
AIRAATVGIGIVAQGSDAAHTAADVVLLDGRIETLLDALNEGSQLWQRVQ
AAVAVLLGGNASGAVFAIIGSALTGQAPLNTRQLLLVNIVTDAFPATALA
MSQPRRPMPFSGRGPDEKALLRAVALRGTTTAGATLAAWFMARSTGFPRR
AATVALVALVTTQLSQTLLESRSPLVAVTAAGSFAAMALLISTPGVSQFM
GCTPLGPIGWAQALGSTAVATTAAAIAPRFLPRTPEAA
333989723YP_004522337.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MSQLFPDYRPLWETDQHRELRKHAAEFLRKEATPHQERWVAQHGVDRDFW
NKAGDYAMHAVVQEELVYARRFLGAFASSGAQGVEHVLV
333989721YP_004522335.1 methylisocitrate lyase 2 [Mycobacterium sp. JDM601]MSGLLGSATAPADKRAAFRAGLTSGRLQRFPGAFSPLVAKLIAEIGFEGV
YVSGAALSADLGLPDIGLTTLTEVAGRGAQIASATDLPTLIDADTGFGEP
MNAARTVTVLEDSGLAGCHLEDQVNPKRCGHLDGKAVVPASEMVKRLRAA
VAARRDPDFVICARTDAAGIEGLSAAIDRAKAYADAGADLIFTEALSGQA
DFERFRAAVDVPLLANMTEFGKSELLTAAQLTDLGYNAVIYPVTTLRLAM
FAVEVGLREIDTAGTQSGLLEAMQHRSRLYELLRYAEYNRFDDDIFNFTL
EGGQR
333989719YP_004522333.1 transcriptional regulator [Mycobacterium sp. JDM601]MAPSTTRTFAGARLRRLREERGLTQVALARALNLSTSYVNQLENDQRPIT
VPVLLALTDRFSLPAQYFSGDSDARLVADLRDMFTAAAGEHAASDSQIEE
LVARMPDIGNSLLTMHRQLRGATEELESYRLRMSGDAAQPVAHPMPFEEV
RDFFYDRSNYIAELDNAAEKLFIDTGMRFGGLDIQLSALLAEHFGITVAI
VDDLPAGTKRLFDPATRVLRIAHWLLAGQRAFQMATQLALLTQADLLSDI
VAQDESLSPESRGVARIGLANYFAGAFLLPYRQFHRSATELRYDIDLLGR
RFEVGFETVCHRLSTLQRPGRRGVPFIFVRTDKAGNISKRQSATAFHFSR
VGGSCPLWVVHDAFSQPGRIITQVAQMPDGRKYFWIATTTPPEGRGYLGQ
HKTFAVGLGCDLAHADKLVYSTGVALDDQATVVPIGAGCKICDREACPQR
AFPFLGRRVVVDENAGSGLPYSPVTAGGR
333989717YP_004522331.1 hypothetical protein JDM601_1077 [Mycobacterium sp. JDM601]MAAVDAQFYWMSAAIPSDQFLLYAFAGVPADLDGAVAQLAARARESPELA
QRVEDAGALGYPRWVPTFDHVGALRHRAADDSWAGCLDAVVRLTGDQLDA
RVAPWRLHVFAPVHGIPGHHGAGTVAVLQVAHALADGARASALAAWLFGR
AAPVAAVDTPSSRLQPALLPWRAVVAARSHRRRDLDTRAGLLPHPVGDRP
PLATNNPPAGRRAVRTLVRRRTELNGNTVTVAVLSAVSAALSQYLDEPCD
SLGAEVPMAKSGVRLANNHFGNIRVGLYPGYDRAARMAAIANDVANGRLR
SGHPASVAADRAFAATPAALLRWGVEKFDPQTRPVRVAGNTVVSSVYRGA
ADLRFGEAPVLLTAGFPALSPAMGLTHGVHGIGDTVVISVHAAESAISEI
DVYLRLLDASL
333989715YP_004522329.1 Mce associated membrane protein [Mycobacterium sp. JDM601]MRRLVYGVLPGLILVAAIAAGWVKWYDGSLRLDELIRDETIREASEFTAA
VLSFQPDTVERDLSAAEPLMTDGFRESFVARARDLIIPDAKARKVVAVAE
VPAAASVFATPRRAAVLVFADRTITVGSDEPAEVESSYRVALEKVGGRWL
VADFEPV
333989713YP_004522327.1 peroxidase BpoB [Mycobacterium sp. JDM601]MSTAQTVEFDGVNGVTLVADEWNRDPAAATPTIVMLHGGGQNRHSWHKTG
QILADRGYHVVALDTRGHGDSDRAPDADYAIETLTADALAVIDAIGRPVV
LIGASMGGLTGILVAEQAGPQRVVKLVLVDVVPRYEKDGSARIRDFMLSH
VDGFDSLEQAADAVAEYLPHRTKPRSPEGLKKNLRFRDGRWYWHWDPAMM
TKPGDDPALRTAKMESAAIALRIPILLIRGKLSDVVSAEGVADFLAKVPG
ARFVELSGAGHTAAGDDNDAFSAAVVEFVSG
333989711YP_004522325.1 hypothetical protein JDM601_1072 [Mycobacterium sp. JDM601]MRSIWKWIGLAGVVGVAAGGVLVARDQRRRRAYTPDEVRARLHERLAEAA
GEN
333989709YP_004522323.1 hypothetical protein JDM601_1070 [Mycobacterium sp. JDM601]MIFIVVKFQTKPEWAQRWPQLVAQFTEATRAEAGNLWFEWSRSLDNPNEY
VLVEAFRDGDAGSAHVNSEHFKKAMAEMPQALVSTPKIISQQLDATDWSL
MGELTVD
333989707YP_004522321.1 hydrogen peroxide-inducible genes activator OxyR [Mycobacterium sp.MEVRQLQHFVAVAESGHFTHAAEALNISQSGLSASIQALEKSLSTPVFER
TTRSVVLTAAGRALLGPARRILAEVTAAEIALAAIRDAETGRLALGVVQT
FTAVDLPATIARLHAGHPGIQVLLREAPTSDLLGAVDNGDLDLAFVALDA
TPLPTGLAGLRDYPETLVLVVGAGHVLSGRTTVRITDLAEESFVEFAAGL
GLQTVVAALFRDAGVRRRIAFRTSQMDQALSLVEHGLGVAVVPAPVARRS
GLHSVGLRPISGAAPPTRRLALVGRTAVPTNPAARAFLNLLPAA
333989705YP_004522319.1 hypothetical protein JDM601_1065 [Mycobacterium sp. JDM601]MAGHQDADADGDNGGRPAASDNREVAVARREDELSRRERVADERDRIADE
REQIADSREQAADDREARADEREGATAQRERERLQRVEERDERSQAAADR
QNAEIRRAMAESRRQLDG
333989703YP_004522317.1 hypothetical protein JDM601_1064 [Mycobacterium sp. JDM601]MTVVELVYLVAALLWIFVVVAALCIGGHYLLKLRARQRRMTGLIGGVWLS
VERAVGPYLALAAGSAALLQKLVGGLGADERGRTN
333989701YP_004522315.1 hypothetical protein JDM601_1061 [Mycobacterium sp. JDM601]MAAQRQTSAVAADHRSILPNAAGFPWWGAVAVAVVATAVGVAFDAGSGDK
ELSIVFSALYAMGCIAAVLTVRQSAVFTAVVQPPLILFCTVPAAYWLFRG
GGFPGVKAILINCGYPLIERFPLMLFTAAVVLLLGMVRWYLGMLSGATTP
ASDDGAPPRRPPLVEKLSALLNAALSRDPAHAIEPSAARSPRERRPGDRP
RRATPEARRAARKTAAGRPAARSGERRRGANGAVPSRSRHVRPPMDDVPA
TERPRRRRPAPDESLPRRRPAPDWQDAPPRRRPEPRSRADRDPRARGYRP
TEAPESLPRRRQPPPTGRDNGADSTHHPVSRVRYRTGGGDDSGREPRTRS
RQPRTGEFDSWEYDI
333989699YP_004522313.1 hypothetical protein JDM601_1059 [Mycobacterium sp. JDM601]MAMATAPFGVRLLVGAATVAVEETMKLPQTILTYPMTLASQAAHAVMRWQ
QNIAELVNKGDSTLESLFPPKDEQPEWATFDEDTDDGVNGAEFGDTAVFD
GFDDADSGPRTEGRFALYSFSEGGDDRPASRGETDVTPAGSKADAAVPTP
DLVDELDYGNLTLAQLRARLASLSVDELETLLGYEEATKARAPFQTLLAN
RITRTTTK
333989697YP_004522311.1 exodeoxyribonuclease [Mycobacterium sp. JDM601]MVQRLEQGGLDLDASLSLWERGEQLAKRCEEHLAGARRRVQDALAAENGE
DEGT
333989695YP_004522309.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium sp. JDM601]MNTVLVTGAFGLVGSAVVRRLAADGRGVVATDLDVPANREAAAKLPKSVE
VRYADLTDPAAVDDLVSAVQPAAIIHLAAVIPPLIYLRRELARKVNVEAT
GHLLAAAAGQPQPPRFVQASSIAVYGSRNPHTVSGVLTADTPTNPADSYG
DHKVQAERLVRDSQLDWVILRLGGVLTADPGPYAKLDNLYFEQLLPADGR
LQTVDVRDVAAAFVAATTAPVIGETLLIGGDDTHRRLQRDVAPAMAAAMG
LVNGLPAGLPGDPDSDDDWFSTDWMDSSRAQDVLGFQHHSWPQMLAETAA
QAGPARYLLRVVAPLARLVLGWRAPYYRSGKKFADPWGAITAKWGDPRP
333989693YP_004522307.1 hypothetical protein JDM601_1054 [Mycobacterium sp. JDM601]MTAPEADLTGWTPTPFTGGGFTHDVYRKGQGPGVVLIPEIPGIHPAVLGL
GNHLVDNGFTVAIPSLFGTPGKAITPGYAASTLARVCVTREFTAFATNAQ
RPVTAFLRALARDLNEQTPGKGVGVIGQCFTGGFALAAAVDDAVLAPVLS
QPSVPLSLTPKQRRDAGLSEVELGVVADRAANEGLCAIGLRFSEDWMAPR
ERFGTLKARLGEAFEVIEIDSSPGNPHGISRLAHSVLTDQVREVEGHPTY
AARKRVVEFLTERLAP
333989691YP_004522305.1 fructose 16-bisphosphatase GlpX [Mycobacterium sp. JDM601]MELVRVTEAGAMAAGRWVGRGDKEGGDGAAVDAMRELVNSVSMRGVVVIG
EGEKDHAPMLYNGEEVGNGDGPDCDFAVDPIDGTTLMSKGMPNAISVLAV
AERGAMFDPSAVFYMNKIAVGPEAADVLDITKPIADNIKAVAKVKGLSPR
DMTVCILDRPRHAQLIHDVRAAGARIRLITDGDVAGAIAACRPESGTDML
AGIGGTPEGIIAAAAIRCMGGEIQAQLAPTDDAERQKALDAGYDLDEVLT
TEHLVSGENVFFCATGVTEGDLLKGVRYYPGGCTTQSIVMRSKSGTVRMI
EAYHRLSKLNEYSAVDFTGDAHAAYPLP
333989689YP_004522303.1 integral membrane transport protein [Mycobacterium sp. JDM601]MTRRLIPFLALLYFINYLDRVNIGFAGPNGMNDELGMTATMFGFASGIFF
LGYLLLEVPSNIALHRFGGRRWLARIMLTWGIVSTAIAFVPNTTTLVVLR
FLLGVAEAGFFPGIILYLTFWFPAKQRSRAISLFMVAVPVSTAIGSTLSS
LVIDWGQGVFGLTGWRFMFLVEGLPAIVIAFVCWFYLTDRPADAHWLSND
EKQWLETTLANERAAAEAGEHWGLKKALSHPRMLALAFVYFGIVYGLYAV
GFFLPSIVAGFEQQYGSQLSLIGRGIVTAIPWTVAAVVMVPWARHADRTG
ERIWHVAIPAIVGGVSIPAALYLANPYLAMLTITVSTCSIMCAMPVFWAL
PSTFLTGTAAAGGIALINSLGNLSGFGGPYVTGWLTDLTGDPKVALWVIG
AMSLAAAAMVVALGCAPTRPAAPETSSRKR
333989687YP_004522301.1 hypothetical protein JDM601_1047 [Mycobacterium sp. JDM601]MTAVAGKVASIDRATCVRPNVMAEFRRHSGSVLTGLFGAAAFDEVALVPV
AAAVDKTGRFERNFTDRAIRSGFSALLAIWGDAEDRAAEGERLKRMHRDV
HGHGKGDFAGVRYSALSPRLWNWIAVSGMFVTLNSFTPVTGIEWNDAERE
AAYLQLLEAFRAIELPGKAAKFPASYAEAAAYYDEMVRTDLQANPFLDRV
TAGLGRLPLPSALPAPVRAAAGPLWSVLSAGAGRVVKICSFGIMHPGVRE
LTGFGWQPRHDAEFALYTHLAQLAWRVLPDRLVLVPLAYNRLQYEKLVKL
HRSVALDSFAPSGCPMG
333989685YP_004522299.1 hydrolase [Mycobacterium sp. JDM601]MTTDNKVKPATAATKAANVGVSNALPFNDRGDFEDAQRNLIARPETLTIK
DADGRVVWELESYQKFIGDDKPAPDTVNPSLWRNAQLCMNYGLFKVVDRV
YQVRGYDLSNITFIQGDTGWIVFDTLISPETARAALDLANQHLGERPIVA
VVHSHSHTDHYGGVRGIISQGDVDTGKVKVIAPANFVEDVVDENVIAGNA
MSRRAVYMYGALLPRDAQGGVNAGLGQTISTGKPTLVIPTDIISTTGTKL
TVDGVEMVFQMTPGTEAPTEMNTFFPQFKAMWMAENTTNTMHNLLTLRGA
QVRNPLIWAAFIDETIRLFGAQTEVKFQSHHWPMWGNAKIIDYFKRQRDL
YKYTHDQSVRLMNHGYIGSEIAEEIALPPELNEFWPNRGYYGTLRHNSRA
VYQRYMGWYDSNPSDLNDLPPADAAAKYLEYMGGEDAVLRKAKGDFDAGN
YRWAAMVLKHVVFANPDSVDGKNLLADCYEQLGYQAESGPWRSEYLQGAA
ELRNGVPDIAATDTASPDTIRAMPPEKLFDYLAVRLNGPKAAGKKITLNM
KFTDLKSEYGLTVENAVLNYAAEPVPGADANLTLTKTTLDDIELKNLTLD
EAIATNRITIDGNRGAFDEFMGLLDTFPFWFNIVTP
333989683YP_004522297.1 hypothetical protein JDM601_1043 [Mycobacterium sp. JDM601]MAVQRATETRTRGGSRSHGTLIAVVVGSLALVSPSPALAGQTTSPPVMLT
SAGSTSAIDVSNVIAEIQNQLIGVNGALPFMTPERIAELPSYIRDISYFQ
LLGTLAQMNPTDPTVRFPYITTEVGGNPIQIEGQANPDNIFNFVFTQPDG
TYVIHFAPGSGTVDFNITSQYDFSPSNVNSPPGDGLQLADLTPNADGSYT
ITVSPTPHEGNWIDSDGATGIWIRDTVHDWTTSPGVVTIDRTDVAATDPV
YTPLSDSDVAALLGRIADELPEHNLNSQVFYTPPPNLPTPDNGVIPFIPT
NINGGLPGQFMSFGNFNLEPGQALILRAPEIDATYYNIQLSDPVGRLLPF
QYAQTSLNDIQSFQASDGNTYYVISATNPGVPNWLDTGGLSSGGIFLRIQ
GPEGPIPTGPLQAELVPVADIRDYLPADTPVVTPEQFAAQLELRAFSLEN
LLSLSKDSSWITTTLQIDDIKAAIGSGTFDQLFGTQDSYVSLADRFTDVF
DPSTAVQNIINNPLGSMSAVVQSLPQAFKELEYPLILAMARGARALADTL
QSMDGGMSSGNGFDLFSALTQSFTDPNGLASVFAQTLFDPGTSITAGLLN
ARDAIQFALVTGVHDTPGLWQLATEAQESLAQITAMFSHDFAMGMDLVDQ
LLGF
333989681YP_004522295.1 PhoH-like protein PhoH2 [Mycobacterium sp. JDM601]MLDTSVLLSDPWACTRFAEHEVVVPLVVISELEAKRHHHELGWFARQALR
LFDDMRLEHGRLDQPIPVGTQGGTLHVELNHSDPAVLPSGFRTEDNDSRI
LTCAANLAAEGRRVTLVSKDIPLRVKAAAVGLAADEYHAQDVIVSGWTGM
DEVEASVDDIDALFDEGEIDLAAARDLPCHTGVRLLGGSSHALGRVNAAK
RVQLVRGDREAFGLRGRSAEQRVALDLLLDESVGIVSLGGKAGTGKSALA
LCAGLEAVLERRTQRKVVVFRPLYAVGGQELGYLPGSENEKMGPWAQAVF
DTLEGLASPAVLEEVLSRGMLEVLPLTHIRGRSLHDSFVIVDEAQSLERN
VLLTVLSRLGTGSRVVLTHDVAQRDNLRVGRHDGIAAVIEKLKGHPLFAH
ITLLRSERSPIAALVTEMLEEISGPELR
333989679YP_004522293.1 serine hydroxymethyltransferase 1 GlyA1 [Mycobacterium sp. JDM601]MSTPLAELDPDIAELLGKELGRQRDTLEMIASENFVPRAVLQAHGSVLTN
KYAEGLPGRRYYGGCEHVDVVENIARDRAKELFDAEFANVQPHSGAQANA
AVLQALMEPGERLLGLDLANGGHLTHGMRLNFSGKLYENAFYGVDPVTHR
VDMDVVRAQALEFKPKVIIAGWSAYPRILDFEAFAAIAAEVDATLWVDMA
HFAGLVAAGLHPSPVPHAQVVSTTVHKTLGGPRSGLIVGKKEFAKQINSA
VFPGQQGGPLMHVIAAKAVALKIAGTPEFAERQQRVLSGARIIAERLLAA
DVAKAGVSVVSGGTDVHLVLVDLRDSPLDGQMAEDLLHEVGITVNRNAVP
NDPRPPMVTSGLRVGTPALAARGFGDTEFTEVADIIATALAAGSGADISA
LRSRVTKLAQDFPLYDGLEDWKLA
333989677YP_004522291.1 pantothenate kinase CoaA [Mycobacterium sp. JDM601]MSTPMPLTEEEVVALRGLGEQVDLLEVEEVYLPLARLLHLQVAARQQLFA
ATAEFLGENDQSPDRPVPFIIGVAGSVAVGKSTTARVLQALLARWDRHPR
VDLVTTDGFLYPNQELERRNLMHRKGFPESYNRRALMRFVTSVKSGADYA
CAPVYSHLSYDIVAGAKQVVRHPDILILEGLNVLQTGPTLMVSDLFDFSL
YVDARVEDIEHWYVSRFLAMRSTSFADPESHFHHYAGLNDAQAVAAARDI
WRSINRPNLVENILPTRPRATLVLRKDADHSINRLRLRKL
333989675YP_004522289.1 hypothetical protein JDM601_1035 [Mycobacterium sp. JDM601]MTAVTTPVLSDSTDSLLRFALRADAVTTGVIGLAGVFTARPMAALTGLTA
VQEYAVAAFCLLYGVAVYFLSALPDLRRAGIGVLAANVVCTVAAIAVLET
GVLPLTGFGVAALLASAVYTASFALAQYRGLRRLR
333989673YP_004522287.1 short (C15) chain Z-isoprenyl diphosphate synthase UppS [MycobacterMAIIPARLKEPLYRIYELRLRQGLAASRSALPRHIAVLCDGNRRWARDAG
YEDVSYGYRMGAAKIAEMLRWCADAGIEMATVYLLSTENLQRDPAELAAL
IEIITDVVEEICAPANRWSVRTVGDLELLGEEPARRLREAVDSTREKNGG
FHVNVAVGYGGRQEIVDAVRGLLGKELANGATAEELVDAVTVEGISENLY
TSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAHWPAFRRVDFLRA
LRDYSVRHRRFGR
333989671YP_004522285.1 hypothetical protein JDM601_1031 [Mycobacterium sp. JDM601]MTSAPERAQAITETVHRYIELVGGGTADDLVALYASDATLEDPVGGEVHI
GHQAIRNFYSAITGLQRESELVTLRVAGNEAAFHFALTITNGDHRMRIEP
IDVMVFDGDGKIAGMKAYWSAENITQL
333989669YP_004522283.1 hypothetical protein JDM601_1029 [Mycobacterium sp. JDM601]MNHALLTTLWLLADDVPRETGPDFGKASPFGLLVVVLLLLGTFGLVWSMN
RHLKRVPESFDREDPAADQAADEGTLDPGPDSAG
333989667YP_004522281.1 hypothetical protein JDM601_1027 [Mycobacterium sp. JDM601]MTDSKPARYGDTRGRALPRRLLAIMLGALAVATAAAVAVLGFQRLTTADV
KGELYGYEVVDDQTVTVKISVTRSDPSRPAVCIVRVRAGDGSETGRREVL
IPPSESSTVQVTTIVKSSQPPLMGDIYGCGPDVPDYLRSP
333989665YP_004522279.1 cystathionine gamma-synthase [Mycobacterium sp. JDM601]MHGPIGPSTTAIHAGFRPDPATGAVNPPIYASSTFAQDGVGGLRGGYEYA
RTSNPTRTALETALAAVEQGRYGRAFSSGMAATDCALRAMLRPGDHLIIP
DDAYGGTFRLIDKVFTGWGLAYTPVALSDLDAVRAALTDKTRLILVETPT
NPLLSISDIESIAAIGRESGAKVLVDNTFASPALQQPLTLGADVVLHSTT
KYIGGHSDVVGGALVTDDEELDAAFAFLQNGAGAVPGPFDAYLTLRGLKT
LVLRMQRHSENAAAVAEFLAGHAAVDTVLYPGLPGHPGHDIAARQMRGFG
GMVSVRLHGGRGAAEKLCAATEIFILAESLGGVESLIEHPGAMTHASTAG
SQLEVPDDLVRLSVGIEDIDDLLEDLKQALR
333989663YP_004522277.1 cystathionine beta-synthase [Mycobacterium sp. JDM601]MRIARHISDLIGNTPLVELNSIVPDGAGRVVAKIEYLNPGASSKDRIAVK
MIDAAEASGALKPGGTIVEPTSGNTGVGLALVAQRRGYKCVFVCPDKVSE
DKQNVMRAYGAEVVVCPTAVPPDDPASYYSVSNRLVEEIDGAWKPDQYSN
QAGPESHYETTGPEIWSDTDGQVTHFVAGIGTGGTITGTGRYLKEVSGGR
VRVIGADPEGSVYSGGTGRPYLVEGVGEDFWPAAYDPKVPDEIIAVSDAD
SFDMTRRLAREEALLVGGSCGMAVVAAVEAAVKAGPDALVVVLLPDGGRG
YMSKIFNDAWMSSYGFLRSRLDGSTVEPTVADVLRVKSGVLPDLVHTHPA
ETLRDAIGILREYGVSQMPVVGAEPPVMAGEVAGSVSERDLLSAVFEGRA
KLADAVSQHMGPPLPLIGSGEVVGVAATTLADVDAVMVVEDGKPVGVITR
HDLLGFLSDGPRRR
333989661YP_004522275.1 hypothetical protein JDM601_1021 [Mycobacterium sp. JDM601]MGIRVARRSAVTLATAGALASSGTLYLGLRNLLAGQADVARQTIPRACDV
PPRADGIYVAGELPGDVAVQRFQRGMSVDLHLMIFGDSTGTGYGCCSPEE
VPGALIARALAEQTGKRVRLSTKALVGATSKGLAGQVDAMFVAGPPPDAA
VIMIGANDVTALNGIAGSAQRLHAAVKRLHRSGAVVVVGTCPDFGAVSAI
PQPLRLVAQVRARQLARAQTRAVKAAGGIPVPFADFSAPAFRDTPGLLFA
QDQYHPSAAGYALAASQLIPPLCAAMAQADLRATVPSD
333989659YP_004522273.1 hypothetical protein JDM601_1019 [Mycobacterium sp. JDM601]MLTVEYDGDQHRTSWPQFVKDAERIEYIQQVGWTHVKVLAEHRDHDVIRR
VQRAWDALILR
333989657YP_004522271.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MTSESDEVLARVENGIGLLTLNRPQAINSLNLPMVTAMTAALSTWADDPA
VAAVVLSGAGERGLCAGGDVVAIYHSAKADGAEARRFWHDEYLLNAQIGG
YGKPYVSLMDGIVMGGGVGVGAHANTRVVTDTTKMAMPEVGIGFIPDVGG
TYLLSRAPGHLGLHAALTGAPFSGADAIALGFADHYVPHAALGDFTATIL
AEGVTEALQRHAVEPPASALAAHRDWIDECYAHDTVAQIVTALAGHVSAD
ANAAAELIGTRSPIACSVTLESVRRAGELATLEDVLIQEFRVSSASLHSH
DLVEGIRAQLVDKDRNPQWSPATLAEVSSADVESYFAPAEPDLVF
333989655YP_004522269.1 hypothetical protein JDM601_1015 [Mycobacterium sp. JDM601]MSDTAVTVAEPVSPERPAKPWWVRRYTFTGTAFGVVFVWLSLTPSLLPRG
PLFQGLVSGASGAVGYGLGVFAVWLVRFMRSRDSSPSAPRWAWAVLVPVA
FAGIIGMNFWFHVWQDRVRDLMGVPHLGWLAYPWAALLSVMVLFALVELG
QLTRRLIRFLVRQLNRVAPPRISAVTAVTMLMVLVIALLNGVVVKVAMRT
LNHTFAAVNDEMGPDTAAPESPYRSGGPGSLASWESLGREGRVFVDDGPT
VDDLTAFNEKPAKEPIRVYAGLNSADGIAATADLAARELQRAGGLDRAVV
AVGTSTGTGWVTSPDPTSLEYMYNGNTAVVSMQYSFLPSWLSFLVDKENA
RQAGTMLFEAVDRLVRELPEARRPKLVVFGESLGSFGGEAPFMNLNNVLA
RTDGALFSGPTFQNTIWTDLTAGRDPGSPEWLPIYRDGRHVRFVARPDDL
QRPDAPWEKPRVTYLQHASDPIAWWNPRLLFKKPAWLSEPRGYDVLPEVR
WLPVVTFLQVSADLAVAINVPSGHGHHYTQDVADGWAAVLQPPGWTPEKT
DRLRQRLHSDESS
333989653YP_004522267.1 hypothetical protein JDM601_1013 [Mycobacterium sp. JDM601]MVIADPVALRRSAPRPRSLRLPDLLQTTDLAADAVLDGRYEHLLPTSGLP
TDSRWFTRIHGDERLDIWLISWAPGHATELHDHGDSLGALTVLSGSLDEF
HWDGTQLARRRLDAGDQASFSRGWVHDVVWAPSVAGPTLSVHAYSPPLVE
MSYYDVAPDNTLRRQRTELTEHPEAS
333989651YP_004522265.1 hypothetical protein JDM601_1011 [Mycobacterium sp. JDM601]MLAGGGVAGIAWETGVLCGIADESPATAAALLKSDVLVGTSAGSAVSGQI
GSGAGLDELFARQVAETSPELDPGVGVEGIAELFLAAMTEPNTTAAQKMQ
RIGAVALATETVPAAVRRRVIERRLPSHRWPQRCLRITAIDIDTGELMVF
DRESGVELVDAVAASCAVPGVWPPVVIGRRRYMDGGMRSAVNLDVAGDCD
VAVVLVPAGESAPSPFSAGAAAEVAAFDGRAYAVFADGTALRAFGSNPLD
PACRVPSARAGREQGRQHAAAIAEFLS
333989649YP_004522263.1 medium chain fatty-acid-CoA ligase FadD14 [Mycobacterium sp. JDM601MRSTMQDWPLTIGAILRHATGIHGDRTVTTMTGDGFHTTTYCELGRQVAR
LANALRRLGINGDERVATFMWNNTEHLAAYLAVPAMGAVLHTLNIRLFAE
QIVFVANEAEDRVILVDISLVPQLAPVLAQLDTVRTVIVVGDGDTSALKA
LGSAGKTVLRYADVLAAESDEFDWPVIDENSAAAMCYTSGTTGNPKGVVY
SHRSSYLHTMAACTANGVGIGTDDSVLPIVPMFHANAWGLPYAALMAGAD
LALPDRHLDAPSLVALIEKLRPTVAGAVPTIWNDVLHYLDREPGHDISSL
RQVVCGGSAVPVSLMRAFEDQHAVQVRQLWGMTETSPLATLAWPPPGTDE
DRHWALRGTQGRPICGVEARTVDDDGRPLPNDGVAVGELEVRGPWITGSY
YRGQDESKFASGWLRTGDVGRIDAQGFITLTDRAKDVIKSGGEWISSVEL
ENELIAHPDVIEAAVVGVPDERWQERPLAVVVARSGAAVSPAELRKFLSD
KVARWWLPERWTFTDTIPRTSVGKYDKKTIRARYSNNEYQVSEVRD
333989647YP_004522261.1 ArsR family transcriptional regulator [Mycobacterium sp. JDM601]MAGESGSAPPPLVDDLALCCAPITGAVLDVAAAERLAAVLKALAEPTRLR
LVSLIAGHDGAEACVCDLTAPVGLTQPTVSHHLKTLVDAGLLERSQRGKW
AYYRIVPAALTALAGVFAPGAST
333989645YP_004522259.1 hypothetical protein JDM601_1005 [Mycobacterium sp. JDM601]MSFSDLQLRGKATVEAWLHKSANRYLVVRRRDAEDLVLTTASRAAQARET
SSVTSRLLVALMQQDPVRDVVDDVIPQVFPWVSFLSSDEAREFVIELTST
MKAAESIDNPAPVAQLIDAWRHTAEVLADPELVSVLAAPSDGDFGSVPLP
GTDR
333989643YP_004522257.1 PE-PGRS family protein [Mycobacterium sp. JDM601]MSFVTTQPEALAAAAGNLQAIGSALNAQNAAASAPTTGVVPAAADEVSAL
TAAQFATHATLYQSVAAQAAAIHEMFVATLNGSAESYAATEAANAIAAG
333989641YP_004522255.1 PPE family protein PPE31 [Mycobacterium sp. JDM601]MIDYATLPPEVNSARLYAGPGSTPMMAVASAWRGLAAEISSALTSYETTL
TQLVDEAWMGPASVSMTAATKPYLAWLTDTLAKAEDTASRATAAAAAFEA
AHGATPPPAVIAANRAQQKQLVATNVVGQNSAAIMASDAQYLEMWAQAAN
VMYSYAASSATATQVTPFSEPNQTTNPDGTANQAAAVGQANATAAGNTAQ
NAQTAQLISSLPNALQTLTSPAPTDLPPPTLAGLVEAFFRNASINGVVSL
LTYPLNGGMSFVGTSAAFTPASLIPTMTTFFSGSGFNALGGGSAGAGIGA
LLAPGGPLSSLGALGGGTAGAASAAAGAFTASATTPAISAGVGQATLVGE
LSAPPAWAAAAPAGTAATGDALQASSWSAAPEEIESMAAMPGGMPLGADR
SGFGLGTPRYGFKPTVMARPVVAG
333989639YP_004522253.1 EsaT-6 like protein EsxN [Mycobacterium sp. JDM601]MSINYQFGDVNAHGALIRAQAASLEAEHQAIVHDVLAAGDFWGGAGSVAC
QEFVAQLGRNFAVIYEQANAHGQKVQTAGNNMANTDASVGSSWA
333989637YP_004522251.1 PPE family protein PPE51 [Mycobacterium sp. JDM601]MIEFGALPPEVNSGWMYAGPGAAPMMAAAAAWHGLAGELGTTATAYQAVV
TRMAGELWRGSASASMAAAAAPYVAWLNTTAAQAEQAATQATAAAAAYET
AFAMTVPPPVIVANRSLLMALVATNFLGQNTPAIAATEAHYAEMWAQDAT
AMYGYAGSSAAAAQVTPFTDPSPTTNPAGQAALTQLISTLPSTLQNLASP
LQPTSVTGISGNLLDPANLGSMASSGGSNLVGVLSNLLGIAGNVGGGPTP
ALAGFPGLPGPVLAGAPGIGGPAGLGGIGAGVSAGVGRAASVGMLSVPPA
WAATSPAGNTAPPLSGAPLTTATERGLGAMPAGMPIGSLGARATSATAAP
NYGFRPTVTMHPVAAG
333989635YP_004522249.1 PPE family protein PPE15 [Mycobacterium sp. JDM601]MDFGALPPEINSGRMYAGAGAAPMMAAAAAWNSLGAELSTTAASYQSAIA
ALTGEEWQGPASASMAAAMTPYINWLNTTAAAAEHAAAQAIASAAAFEAA
FAMMVPPPVIAANRAQLAALVASNFLGLNTAAIAATEAQYAEMWAQDAIA
MYGYAASSASAGTLQPLSSPTSVSNPLGTAGQSAAVAQASAGNTQSGLSQ
LVSGLPNTVQNLSSPLSAAAAPAQAGDFLSDFIGSTQNIGIWNAIQTYST
YGVTAGSWHLFAGISSAIAIASPGVGAAGSTILADSLDSPAGAPGPGAAA
AGSAPVLAGVAQAAPVGGLSVPSTWPGALPGGAGAAPLITSEWIPGAVEE
GQSMTAVPAGVGAAGAAAARGGRGFSDPHYGFKPMVMARPVAAG
333989633YP_004522247.1 transcriptional regulator [Mycobacterium sp. JDM601]MSTRVLVVDDEPQILRALKINLSVRGYEVVTAATGAGALRAAAEHRPDVV
ILDLGLPDISGIEVLAGLRGWLTVPVIVLSARTDSADKVEALDAGADDYV
TKPFGMDEFLARLRAAARRNATAAEIDQPIVETSSFTVDLAAKKVTKNGG
EVHLTPTEWGMLEMLVRNRGKLVGRDELLTQVWGPAYAKETQYLRVYLAQ
LRRKLEDDPSNPKHLLTEAGMGYRFEV
333989631YP_004522245.1 hypothetical protein JDM601_0991 [Mycobacterium sp. JDM601]MTRTGRIAGIDCGTNSIRLLIAEPVDGRLRDVHREMRIVRLGQGVDATGR
FAAEALERTGAALADYAELLVTHGVSRVRMVATSATRDAANRDEFFTMTA
QVLGVAVPGAVAEVITGQQEAELSFSGAVGELDGADGPFVVVDLGGGSTE
VVLGDPERGVSAAYSADIGCVRLTERCLHSDPPTAEEVAAARGVARELLS
EALQVVPVQHARTWVGVAGTMTTLSALAHGLTEYDPGVIHLSRVGFGDLV
AVCDRLLGMSREQRAALGPMHPGRVDVIGGGAIVVQELARTLSERAGIDE
LVVSEHDILDGIALSIA
333989629YP_004522243.1 hypothetical protein JDM601_0989 [Mycobacterium sp. JDM601]MSDPKRPEKRRAATSRPGRAGETGRARPSRPPAVRRGPAGSRSAPEPPAQ
PVKRAVTAAADQRSELRVGFTARRAVILAAVMCVLTLTLAGPVRTFFAQH
AEMKQQSQLEAMLHSQIADLQQQKTNMDDPAHIRAQARERLGFVMPGEIP
YQVQLPATAEVPGEPGAEPDMIGLSGEPWYTSLWHTIADVPHPPPAPAAP
PLGPPGLPGPPVPVVPGG
333989627YP_004522241.1 hypothetical protein JDM601_0987 [Mycobacterium sp. JDM601]MSARRWLRTTAVVGATAVLLASSCSWQLGNPIPQGVPPPPGDPVPPVNTQ
LVAGRPADQLYHWAAERAAVLDIPVTALEAYAYAARVAEVENPNCHLSWT
TLAAIGQIESHHGRYNHATVARNGDVRPKIRGVRLDGSGGTLHIVESLQP
DLADDDGVVRAMGPMQFIPETWRLYGVDANNDGIISPDNIDDAALSAAGY
LCWRGKDLATAKGWMTALLAYNDSEIYARAVRDWAAAYAAGRPL
333989625YP_004522239.1 PPE family protein [Mycobacterium sp. JDM601]MTAPVWLASPPEVHSALLSAGPGPGPLLEAASAWSLMSAEYAEVAAELDA
VLAGVQSAAWQGPSAQQYATAHVPYLSWLTDSAAKSAAAAALHQTAATAY
TVALAGMPTLAELAANHAVHATLVATNFFGVNTIPIALNEADYVRMWIQA
AEMMTVYQGVAGSALASVPVATPAPAVVDPAGQAVADVSWEQQIADLLRE
INMGFSDPVAKWLWSLLGVDGYPIEAFPFASAVGEMLLQIPGMSPILASS
LGWTVFHTLMLLWPMGQIAVQMAIPIMMAAAPGLLAAAAGLGALGAIGAA
GGADQVVEPAPLAPVAGGAGAAVAVGATVPAGAQVPATTGTISSAGPAAS
AAGGMPAGGAAGGGPGVGFGPTSSMYLVSSASASARQSTGARRSRSAEEA
ASESQAAPAAAAALREAQQRRRRRRTRQHGFGDEYMDMNIGVTPDWDQPG
ASASGAGALGFTGTATDVQRRAAGITVLEGDTFDTEPRMPMLPGGWAENR
S
333989623YP_004522237.1 transcription-repair coupling factor Mfd [Mycobacterium sp. JDM601]MTAPGHASPATPIAGLVEAALSAPTFVDLIERADSRPAELNLVGPAATRP
FAAAAVARNTPLLVVTATGHEADDLAAELRGVYGDTVALFPSWETLPHER
LSPGVDTVGARMLLLRRLARPDDAHLGPPLRVVVTTARSLLQPMTPHLDA
IEPVTLTVGEETPFEAVIARLVELAYTRVDLVGRRGEFAVRGGILDVFPP
TAEHPVRIEFWGDEITEMRPFSVADQRSIPEIDAGTVVAVACRELLLTDD
VRARAAQLAGDHPRTDNTVTGGVGDMLAKLAEGIPVDGMEALGSVLRPGP
QALLTDQLAAGTPVLICDPEKVRARAGDLIKTGREFLEASWSVAAIGGDA
PIDVEQLGGSGFRDLAEVRKAALDAGHPWWTLSQLPDPEAIELEVRPSPS
ARGRQRDIEAIFAMLRAHTATGGAAAIVTPGVGTARRLVEQLAESETAAT
LLEPGAAPQPGVVGVLQGPLHDGVVIGGANLVIVTETDLTGNRVAGPEGK
RLAAKRRNAVDPLALTAGDLVVHDQHGIGKFVEMTERTVGGARREYLVLE
YASGKRGANGTDKLYVPMDSLDQLSRYVGGQAPGLSKLGGSDWSQTKTKA
RKAVREIADELVALYAKRQAAPGHAFAPDTPWQAEMEDAFGFTETVDQLT
AIGEVKADMEKPVPMDRVICGDVGYGKTEIAVRAAFKAVQDGRQVAVLVP
TTLLADQHLQTFTTRMAGFPVTVKGLSRFTDPKESKAVIDGLADGSVDVV
IGTHRLLQTGVAWKNLGLVIVDEEQRFGVEHKEHIKALRTHVDVLTMSAT
PIPRTLEMSLAGIREMSTILTPPEDRYPVLTYVGPHDDKQVAAALRRELL
RDGQIFYVHNRVSSIDAAAARVRALVPEARVVVAHGQMPEELLETTVQGF
WNREYDILVCTTIIETGLDISNANTLIVERADTFGLSQLHQLRGRVGRSR
ERGYAYFLYPRDTPLTETAHDRLATIAQNNELGAGMAVAMKDLEIRGAGN
VLGVEQSGHVAGVGFDLYVRLVGEAVEAYRAAYRGDLVTTEEPKDVRIDL
PVDAHLPPEYINSDRLRLEAYRRLAAAPDDAAISAVVEELTDRYGPLPEP
AGRLVAVARLRLLCRSVGITEVSVASATTLKLAPMTLPDSAQLRLKRLHP
SASYRATTATVQVPIPRAGGAGAPVGAPRIRDVELVQMVADLISALDGKP
AGRLDMAGAAPATRDHATAAGRR
333989621YP_004522235.1 UDP-N-acetylglucosamine pyrophosphorylase GlmU [Mycobacterium sp. JMSTHKHAPSPQGADRQDAVIVLAAGAGTRMVSDTPKVLHTLGGRSMLSHC
LRAAAGVSPRHLVVVLGHAHERIAGPVAELAQALDCRIDIARQDQQLGTG
HAVLCGLSALPDDFAGTVVVTSGDIPLLDTATLRALVDTHRAASAAVTVL
TTTMADPTGYGRILHTQDGEITAIVEQADATESQREIREVNAGVYAFDIT
ALRSALGRLGSDNAQHELYLTDVIGIVRGDGQAVHARHVDDAALVAGVND
RVQLAELAAELNRRLIAAHQRAGVTVVDPATTWIDVDVTIGRDTTVAPGT
QLLGTTVIGAHCEIGPDTTLADVTVGEGASVIRSHAASSWIGAGATVGPF
SYLRPGTALGADAKLGAFVETKNSTIGTGTKVPHLTYVGDADIGEHSNIG
ASSVFVNYDGQNKRRTTIGSHVRTGSDTMFVAPVNIGDGAYTGAGTVVRD
DVPPGALAVSAGPQRNIENWVQHKRPGSAAARAAEKAVAADPDEAS
333989619YP_004522233.1 arsenate reductase [Mycobacterium sp. JDM601]MTDGTIYHNPRCSTSRKTLELLRDNGIEPTIVEYLKTPPARAELADMIRD
AGIGVRDAVRTGESVYAELGLADASDDELLDAMVANPILIQRPFVVTGNG
TRLARPIDAVREIL
333989617YP_004522231.1 hypothetical protein JDM601_0977 [Mycobacterium sp. JDM601]MGLGAAIAVGMLTPAAAMADPPPGCTAADLANVTAGVAASTSGYLFAHPD
VNAFYSGLRDRPDDEVPEAIRGYFADNPQAHTDLLGIRRPLVDFRSRCEL
PEADHGLLGR
333989615YP_004522229.1 dehydrogenase/reductase [Mycobacterium sp. JDM601]MTSRASWTAADLPSFAGRTVIITGANSGLGAVTARELARVGASVTLAVRD
TAKGQAAAASMPGSQDRVTVRALDLADLASVRRFADETPAVDVLINNAGI
MAVPYSTTVDGFESQIGTNHLGHFALTNLLLPKLTDRVVTVSSFMHRMGY
VSLKDLNWESRRYRAWLAYGQSKLANLLFTSELQRRLVAAGSPLLALAAH
PGYSSTNLQGHTGNRVGDALMRTIGNGLLATSPDFGARQTLYAASEDLSG
NTFVGPRFAFIGRTGSVGRSLLAKRGSTAAGLWELSEQLTGVQFPL
333989613YP_004522227.1 hypothetical protein JDM601_0973 [Mycobacterium sp. JDM601]MVYSWSAQSPEANHTVLVSGPGSASTIAHAQALNAQAAQLQVLASSSKAN
AAGTYGSAWSGAGATSSQASLAGINTELLALAQWLQARAPMVTSAAQAYH
RAVSAMVPTQQARANRVQEAADVEANPRVLGALTPRITELNLDYFGQMWP
TNASAGSGYGAALNTATAALAAPPPPANAAISPEAPVRAAAAVSEAVGRT
AAGAAMRGPTGRCRRLRR
333989611YP_004522225.1 peptidyl-tRNA hydrolase Pth [Mycobacterium sp. JDM601]MAESPPVLVVGLGNPGPTYARTRHNVGFMVVDLLAERIGSGFKLHKKSGA
DVATGRLSGRAVVLARPRCYMNESGRQVWPLAKFYSVPPAGVVVIHDDLD
LDFGRIRLKQGGGEGGHNGLRSIATVLGSKDFQRVRWGIGRPPGRQDPAA
FVLQAFGSREREEVPTICEQAADATELLIELGLEPAQNIVHAWG
333989609YP_004522223.1 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Mycobacterium spMTASDGSAATEWSPTGSVTVRAPGKLNLHLAVGDRRDDGYHELTTVFHAV
SLVDEVTVRDADLLSLRIAGEGADVLPTDERNLAWQAAELMAEHVGRAPD
VAITIDKSIPVAGGMAGGSADAAAVLVGMNVLWELGVPRRDLHAMAARLG
SDVPFALHGGTALGTGRGEELATVLTRETFHWVLVFADRGLSTPAVFAEL
DRLRDSGRALPEVGESEPVLAALAAGDPQRLAVLLGNDLQTAAVNLNPAL
RRTLRAGVEAGALSGIVTGSGPTCAFLCASAPSAADVAVELAAVGAGRAV
RVASGPVYGARVVPSSVTGV
333989607YP_004522221.1 hypothetical protein JDM601_0967 [Mycobacterium sp. JDM601]MIITLRQQNVIDFLLCDHVFLSFLGGARFQPPEGAPAP
333989605YP_004522219.1 resuscitation-promoting factor RpfB [Mycobacterium sp. JDM601]MTRLHQAPSPMLRMLVGALLLVLTFAGGFAVASAKTVTLDVDGTPVTVTT
MRSRVIDVVAENGFDLGERDDVTPARDARVHDADTIVVRRSRPLQLSLDG
RESTQVWTTALSVDEALAQLSMTDTAPAAASRGSRVPLAGMALPVLSAKN
VRIDDGGVVRTVRLAARNVAELLAADGTPLEQADKVSPPASTPITEGMEI
QVTRIRVTHVTERVPLPPTARRVEDPAMNISRQVVEDPGTPGTQDVTYSV
ATVNGAETGRLPVSNAVVDPARDSVLRVGAKPGTEVPPSVYGAAWDRIAA
CESHNNWAINTGNGFYGGVQFDYGTWIANGGLKYAPRADLATREEQIAIA
EVTQARQGWGAWPVCSGRR
333989603YP_004522217.1 methionyl-tRNA synthetase MetS [Mycobacterium sp. JDM601]MRQIEPFYVTTAITYPNGDPHIGHAYEYIATDAIARFHRLDGFDVRYLTG
TDEHGLKMAETAAAEGIPTAELARRNSDVFERLQERLNISFDRFIRTTDA
DHLTASKAIWQRMVDAGDIYLDTYSGWYSVRDERFFTEAETRLTDGGSRV
AAETGAPVTWTEEQTYFFRLSAYTDKLLAHYEANPGFIAPEVRRNEVVSF
VSGGLRDLSISRTSFDWGVPVPGHPDHVMYVWVDALTNYLTGVGYPDTDS
ESFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPRKVFAHGFLLNS
GEKMSKSVGNVIDPVEFVEKFGVDQVRYFLLREIPFGQDGSISEEALISR
INADLANELGNLAQRSLSMVAKNLAGVVPEPLAPTGDDEELLAQADGLLE
KVRVAFGAQAMHLGLEAIWLMLGAANRYFSAHEPWKLAKSESAADQARFG
TVLYTTLEVVRIAALLAQPVMPESAGKLLDLLGQEEGQRMFTAVGERLAP
GLTLPAPSGVFPRYQS
333989601YP_004522215.1 dehydrogenase [Mycobacterium sp. JDM601]MTRTRVVVVGGGYAGTLAANRLRQHPGVDITLVNPRPAFVERIRLHQYVA
GTGTATIDYPELLGDGVRLAVDAVTRIDAADRRIRLASGIALRYDYLIYA
VGSTGAITPTVSGAAEFAYSISELEHAQRLLARLGEVTADAPVIVVGGGL
TGIEAASELAGQGRTVTLVCGEMLGPSLHAAGRRSVAKALRKLGVEVREA
ATVAEVRPDAVVLADGSTLPSQVTVWTAGFGVPDLARASGLATDALGRLL
TDETLTSIDNPWIMAAGDAAAPSGQPLRMSCQAALPLGAQAANTVLARIA
GDSPMALDQSFAAQCISVGRNAGTVQLSRRDDTPTKAFIGGRLGAVVKES
ICKYTVKWIRGEAAKPGSYRWFKGGRAAGIAQRQADQEATV
333989599YP_004522213.1 para-aminobenzoate synthase component PabD [Mycobacterium sp. JDM60MRIERLGDLGTAPQVLRAVGDATGRCGLPPPAALTGEWFGARAVIAPSVA
VTPVSPGEVFDTGDVPAPGSRNGAVGGGWIGYRSYPDAGADDLGPRIPEA
AGGWTDCVLRQDDESQWWFESLSGTPMPGWLSEALTTPAPERRCRIFWET
PDRQAHRAGVLACLEAIRAGEVYQACVCTRFTGTVAGAPLDFFADAVART
GPARAAYLAGDWGAVASLSPELFLRRRGQGVASSPIKGTLPLDARPSALR
ASAKDVAENIMIVDLVRNDLGRVAITGTVTVPELLAVRPAPGVWHLVSTV
SARVPQELTMSELLDAAFPPASVTGTPKHRARQLLSEWEPSRRGAYCGTV
GLASPLAGCELNVAIRTVEFDAAGGAVLGVGGGITADSDPDAEWQECLHK
AAPIVAAGQSRERSTAS
333989597YP_004522211.1 hypothetical protein JDM601_0957 [Mycobacterium sp. JDM601]MISPGLLVPVAEFGPTDRARGWAVTAAVTTLAAVTRFSNLYTPTDAGTPI
FDEKHYAPQAWQMLHNHGVEDNPGYGLVVHPPVGKQLIAIGEAVFGYNGL
GWRFTSALLGVLAIALLVRIVRRMTRSTLAGGIAGLLLVGDGVSFVAART
ALLDGFLTFFVVAAFGALIVDRDQVRMRMHTVLTEGRCGATPWGPRLGVR
WWRFGAGVLLGLACATKWSGLYFVVFFGAMSCAFDVAARRQYRVRRPWLG
TLRRDVGPTGYAMVLIPFGVYLASYAAWFASETGVDRHEEGQSIGLESRF
PVPDALRSLWHYTYQAYHFHSGLTNAAGNHHPWESKPWAWPMSLRPVLYA
IDQHDVPGCGAQSCVKAVMLVGTPAMWWLAVPVLGYALWRTLVRHDWRYA
AALVGYCAGWLPWFADIDRQMYFFYAVPMAPFLAVLLALICSDIVTGGRL
RGEERRTLGLIAVCCYVALVLTNFAWLYPILTGVPISPATWNMQIWLPSW
S
333989595YP_004522209.1 hypothetical protein JDM601_0955 [Mycobacterium sp. JDM601]MLNLRAVLAVGCVGLLAACSSDPGEVTADIGKVVDLESSFGPEFQVKAIA
PTGLDPKLLAANTLPPGLKFEPADCSRFAVSQQLPQGVQGNMAAVAAEGN
GNRFITIALETSEPVPFNEPGKSCRRIGFAGERMRGLVETVEAPRIDGVQ
TIGVHRVVEAVAGGKSRVGELYNYSAYFGPYQVLVTANPLVAPDKPVIPV
DTARARELLVAAVAAVRG
333989593YP_004522207.1 glutamate dehydrogenase [Mycobacterium sp. JDM601]MSELNPRLHEIYDEVLRRNPGEAEFHQAVFEVLSSLGPVVAKHPDYVDSA
VIRRMCEPERQIIFRVPWLDDNGNVQINRGFRVEFNSALGPYKGGLRFHP
SVYLGIVKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGRSDNEIMRFCQS
FMTELFRHLGEYTDVPAGDIGVGGREIGYLFGQYKRITNRYESGVLTGKG
LTWGGSQVRTEATGYGAVFFADEILKTAKDSFEGKRAVVSGSGNVAIYAI
EKIHQLGGVVVACSDSSGYIVDEKGIDLELLKEVKEVKRDRIEAYATARG
GATQFVNSGGSIWDVPCQIAFPSATQNELDGNHAATLAKNGCKIIAEGAN
MPCTPDAVKLFTEAGVTLAPGKAANAGGVATSALEMQQNASRDSWSFEYT
EQRLAAIMQSIHHRCLVTADEYGAPGNYVVGANIAGFIQVADAMTALGLI
333989591YP_004522205.1 hypothetical protein JDM601_0952 [Mycobacterium sp. JDM601]MADTAPPGMSDYERRAWEALLEAAAGTERSGPLESLSRGITGRAKALAAE
ARSTVEQIPGATLAIGKVDDLTTKAMETLHAVVVERGLNSVKPADVFAMF
ADEGVAVASYEEVRELDLKHCDRSVPRRKDRYIALAMAGGAASSLAVTGA
AVSGPVTGGTTLTVAASAVIADVTAVMAGMGRIVALVAAHYGYDVRVPDE
QAFASGVIAYSAAGDSAEKAAALAALSRLTQQMMGGASRQRLQPQQADNV
IRQVSMALGFRLAKRKLAQAVPLLGAVVNGGLNARIAQQTFERAQQAYRL
RFLTEKHHLDAGRWAPVASDDAIDIPLIDEVLDAELASRSGDAAGDTD
333989589YP_004522203.1 hypothetical protein JDM601_0949 [Mycobacterium sp. JDM601]MNSTGIEGYREFLARRDGEADLLNRRLANRERFFHDLEANPIRSAQPADR
ATFLRNLRRRRPEPGLDRKMLFLLATAKLNQAERFGVGLGETYGRNSDES
LPPENVYLELEEHYHTRLLAYALDVFDLTFQVVPPPFVMRQFVKAGVFLP
ERLGFMFVGAAEMAGCVLFDELRRVGIELFADEPEVAARITLLYSEILTD
EIGHVGYCASRCTAAERAIMRRLYPVIARLFARQTAEISLLIDPQAFRAR
LGRRFDIAELTEGLDNETYLVTHP
333989587YP_004522201.1 transcriptional regulator [Mycobacterium sp. JDM601]MAAHDWLIGRDRRSEGAERIYAAAAELISRQGYDAFTIDALAAVVHCSPA
TIYRHAGGKAAIRDTVLARQAERILDSVRDAITGLTGSERIVTATLVALQ
RLRAEPLSQIMRAMTGSPGTDWLTDSPVVARFAAEMVGDANPDPLAAQWL
IRMFLALWYWPIHGADDEEAAVRRFLGPPYAVAPAAHPETC
333989585YP_004522199.1 hypothetical protein JDM601_0945 [Mycobacterium sp. JDM601]MGNVHAPSTKATRDQRLNFRASAQQQLLIRQAAEAADRTVTDFILGSVLE
SAERILADRKWFVANDEQWERFQELLDAPLQPMPKLRQLLQRESPFAEEE
333989583YP_004522197.1 ribosomal-protein-alanine acetyltransferase RimJ [Mycobacterium sp.MLVNLWPFKAVQHPGWPTVLGPLRVPAGVIRLRPVRMRDGVAWSRIRLAD
RSHLEPWEPSVEADWGTRHSSAAWPPVCSTLRTEARYGRMLPFVIELDGR
FCGQLTVGNIAHGALRSAWIGYWVSSSAAGGGVATGAVALGLDHCFGPVR
LHRVEATVRPENAASRAVLAKVGFREEGLLQRYLDVDGAWRDHLLVAITV
EEVAGSVTAGLVRAGRASWV
333989581YP_004522195.1 UTP-glucose-1-phosphate uridylyltransferase [Mycobacterium sp. JDM6MPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIITS
EGKDGVVAHFVEDLVLEGTLEARGKKAMLAKVRRAPQLIKVESVVQAEPL
GLGHAISCVEPTLSADEDAVAVLLPDDLVLPTGVLETMSKVRGLRGGTVL
CAIEVSPDEVSAYGVFDVEPVPDGDNPDVLRVKGMVEKPKAADAPSMYAA
AGRYVLDRAVFDALRRIDRGAGGEVQLTDAIALMIAEGHPVHVVVHRGSR
HDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVARLGLAEN
333989579YP_004522193.1 hypothetical protein JDM601_0939 [Mycobacterium sp. JDM601]MPTYSYACTECSNRFDVVQAFTDDALTTCEECSGRLRKIFGKVGVVFKGS
GFYRTDSRDAGKSSNGSSSAKAGAAGASSDSGSSGEGATKSADKSSGDSG
TKSADKPKASTASTAAAASA
333989577YP_004522191.1 large-conductance ion mechanosensitive channel MscL [Mycobacterium MLKGFKNFLMRDDVITVAIGLVVALAFSNLVEAFTDSVINPLVSAMQPDA
SGLGLGYQLGEEGSAATFIDLGAFISAIIYFIVFMATIYFFIVLPYKHIQ
KRRGKTVFGDPAPTKTCPECKSEIDPEATKCKFCASPQPAAA
333989575YP_004522189.1 pterin-4-alpha-carbinolamine dehydratase [Mycobacterium sp. JDM601]MVDDRTAHGDEDHSGPLVTELLAEGGFMVDGVVAVSADEVEIRNALNTAV
IGGVDLVVSVGGTGVTPRDVTPEATREILDREILGIAEALRASALAAGIP
DAGLSRGLAGVSGSTLVVNLAGSRAAVRDGMATLNPLAAVIIGQLSSLEI
333989573YP_004522187.1 two-component sensor kinase MprB [Mycobacterium sp. JDM601]MQFFHRRQDGASAQSTSLSLRWRVMLLAMSMVALVVVLMAVAVYAVISAA
LYNDIDNQLQSRTEMLIASGSLAADPRKAIEGTAYSDVNAMLVNPGRSIY
TANQPGQRLPVGQQEKAVIRGELFLSRRTAAGQRVLAVHLPNGSTLLISK
SLAPTRAVTMKLRWVLLVVGGVGVVVAAIAGGMVTRTGLRPVGRLTEAAE
RVARTDDLRPIPVYGSDELARLTEAFNAMLRALAESRERQARLVADAGHE
LKTPLTSLRTNVELLMASAAPGAPQLPEEEMADLRADAIGQIEELSTLVG
DLVDLTRDDRREAAFEQVDITEVVDRSMERVRRRRNDIEFDIQVVPWHVY
GDAAGLSRAVLNMLDNAAKWSPSGGVVGLRMRQLDPTHVEMVVSDQGPGI
PESERELVFERFFRSDQARAMPGSGLGLAIVKQVVLKHGGAITIEDTHPG
AESPGTSIRMVLPGGATSAGERPAPAVTGASQST
333989571YP_004522185.1 50S ribosomal protein L32 [Mycobacterium sp. JDM601]MAVPKRRMSRANTRSRRAQWKAEATGLVNVSVAGRAHKVPRRLLKAARLG
LIDLDRR
333989569YP_004522183.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MSIWTSTERQALRKTVRGFVEREISPHIDEWERSGELPRELHRKAAEVGL
LGAGFPEEVGGSGGDGADAVIVCEEMHQAGAPGGVFASLFTCGIAVPHMI
ASGDTRLIEEFVRPTLAGEKIGSLAITEPGGGSDVGHLRTTARLDGDHYV
VNGSKTFITSAVRADYVVTAVRTGGPGAAGVSLLVVEKGTPGFEVSRKLE
KMGWRSSDTAELSYVDARVPVANLVGVENTGFAQIAAAFVSERVGLAAQA
YASAQRCLDLTLAWCRDRETFGRPLISRQAVQNTLAEMARRIDVARVYTR
HVVERQLAGEFNLIAEVCFAKNTAVEAGEWVAHQAVQLFGGMGYMAESEV
ERQYRDMRIIGIGGGTTEILTSLAAKTLGYQS
333989567YP_004522181.1 acetyl-/propionyl-coenzyme A carboxylase subunit alpha AccA2 [MycobMISNVLVANRGEIARRVFATCRRLGLGTVAVYTDPDAAMPHVAEADAKVR
LPQTTSYLSAEAIIDAARAAGADAIHPGYGFLSENADFAAAVQDAGLTWI
GPPVAAVTSMGSKIESKKMMAAAGVPVLEELDPASVTAEQLPVLVKASAG
GGGRGMRVVTELSALADEVAAAQREAASAFGDPTVFCERYLPTGHHIEVQ
VMADAHGTVWAVGERECSIQRRHQKVLEEAPSPLVARTPGMRAKLFEAAR
LAASAIGYTGAGTVEFLADSRGEFYFLEMNTRLQVEHPVTEETTGVDLVE
LQIAVADGARLDPEPPPAHGYSIEVRLYAEDPGSGWQPQAGTVHAVDVPG
VAAQFGSLCRHTGIRLDSGVVDGSTVSIHYDPMLAKVISYAPTRRQAATV
LASALARTRLHGLRTNRDLLVNVLRHPAFLDGATDTAFFDTHGLAELSAP
LADTATVRTAAVAAALADAAHNRATAQAFGSVPGGWRNVPSGFQTKTYAA
DDGTEHRIEYRFTRTGLIVKDCDVRLVSAGPDEVVLADPAGVARTFTVAR
YGSDIYVDSPAGGVHLVALPRFPDPESAVEQGSLLAPMPGNVIRLGAGLG
DAVTAGQPLIWLEAMKMEHTISAPSDGVLTQLDVKPGDQVEVGAVLARVE
QQAEGDPE
333989565YP_004522179.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MDTLVSYTGPEDTADGSARLTLDSPHNRNALSSRLVAQLHAGLRDAAADP
NVRVVVLGHTGKTFCAGADLSEAAGGDPGELAADRAREMAALLRAIVESP
RPVIAAVNGHVRAGGMGLVGACDIAVAGPASTFALTEARIGVAPSIISLT
LLPKLSARAAARYYLTGEKFGATEAAKIGLITLAAEDVEATVAGLVADLR
LGSPQGLAASKALTTAAVLAGFDRDAERLSVASARMFVSAEAREGMLAFL
QKRPPSWAG
333989563YP_004522177.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MQAADRLAERRERLLVAGLDLLGGREMPALTVRALCRRAGVASRYFYESF
TDKDEFVAAVFEWVVNDLAASTQEAVAAAPPAEQTRAGMAHLVAAIAGDA
RVGRILFSTRLTNALLVRKRAQSSALFAMLSGRHVENVLRVPGNDRIKAA
AHFVVGGVAQTIGAWLAGDIHLQPDQLVDQLTALLGQLDDPALYRDPPS
333989561YP_004522175.1 hypothetical protein JDM601_0921 [Mycobacterium sp. JDM601]MHVDPQALRTGANVSDDAGGHARNGAQRLGSAGVAAGIFGDFDDAHSFHA
ALGSAKDGHRDALQGHHQNLTGIAENVRTAATAFTRMDNDNAEQLRDVIG
PGPGP
333989559YP_004522173.1 monovalent cation/H+ antiporter subunit G [Mycobacterium sp. JDM601MIVLDLFASVLGLAGAVLALTAAIGVVRFPDTLARMHSATKPQVLGLILV
LVAALIRLRGSHDAGMVTVSIIFTLITAPVVAHRVGRLAYQEQDMTEVLA
VDQLVELTEEEDQASR
333989557YP_004522171.1 Na(+)/H(+) antiporter subunit E [Mycobacterium sp. JDM601]MRPIALRIAALCGLSVIWTLLWGRFTIPNLVVGIAVAVVIMVLLPLPPVP
VQGKVHPWSALKLLGLFAWYLVVSSGQLMWLAIRPGPPPQTGVLRVPLTI
KSDLVLVLAAGITTLIPGSMVLEIDQVRRILYCHVIDVGNARSVERFYHQ
AAQVERLLIDAFERDEDWLPAGAGA
333989555YP_004522169.1 monovalent cation/H+ antiporter subunit C [Mycobacterium sp. JDM601MTAHLVPLLMAAGLTSCGVYMLLERNLTRALLGLMMIGNAINLLIIDVSG
PGGSPPIYNSTEGMENDADPLAQAMVLTAIVITMGIAAFVLALTYRSYHL
TTDDDIGDDEEAIRLSQLSDEEIIAAEADHSEPVAPGELDAVVESTVAES
GVSR
333989553YP_004522167.1 two-component transcriptional regulatory protein [Mycobacterium sp.MAPPARIMLADDHALVRSGLRMILDAEPDLCVVAEAADGSEALAALQNTP
VDLAILDIAMPRMTGLQAAREINRSHPHVRVLMLSMHDNEQYFFEALKAG
ASGYVLKSVADRDLLEACRATMRGEPFLYAGAVTALIRDYLHRSRHGDDL
PDNILTPREEEVLKLIAEGLSAREIAKTLGISAKTVDRHRTNTLQKLGLR
DRLALTRYAIRAGLIEA
333989551YP_004522165.1 PPE family protein [Mycobacterium sp. JDM601]MDFAALPPEVNSGLMYAGAGPASMLTAATAWDGLATELHLAATAYESVVT
ELTSGPWLGPSAAAMAASITPFVSWLNMTSVQAEKTGMQAKAAVAAYEAT
FATVVPPPAIAANRAALMTLLATNILGQNAAAIAANEAEYAAMWAQDASA
MYSYASLSATATEMEPFQPPPHTANPAGPLNGSEAAGLNSAANTAQTLPS
KLASALPGSSDAGSQFPAMLAQADVPTGPFDWLGIIADETALGIALPLSI
LGVWLAGAAMYFAELDSREIFDTQDILRGGQRSILEALGQIGGFAELPGT
ESLRVPHASVVAALAEGFPLGALSVPLSWAELAPEIRHASFSTPLSAAGS
PTPAGLGTAFGQMALAGMGGSALAGAVNQNRGQQTKTPEAGKAAPAASVD
PAAAESGPGAPVAAAHSPASSVVELAAGIRELGELHDAGYLTEAEFAEQK
RRLLARG
333989549YP_004522163.1 magnesium chelatase [Mycobacterium sp. JDM601]MVTALTTPHDLPTTLGELRAAGHRERGVKQEIAENLLARLADGDDAATVW
PGIFGFEDTVLPQLERALIAGHDIVLLGERGQGKTRLLRALTGLLDEWTP
VIAGAELGEHPYSPITPESIRRAAELGDNLPVAWRHRSERYTEKLATPDT
SVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHRGIVAVNELPDLAER
IQVAMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPLKD
RFGAEVRTHYPLELDAEVGVIAQEAHLSAQVPDYLLAVLARFARYLRESR
SVDQRSGVSARFAIAAAETVAASARHRGAVLGETDPVARVVDLGTIVDVL
RGKLEFESGEEGREQAVLEHLLRRATADTASRALGGIDVGPLVAAVENAA
VTTGERVSAKAVLAALPDLPVIDAIAQRLGAESDGERAAALELALEALYL
AKRIDKTSDEGETVYG
333989547YP_004522161.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MARTQRERREATVAGLLDASIATIAEVGYARASAKVIAARAGVSDGALFR
HFDTMGDFMAATAQEVLRRQLERFGKQVAEIPAEVPALEAVLTVLRDLTA
NSTNAVLYELLIAARTDEKLRATLQHVLAEYGAKIGEAARVLPGADTFPP
ELFPNLVALLTNTFDGAAIVRAVLPQPEIEANRIPLLLALLEGRI
333989545YP_004522159.1 bifunctional purine biosynthesis protein PurH [Mycobacterium sp. JDMTDGKRPIRRALISVYDKTGLVDLATGLHAAGVDIVSTGSTAKTIAAKGI
PVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALGELDIAP
FELVVVNLYPFSETVDSGAGMDECVEQIDIGGPSMIRAAAKNHPSVAVVV
DPLGYDGVLAAVNAGGFTLAERKRLASLAFRHTAEYDVAVAGWMSSTLAP
EEPRQPMPEWFGRSYRRAAQLRYGENPHQQAALFCDGGAWPGLAQADQLH
GKEMSYNNFTDADAAWRAAFDHEETCVAIIKHANPCGIAISSISVADAHR
KAHECDPLSAFGGVIAANTEVSAEMAEYVSTIFTEVIVAPAYESGAVEIL
ARKKNIRVLLASEPLRGGVEWRQISGGLLMQSRDGLDAAGDNPVNWTLAT
GSPADPATMADLVFAWRSCRAVKSNAIVVAANGATVGVGMGQVNRVDAAR
LAVERGGDRVAGAVAASDAFFPFPDGLQTLTGAGVTAIVHPGGSVRDDEV
TAAAAEAGVTLYLTGARHFAH
333989543YP_004522157.1 hypothetical protein JDM601_0903 [Mycobacterium sp. JDM601]MTHAASAADVGVRNLHSLARARAELLTRLVLPPGHDPILDVMATIWLDGA
GAGFQMVERPAPAGLTTPLADALYERLAGAELCSEYEEFPELDDSDFQDL
ACGRVEKVSHGIHPAGHPDVIWDKVEIWTDGVAAALRITRDEGRQQA
333989541YP_004522155.1 transmembrane protein [Mycobacterium sp. JDM601]MTYSPGNPGFQPAQPPGSYGQSPPSFAKSGGDNESKLPLYLQIAVVVLGF
GVYLGNFGPIVTVTDGEFPLILGDAGHTVPLALLAALLAGAGLLPKAKLY
TAVVAAIATLAALLAIATIAEAGENYEIGWGLWLVLTFSVLQAVAALGSL
LLEAGVVTAPAPRPKYDPYAQYGLPPGGNYYGQPGQQGYGHQGPQQSGYP
SYGSYPSAPSSGGFGAQSAPSTGGFNSGAQQAQSAQQGPPTPPTGFPSFG
PPPSGGSGSSSTGGQGSSTGGQSGSGQGQSSTGGQQSQGGSAPSGPAQP
333989539YP_004522153.1 thiolase [Mycobacterium sp. JDM601]MSIDPRTPVVVGVGQSAERIDDTDYRAMSPVELAAVAAQAAVADCGAERV
AQAIDTVVATRQFENSIPNAPAPLGKSNNFPRSVARLIGADPARAVLDKV
GGQGPQKLLSEFAAEIAAGTADAVLLCGSDATSTLRHFAKSSEGEDKPDF
SETIDGQLEDRGYGLEEFVEHYTVIHGLTGAPVQYGLLENARRARLGMGT
ADYLQAMGELFAPMSKIAAKNPFSASPVERSVDELTTISTTNRMICDPYP
RLLVARDQVNQGAAALLMSVEAARRLGVSEDRWVYLHGHADMRSQRLLER
ADLGAYPAAVAATTAALAMAGIGFGDITAMDLYSCFPVPVFNICDAFGLA
GDDPRGLTLTGGLPFFGGAGNNYSMHAIAEAVAVARSAAGQFAFVGANGG
MMSKYSVGVYSAAPAPWTPDRSAEPQAELDAAPKVAVTERAEGPATIETY
SVRYDWETRTGIIIGRLDADGSRFLATTEDDDLVALLSDGEPLGTPITVR
ALDYGNRCSLR
333989537YP_004522151.1 succinyl-CoA synthetase SucC [Mycobacterium sp. JDM601]MDLFEYQAKELFAKHNVPTTPGRVTTSAEDAKAIATEIGRPVMVKAQVKV
GGRGKAGGVKYAATPEDAFTHAQNILGLDIKGHVVKKLLVAEASDIAEEY
YISFLLDRSNRTYLAMCSVEGGMEIEEVAATKPERLAKVPVDAVKGVDLA
FARSIAEQGHLPAEVLDAAAVTIQKLWEVFVAEDATLVEVNPLVRTPDDQ
ILALDGKVTLDGNAEFRQPGHAEFADIEATDPLELKAKENDLNYVKLDGQ
VGIIGNGAGLVMSTLDVTAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILGDKQVKSVFVNVFGGITACDAVANGIVSALKILGDAATKPLVVRLDG
NNVEEGRQILADANHPLVTLVDTMDEAADKAAELAYAGKDA
333989535YP_004522149.1 hypothetical protein JDM601_0895 [Mycobacterium sp. JDM601]MRPSEALQPVGNRLPSAAVAISACVFAIIGCWATSVVTTDLIASWWHTDR
LFCVAVGFLSLVFAVTSISGVIMLLLRRPLGRYLIAIGAVIALLTFGSLF
LAGARVPWIVHAIPIIQAVTVLLALHPATPRWLGV
333989533YP_004522147.1 hypothetical protein JDM601_0893 [Mycobacterium sp. JDM601]MGPEHTNSENLESEPMTNQTQQLPDIDELRQEIDRLDAEILAAVKRRTEV
SQEIGKARMASGGTRLVHSREMQVIERYSELGQDGKDLAMLLLRLGRGRL
GH
333989531YP_004522145.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MARAFAARGRDLALCARRIDRLEELRDELGQQYPGVKVSVAALDVNDHDE
VPKVFARFVDELGGIDRVIVNAGIGKGAPLGSGKLWANKATIETNLVAAL
VQIETALEMFTSAGSGHLVLISSVLANKGVPGVKAAYAASKAGVSSLGES
LRAEYSSGPIKVTVLEPGYIESEMTAKSGSTMLMVDNASGVKAMVHAIER
ETGRAVVPPWPWTALVWAMRRMPPRFTKRFA
333989529YP_004522143.1 hypothetical protein JDM601_0889 [Mycobacterium sp. JDM601]MASFLIRAALTGLALWVVTQIVPGIEIVGGDTTVERVGIIFVIALIFGLV
NAFIKPVVQLLSIPLYILTLGLFHIVVNALMLWITAWITDKTAKHWGLYI
ADFWWDAIWAAIVLSLVSWVLSLVLRDARRITR
333989527YP_004522141.1 hypothetical protein JDM601_0887 [Mycobacterium sp. JDM601]MSHNGSCEVVVLGDPARLHGLLDAARVVGPDAATRFDSGSDTWTVITADG
EQLAARVIVHASASPDDVVAAHGMPNRFRIPGPHTRRQARYVARLVDGLR
RSGASRIEARPARVRVRRYLPTRGLSRFYLTGSESTDTEVYDGPAILTHN
GQDYPTRVRLAGHFDPIDGQYHWQGMFFIDLPGSNATGSKVSIRVGEHTG
HGRVAERTPWGTLTVSGAGGYPPYPLQDSEEVRIAMPPRV
333989525YP_004522139.1 hypothetical protein JDM601_0885 [Mycobacterium sp. JDM601]MKTQTCLPAQSRGDHGDYMRAVHLLRAAASSDVGQSDARRQWIRAATRC
333989523YP_004522137.1 endoglycoceramidase [Mycobacterium sp. JDM601]MGSKVVGVAAFLALTVPAVPAQADLDDMMDVLFDPFVTTAGAFDGEAVFD
ATAWESFLSTEHWDAALAALAEPGPAVGFDFYALLHDATQKWIDSDLGSQ
VNGVINTLFGSTVIGNGIDGTQDNPDGGDGGWLFGDGGAGWASTTDGVAG
GSGGAAGIFGDGGDGGTGGAGAAGGDGGAGGWLWGNGGHGGDAGDGPTAA
GLPALGGVGGTAGLWAGEHGSVGQFGALPGGITGTVAPPVEVSNGWFTNG
DGQVVIWHGLNQVYKVSPYTPSGDGFSDDDAAFLAANGFNSVRLGIIWAG
VEPEPGVIDYDYLASIEETVEILARHNIVAILDMHQDLYNEEFGGEGAPD
WATFNGGLPHFGLGFPATYPLSPAQNYAWDAFWANTKASDGIGLQNHYAL
MWQAVADYFKGNSNVAGYDIMNEPWAGTHWLGSILGNQYFDAQQLTPFYN
QIDAAIRSVDPNKTVFFEPNTLFGSTPIPTHLGAVDDPNSAFSFHHYCLT
TALFPGTSFGCDWNADIVFGYAQDYMQEHNIPGWLSEFGATNNLGAIEAS
LQGSNRYLFGWSEWAYSGKDITSISPEDQALVYDPSKPPVGDNVNWDKLD
LLAQPYPQVISGIPITWSFDNGVFTFSYSTDQADGTGSFDAGSQTTISVP
PSQYPNGYTVNVTGGTATSVPNAPVLTINSDDGASTVTVTVRPAGG
333989521YP_004522135.1 ATP dependent DNA ligase [Mycobacterium sp. JDM601]MAAQPFQTRVKLTNADKVLYPATGTTKAQVYHYYTRIAEVMLPHIAGRPV
TRKRWPNGVAQDSFFEKQLASSAPAWLPRAEVQHRSGITAYPIIDDLDGL
AWIAQQAALEVHVPQWRFEAEWTGGGRVLKPGPASRLVFDLDPGEGVSMS
QLAQVARAIRDLMAELDLDTFPVTSGSKGIHVYAALDRPVASAGAVAVAK
RVAQQLESAMPKLVTATMAKKLRAGKVFVDWSQNNASKTTIAPYSLRGRD
HPTVAAPRSWAELDDPDLRQLRFDEVLERVEHDGDLLAGLDGPLEGQDRL
AVYRAKRDAGRTPEPVPAAAPAAGEGNSFVIQEHHARRLHYDFRLERDGV
LVSWAVPKNLPTTTSVNHLAVRTEDHPLEYGGFEGTIPKGEYGAGTVRIW
DSGSYVTEKWQDTSEKGEVIVVLRGDRISGRYALIRTGGDQWLAHRMKDQ
QTFAFTDLAPMLATHGSVSGLDPKVWAFEGKWDGYRLLVEADRGRVRLRA
RSGRDVTGEYPQLQTLAAELTEHHVVLDGEVVALDAAGVPSFAAMQNSAR
STRVKFWAFDLLYLDGRPLLRAAYRDRRRLLATLAQGTGLVVKDLLAAGG
AEALEQSRRLGWEGVIAKKWDSPYQPGRRSPAWVKDKHWRTQEVVIGGWR
AGEGARGGGIGSLLMGIPEGDGLRFVGRVGTGFTERALAALKKELTPTDE
SPFDAPLPRADAKGVTFVRPTLVGEVRYSERTADGRLRQPSWRGLRPDKT
PDDVVSED
333989519YP_004522133.1 hypothetical protein JDM601_0879 [Mycobacterium sp. JDM601]MVIVAVVVIAAAAFGISRLHGIFGSEDTTSTSRDSADEIVPFNPKNVVYE
VFGAPAATATINYLDVDAAPQQVIDAPLPWRYQATTTEPAIIGDLRAQGN
GDLLGCRIVIDGELKDERIVNAVSAYTFCLDKSG
333989517YP_004522131.1 hypothetical protein JDM601_0877 [Mycobacterium sp. JDM601]MFDNVLPEPASLVESDDAALVAAISGWARVEAAASARRLAAVGELVARRT
RGADAVNRSRWSCDYWDAAASEVAAAEQISHGMASSQMYLATALRERLPK
VAALFLDGAINARLVATIVWRTTLITNPYLLDAVDTELAAIATGLGPLSA
AKTAAAIDALIDRYDPDAIRRQERDARGREIVVDTRNSENGTTALWGRLF
GTDATALDRRLTQLAHTVCDDDPRTLAQRRADALGALAAGADSLACACGS
TDCPAGGGADARAANVTVYVLAEQAALDAVADPGFGNGEPQQDPEPAAAQ
PPPAPAPKTQARPARAGAIIGGGTVPAPLLAQLINGGATVKPLRHPDGLP
AEPHYRPSAALAAFVRARDLTCRFPGCDQPASYCDVDHAIAYPFGPTHPA
NLRCLCRKHHLLKTFWTGPGGWHDIQHPDGTVEWTSPTGHTYTTRPGSRL
LFPMLCMPSGAPPATTSPALPTAVRGLMMPTRKRTRIQGRVHRINAERAL
NKAPP
333989515YP_004522129.1 hypothetical protein JDM601_0875 [Mycobacterium sp. JDM601]MPIRVAQIGTGNVGVHALKALITNPEFELTGVWVSSDAKAGKDAAELAGL
DTPTGVSATTDLQQILDAKPDCVVYTALADNRLVEALDDFRRILAAGINV
AGSSAVFLQYPWQVLPAEMLSPLEDAAKAGNASLFVNGIDPGFANDLLPL
ALAGTCQSIQQIRCMEIVDYATYDSPAVMFDVMGFGQPIDEVPILLQPGV
LSLAWGSVVRQLAAGLGLELDSVEQSHVRVPAPEDFTISAGDITKGTAAA
LRFEVRGMVDGHPAVVLEHVTRLRDDLCPEWPQPAQPGGSYRVEVTGEPS
YALDLCLSSPNGDHNHAGLVATAMRVVNAVPAVVAAEPGIRTTLELPLVT
GRGLYARP
333989513YP_004522127.1 acyl-ACP desaturase [Mycobacterium sp. JDM601]MTNVQTALLHELEPIVEQNLNRHLKAAKPWLPHDYVPWSKGRDFAFLGGE
DWVPEDSPLDPVAKAALLVNLLTEDNLPSYHREIATRFGRDGAWGSWVGQ
WTAEEGRHSIALRDYLVVTRGIDPVNLENMRMQHTIAGYDSGDKTPLQAL
AYVSFQELATRVSHRNTGKASGCPIADQLLARVALDENLHMVFYRNLMDA
ALDIAPDEAMCAIRDEVLGFSMPGMNMPGFQENALLIAKAGIYDLRIHHD
DVVQPVLRFWKVFERDGFGPDGEQAREQIDGFLKMVDERATHYEEKAKAR
ESVSA
333989511YP_004522125.1 20-beta-hydroxysteroid dehydrogenase [Mycobacterium sp. JDM601]MTDLSGKVALVTGASSGLGAAAAQLFARRGASVFGLARDAERLAAVFADV
PGGRFASTDISTAPACTAAVGQCVEQFGRLDVLVNVAGAHQMRHTLEVTD
GDWAHDLAVNLNGPFFLCRAALPHLLETAGNIVNVASIAGVEGQAYSAGY
CAAKHGLVGLTRALAVEFTAEKLRVNAVCPGGMLTPQVTNFQLPEGADVN
LVMRVASPRGMSTPSDVAEVIAFLASDAAAAVHGAVYMTDNGKTAG
333989509YP_004522123.1 camphor resistance protein CrcB [Mycobacterium sp. JDM601]MNWLLVIAGAAVGAPLRYLTDRFVQARHDTTFPWGTFTANVLGSLILGVL
TGAVSGGDQRWQLLIGTGLCGALTTYSTFSYETLQLAGAGARLYAVANLV
LTLTCGLGAYYTGNVAAQALWL
333989507YP_004522121.1 camphor resistance protein CrcB [Mycobacterium sp. JDM601]MMAIPEPDVTVGPDLFVRRRRSSAVREQAPVVAAVALGGAVGACARYGIE
LAWPAPSGGFPWATLLINVSGCALMGALMVAITELWVGHRLLRPLLGTGV
LGGYTTFSTFASDVDTLAAAGQLARAVIYLLITPVLVLVATWTTAALTRR
LIIRRTA
333989505YP_004522119.1 hypothetical protein JDM601_0865 [Mycobacterium sp. JDM601]MEALLSDEVVFTSPVAFKPYPGKPITAAILRAVMRVFSDFRYIREIGDPS
GRDHALMFEATVAGKRLTGCDFLHVDDDGKIDDFMVMVRPLSAATALAEA
MAAQFDQITREAAGQGGPA
333989503YP_004522117.1 hypothetical protein JDM601_0863 [Mycobacterium sp. JDM601]MVVPARADPSDAHTTMMTAAQPQNAVTVGDLLTISPRARERRMLAATALD
RWESEGGTADG
333989501YP_004522115.1 linoleoyl-CoA desaturase [Mycobacterium sp. JDM601]MAITDISVFAHLTDADIDALAVDLDTIRLDIEDSLGARDARYIRRTIAAQ
RVLEVAGRLMLTVGSKRHAWWAGTLSVALAKIIENMEIGHNVMHGQWNWM
NDPEIHSSTWEWDMAGVSKHWQFTHNLRHHKYTNILGMDDDVGYNTLRVT
RDQPWTPSNIGNVLFHIILALGFEWGIGLQPMEFGNIRKGGPERETALGK
ARQFALKAGRQLVKDYVAFPALTSLSPAASYATTLKANLLANVIRNIWAD
AVIFCGHFPDGAEKFSKTDMIGETRGQWYLRQMLGSANFDAGPALRFMSG
NLCYQIEHHLFPDLPSNRLHEISVRVRQICDKYDLPYTTGSFLMQYGKTW
RTIAKLSLPDRYLRATADDAPETRSERMFSVLAPDFVGTDAATGHRRGLR
SAIAAVRGWRRGHGSSAGTRGLRQPAALECQRELAANRQMTEPS
333989499YP_004522113.1 ANTAR domain-containing protein [Mycobacterium sp. JDM601]MDITAALAADLAALTEILDDPGLDLTGTLRQLVDNSKLAVGSYLGLTVMT
TVLGRQSSFTVLESGTEIGDIVTSLWLPIPPAMSDDGAAPFASLILYAGN
PGAFVDLAADLSWLTGRTLTEFVLDQHRTPPRAGGAPGGIAAASLIDQAI
GVLIAGGYTVERAHREIDARAERLSVSRGDIANDILSELNGPVSEDN
333989497YP_004522111.1 transcription regulator ArsR [Mycobacterium sp. JDM601]MAKHEERRPEDMTSPSRSEEPTRPQLASAASTFALLSSPARLHVLWLAAQ
GAYDVTTLAGRAGINVATMSQHLTKLRLAGLIRARREGRHHIYTVDDPHI
LTLLQQIFAHIAPDGTLAPDPPPGPRDDP
333989495YP_004522109.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MTTGGGSAATTAVRRRPKDRKVQIVRAAARAFSDRGYHAVGVDEIAAEVG
ISGPALYRHFTNKYALLVATAEYTAQALVTAAQRADEPDKPPQDRLRAII
DALIEATIGMRREGAFYRWERRYLQPADRGRIRGSYDALNAALAEPLAAL
RPGLNAVDTVTLAAAALSVIGSISAHRTRLAAAPLQSLLAELCWSVLTST
DLPAAPDGPMPRRSERGLPSTSKRERLLTEAIRVFGQRGFYEASIEEIGT
AAGLQGSSAYRYYPSKAALLVAALQRASDRVLLAITDALAESSDPREAAT
RIAERYTALSFAAPDLINIYFAEFANLPERDQTHLRALQRQNVNEWAHLL
GQVGSAETEAVFRVHAALALVVDIGRLVNFDDTDEQRARVHTLMEAVLFG
AEPS
333989493YP_004522107.1 fatty-acid--CoA ligase [Mycobacterium sp. JDM601]MTAQPLRSRRNHWVNQVAIHAEMRPDAVAFRCRGTDTSWRQLHDRSERLA
AALFRRGISFGDRVLIVMLNHTEYVEAVLAINALGAIAVPVNFRLTDPEI
SYIVSDSGAKGVITDQLLAPLIDAVRKNTTGLDVAVVLGDEYEALITEAG
EPHPGLDISEDTPALIMYTSGTTGSPKGAILSHSNLQAQSLTCIQALQTS
QDSVYFCAAPMFHIAGLGSIAPNLVMGTKTVIHPLGAFNAAETLDAWESE
RATSVFLVPAQWQLICADPTVRQRDLALEVISWGAAPASDTVLRAMAETF
PDALNVAVFGQTEMSPITCVLDGKDAIRKLGSVGKVIPTIAARVVDENMN
DVAPGEIGEIVYRGPTLMQGYWNKPEATAEAFAGGWFHSGDLVRVDEEGF
VYVVDRKKDMIISGGENIYCAEVENALFEHPQIREAAVIGRADDKWGEVP
VAVVAVAAESQSLTLGDLEPFLNERLARYKHPKELVLVDELPRNASGKVV
KPQLRKTYG
333989491YP_004522105.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MDFSFTDEQELLRTTVGKFLADRYDLERSRAAAKTGAGWQPNIWRAFADD
LGILGATLPESTGGLGGGPIELMIITEALGHALVIEPFVETVVLAGGLLQ
RAGGPQAEALLTRIAAGDAVVAVAVEEPASAGTWHDVTTTARRDGDHWVL
DGAKIAVSSGPLASHLLVTARTSGAQRDTIGISLFLLDLDQTSVAMEPLR
TIDDRRAADLTFDGLRLSADALLGAEGRAWPALEQTADEATAAIVSEAVG
CLRRVLADTVDYTKQRQQFGQPISSFQVLQHRMVDMYLEVEQAVAAQYLA
IMKLGAEPAERARAVSAAKATVARAARFVGQSAVQTHGAMGMTEELALGH
YFKRLTAIEYQFGSRDRHLARYAGLTAVG
333989489YP_004522103.1 hypothetical protein JDM601_0850 [Mycobacterium sp. JDM601]MPTFADVYREKYLLLTTFTKDGRAKPTAVWGAPDGGKLLVITDDGSWKTK
RIRNTPRVTIQKCGVLGAPKGEPVEAVARVLPKSETRRVYGAVVKRYWWH
AWWFVPHSVVRGGIDKVHVGLEIAPTGAVS
333989487YP_004522101.1 hypothetical protein JDM601_0847 [Mycobacterium sp. JDM601]MNLIVHRVCLILLTIVGISLGGWAYFAPLNWYNTFPGMGMHWLPVLGPYN
EHFVKDVGSLFFGLAVLSALALYYLRNRPVVVITAVSWSVFNVLHLIYHL
GMLHMYGPRDAVLNVVSLGLLLVLSLLLLIPARGHATEDHA
333989485YP_004522099.1 hypothetical protein JDM601_0845 [Mycobacterium sp. JDM601]MADRFTIPSAEVLRAREKLVLDHFHDEVRQDWDDVLATFPHPHYEIIPTL
TVHDGDTEVRAYYRDTRIAFPDQDHEIIALRHSADAVIVEFWLLGTHLGP
LGAIPATGSRHRTRMTAYFVFDERETLIAERIYFDTLSMLKQLIGGLNLR
DPRNWPLVIRGVRGLLAMAAEPDPLLVNTPAADLAGSE
333989483YP_004522097.1 HipA N-terminal domain-containing protein [Mycobacterium sp. JDM601MGRDCVGAVQFAREDALDELAQRAVDYRPVSDTEIGERLAALRVTGVSWT
LPDEHWSLPGAQEKFTLARLGDRWHEARGAATSTHIVKPGVARLMHQAVV
EYATMQVAARLGLLVAATELADFAGETAIVISRFDRYHDPTSAVHRLHQV
DFCQAMGRMPVNKYEERNGPRTAELATMLRRESARAEQDVHRFSDAVLFN
YVVGAPDAHAKNFALLYPPRGGPRMAPLYDLSSALAYEPRAGGYDLSSVA
MSIGGRRKFGQVLKKNFERHADEMKLDRTERLARVADMAAATPDVFRSVL
ASIDSPAAREVVDRLLPRLERHTQDIARRIGR
333989481YP_004522095.1 oxidoreductase [Mycobacterium sp. JDM601]MSEVTLTTGREPTLKPSACILCECNCGIEVLVEPDTGRFAKIRGDKAHPA
SAGYTCNKALRLDAYQNGRNDRLTKPLRRRDDGTFEEVEWDAALTEIAQR
LTRLRDEHGGESIFYYGGGGQGNHLGGAYAPATMAAYGARFRSSALAQEK
TGEFWVAARMLGRPHRSDFEHCEVAVFVGKNPYQSHGFPRARSVLKEIGK
DPSRSMIVIDPVRTQTAELADFHLQLRPGTDLHLLTAMVAVLVQEDLIDH
AWLAEHTDGLAEVAAVMREVSVTDHCAVADVPEDLVRAAARRIAEAGSVA
MLEDLGIQMNRNSTVVSYVEKLVWLLTGNFAKRGTQYVFSGLAPIARDRG
LAFDDIPRTPVSGAAIVSGLIPCNAIPDEILTEHPDRFRAVIVESSNPLH
SLADSVRMTEAFRALELVVVIDIAMTETAREADYVLPPPTQYEKYEATFF
DFEFPRNLFHLRHPLLEAPAGQLAEPEIHARLCELAGAVGEADYAPLRAA
LAQGREAFAQAMLGVLADRRLAKLAPVLLYRTLGPTLPDGAAGAAVLWGA
SLMCAMENPAGVARAGYGAGLMAGDRLFEAILASPHGVVITDDEDDASWQ
RLGGRRIQLDVPELLDVVRKLGDDEAVITDADYPLVLSAGERRDFTANTI
LRDPAWRKRDPEGALRVSQADAAAWSLANGDRVRVCTRRGSAEAVVTVVD
TMRQGHISLPNGLGLVSQDGEQVGVRLNNLTSSADCDEFVGTPWHKSVPA
RLEKI
333989479YP_004522093.1 hypothetical protein JDM601_0839 [Mycobacterium sp. JDM601]MTATSATSAADPETPPTITAKLPPSRALRIVWIAAFGSLTVSFPLYSYLA
FHSGFDRGGIANAMVVQVTVAYFLGIFAAFLPIPSLRQWTRFQRLQGVVL
AFAVVSYTTHLTWELGWLLLHKAIPAARDAAWAYPWWNYIDGGDLRYLDA
APGFLMIEVLSVINGCIGMTGLILLFRSKFLDHRGTLLIMSTAVTHTVLT
WYYYGTEIIGGFPSVNTSSFMDLGVKFVLLNGPWLIAPWLVLAWGYAMLI
RQLRA
333989477YP_004522091.1 hypothetical protein JDM601_0837 [Mycobacterium sp. JDM601]MQMTGSAEGDRSGRIRRYGFATAALATALSMVVGTPAVTARTAPAVALTS
TAGFQPAIDALIAEMQRLVGVNMALDYAAPGSEDELMTMLQNTNYQLLSA
GLSRVTQLFNGVFFQSPEVIAGNAADPRQYFDFFTPDIYYRVTAGLAPGA
TYVLNGTLGGGTEHFVISTQAITGGSAQAIENLEMGHGLVVNPDGTFTVY
IGPEAPEGAVNFMDSTDATVGGAASLLIRDMLGDWAKGPGHVTLQCVADC
PPFFAIPEGGFFPSDDPVGATLEQPGGITSVDSMLTTLFSAFAQVIGPFN
TRAIEGGASVGMNVPANTMFDLSPQTSYGAGLESAVVTGGNFELEPDEAL
ILKVPTVDAAYSGIELMNVYGGALPYVMAQTTLNHTTTYHAEDGYTYYVI
SGTNPGVANWLDTGGINTGEIFARFENVTDPDNALGLGVTTEVVKLADLG
TSMLPDDTPTVSPEEFAVDMAQRVLSYGYGLDVSRMHAQPDWVLQNLLMN
GLQGLMGDENYEAVFGHEPFTPIALRFTDALSPNWDAVWNSIMDHPMESL
TAVWNNLPLLASDINLPITLALAQTALSVVMPQLLIPAINDALFDPNTSI
LAGLLNARDDFATAILTATDAWPTELGEQATQQWANMADLIASTPSFDLS
DLFGG
333989475YP_004522089.1 hypothetical protein JDM601_0835 [Mycobacterium sp. JDM601]MTATQHAYFAYGSNLCAQQMARRCPEASDPRPATLADHDWLINQRGVATV
EPFPGSRVHGVLWRVSDRDLAALDSAEGVPVRYRRDRLTIHTTDGSSPAW
VYIDHRVQTGAPRDGYLERIIGAAVQHRLPPAWIEFLRRWDPIRWRPRTP
PADHAGPQSLSALLAEPDVIEDSRLRSRFGFLAIHGGGLEQMTDVIAERA
ADAAGASVYLVRHPDGYRRHLPSTRYLAAESPRLAEFLDHVDVVVSLHGY
GRIGRSTQLLAGGRNRRLAEHLARCLILPGYQVITDLEAIPAGLRGLHPA
NPVNQTRGGGAQLELSPRVRGISPRSQPPGLDGLSPVTSALVRGLALAAR
SWD
333989473YP_004522087.1 transmembrane protein [Mycobacterium sp. JDM601]MTRVHPGWLVALFAAILSVSAWLPWLTTSAHGGGRASAIGGTAGSIALPP
RFGVGQLIVLLAAVLLVAGAMIGRGLFSRLASVAALVVSLGIVALGVAFY
RLNVAAPITAGYGLYIGAVSVAGALGCSVWALLTSARR
333989471YP_004522085.1 hypothetical protein JDM601_0831 [Mycobacterium sp. JDM601]MAKLSGSIDVPLPPEEAWGHASDLSRYKEWLTIHRVWRSVLPDTLEKGTT
LESIVEVKGMPNRIKWTIVNYKPPTGMTLNGDGKGGVKIKLLAKVAPAGD
GSKVSFDVHLGGPALFGPIGMLVAAALKSDINESLQKFVTVFAPA
333989469YP_004522083.1 hypothetical protein JDM601_0829 [Mycobacterium sp. JDM601]MLRGALRLAAATASLAAGGWTLRALRGTPGALGAAPHAIDAVAARSRHYR
DGIFHNVERASMVNMDREQQRLMLRELFADRGASRPVAPVPLGVPDFADA
AEPLTVTWLGHATALIEVDGYRVLTDPVWSERCSPSDAVGPRRLHPPPVE
LSALPAVDAIVISHDHYDHLDIDTVTALARSQRAPFVVPLGVGAHLRAWG
IPADRVVELDWDEQASFGELTLVCTPARHFSGRFLTRNMTLWASWVIAGP
DHRVYFGGDSGYTGSFGQIGADYGPFDVTLLPIGAYNTAWPDVHMNPEEA
VRAHLDVDGATLVPIHWCTFRLAPHRWEEPVERLLAAAEPAGVSVVVPRP
GGSVRLDGGEAKLGPPHKPSERIRPAAGDIEPWWRS
333989467YP_004522081.1 acetyl-coenzyme A carboxylase carboxyl transferase subunit beta AccMSRIGADELRDAILDHGSFISWDDEPLALPVSDDYAAELAAARAATGRDE
AVITGEGRVGGRRVAVIASDFDFLAGSIGVAAAERITTAIQRATTQRLPL
LASPSSGGTRMQEGTVAFLQMVKIAAAIELHKRAHLPYLVYLRHPTTGGV
FASWGSLGHITLAEPGALVGFLGPRVYEQLYGAPFPPGIQTAENLQAHGV
IDGVIPVKWLRRTCSRALKVMLDDPAPPPASPACEPTPDLPAWDSVCASR
RPDRPGVGFLLRHGATERVFLSGTGSAERGATMLLALARFGGQPAVVLGQ
LRGPDRLTDPIALRDARRGMALAEDLRLPLVLAIDTPGPALSVEAEQGGL
AGQIAACLAELVTLEVPTVSVLLGQGSGGPALAMVPADRVLAATHGWLAP
LPPEGASAIVFRDTGHAPELSAAQGIRSADLKAHGIVDVIVAERPDAADE
PIDFAKRMSRAIAVELDALRRVPAEQRMAARLQRYRRIGLAG
333989465YP_004522079.1 transmembrane ABC transporter ATP-binding protein [Mycobacterium spMGTAVTAVAGRAAARGLLWSLLRPYRVAVVLLALIVVVENAARLAVPILA
QRGIDRGIPPIAADGSTRVLTAIIVALGAVVLVQAGSRILFLQWSGRIGQ
RVLLELRRRVFRHFQRLDVGFHDRYTSGRVVSRLTNDVDAIQEMLLGGFD
SLVSAVLTLAGTAVLLVVLDWRLGLMCLGAFPVLVALLRWFRAESSKTYT
AVREHAARVIVQFVETMTGIKAVQAYRREARNAELFTGVADRYRAVNEKA
FKLVAVFSPGVKLVGNLTTGMVVLYGGWRVLHGHMTIGTFTAFLLYLRMF
FDPMQEITQFLNTFQSATSALEKLAAVLAEKPGVADPDAPVTLAEVRGEI
ALRDVCFGYRADAPVLAGLSLSIPAGQTVALVGSTGAGKTTIAKLIARFH
DPASGSVTLDGVDLRDLTQAELRRHVVMVTQENFLFSGTLADNIRFGRPE
ATDAEVVAAAAGVGAEAFVAALPDGYDTDVAKRGGRLSAGQRQLVAFARA
FLADPAVLILDEATSALDIPGERMVQQALRTVLARRTALVIAHRLSTVEI
ADRVLVIEDGTVVEDGPPADLIRAEGHYAALHDAWRRSLA
333989463YP_004522077.1 two-component response transcriptional regulatory protein PrrA [MycMNNPANAAASPRVLVVDDDSDVLASLERGLRLSGFEVATAADGAEALRSA
KETRPDAIVLDINMPVLDGVSVVTALRAMGDDVPVCVLSARSSVDDRVAG
LEAGADDYLVKPFVLAELVARVRAMLRRRGSAASSSSETITVGPLEVDIP
GRRARVKGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADT
NVVDVFIGYLRRKLEAGGAPRLLHTVRGVGFVLRTQ
333989461YP_004522075.1 hypothetical protein JDM601_0821 [Mycobacterium sp. JDM601]MHGVNCWLMGLSFLLGLTLTFAFAIWRVKREVPTSTPSGGAAVAAAPYGD
GSARAGGGGSGPAGWTIKGNEDSMLYHGLDSPSYEATIAEVWFKDEQTAA
AAGFQRWDSRREQT
333989459YP_004522073.1 outer membrane protein OmpA [Mycobacterium sp. JDM601]MALAAIPLLLALIGLGVADRERIDITAGDATWPEVPVPSLSMPAAPEANT
PGISFAPLSILRNGNVITLNGDLPDVATRTGLIEMLKGLFGSGVQLVDNI
NIKPGVKVPDAAALGSVFKAAVSMPDFKFKISGGTVTLIGTAASGAVKSA
VEAAAKAAWPNLVISNNILVLPDVPEAPGPEVPRPEAPNTPAAPGSPAPK
PVPPSASPAPDPAGDCGKLQADVTALMATPVTFVTNGHTLSPGTRRQLSR
VAETLKGCRSAQVTVSGYTDNTGNDGINVPLSTDRAKAVADFLVAQGVPA
SSVTAKGFGSADPVASNATPDGRAQNRRVAITVS
333989457YP_004522071.1 peptidyl-prolyl cis- trans isomerase [Mycobacterium sp. JDM601]MTKPGKPQITVPAGPPPTELVIEDIVVGDGAEAAPGALVNVHYLGVDYDS
GAEFDSSWNRGEPLEFPLDGLIAGWQDGIPGMKVGGRRQLVIPPELAYGP
AGTGHQLAGKTLVFMIDLLGTR
333989455YP_004522069.1 membrane transport protein [Mycobacterium sp. JDM601]MRLFADTTPLRNPDFRRLWLAGIPTVIGANLTIFAVPVQIYALTGSSAYV
GLSGLFALVPLVVFGLLGGAWADAMDRRKLLIIASCGLAAASLLLWVQAV
LGGDVWVVLSLLAVQQGFYAVNSPTRAAAIPRLVAGGDLPAANSLNMTVM
QFGAIVGPLLAGLLLGWVDLPTLYLVDAVTCVFPIWATFRLAPMPPAGST
DGSRFGVAAVLDGFRYLAGNTVVLMSFVVDLIAMVLGLPRALFPQIAAVD
FGGPVEGGTTMALLAAAMAVGAVAGGVFSGWLPRISRQGLAIVISIVVWG
AAMAGFGLAVARADGHPGPVLWVALGFLAVGGAADMVSAAFRSTMLQQVA
SDEIRGRLQGVFTVIVAGGPRLADTVHGAAGAVVGTAAAAAGGGVLVVVG
VLLAALAAPAFIRYHRPGPAAAR
333989453YP_004522067.1 citrate synthase II CitA [Mycobacterium sp. JDM601]MIAAVPENFVAGLEGTVAFTTEIAEPDKDGGALRYRGVDIEDLAGKVSFG
DVWALLVDGDFTRPLAPAEPLELSVRTGDVRVDAQAGVAMLAPQWGFQPL
LDTDDATARDQLARAAVMVLSYVAQSARGSQPPVSQQTIDGCATITERFM
TRWRGEPDPAHIEAIDAYWVSAAEHGMNASTFTARVIASTGADVGAALSG
AIGAMSGPLHGGAPARVIPMIEEVERSGDARAVVKGILDRKEKLMGFGHR
VYRAEDPRARVLRATAKRLAAPRYEVAAALEQAALDELRERRPDRAIETN
VEFWAAVILDFAEVPPAMMPAMFTCGRTAGWCAHIMEQKRLGKLVRPSAI
YVGPGPRGAESVAGWDRLPKG
333989451YP_004522065.1 hypothetical protein JDM601_0811 [Mycobacterium sp. JDM601]MDVSDDTAYVDMLNTLSEGSVRRHFNPYLDIDWDSPEFKVFDNDPRWILP
ATDPLGKHAWYQAQPEERQIKIGMWRQANVAKVGLHFESILIRGLLNYAF
WVPNGSPEYRYCLHESVEECNHTLMFQEMVNHIGADVPGMPRFLKWLAAF
IPLVAGPLPIPFWFGILAGEEPIDHIQKDILREGKTLHPIMEKVMAIHVA
EEARHISFAHEYLNKRVPNLPRRKRFWLSLFVPVTMRILCSAIVVPPKAF
WQEFDIPRSVRKDVFFGSADARRMLSDMFADVRMLCHDTGLMNPVAKLIW
RMCRINGAPSRFRAQPQRAHLSRVA
333989449YP_004522063.1 hypothetical protein JDM601_0808 [Mycobacterium sp. JDM601]MRELRAIGLDADGKHIICESVGDDDDSTEMFRVRIDDRLRGAVRGEASRV
GQTQIDLGISMLRPKDIQARIRAGASVEQVAAAAGVDVSRVERFAHPVLL
ERSRAAELAAAAHPVLADGPAVPTLLEVVTSALMSRGLNPDQSSWDAWRN
DDGRWTVQLAWKAGRSDNVAHFWFAPGAHGGTVTALDDPAMELIDPDFDR
QLRPVAAVAQLDFEEPAAAPATEEAPAPPRPTARARRSKPAVPGWEDVLL
GVRSSGQR
333989447YP_004522061.1 rRNA methyltransferase [Mycobacterium sp. JDM601]MARVLDVVDIDDPRDSRLDDFRDLNSVDRRPDLPTGKGLVIAEGVLVVQR
MLVSRYSPRALLGTDRRLVELADDLAVVPDVPYYRVSAEVMAEVVGFHLN
RGVLAAASRVPEPTVTDVVADARTIAVLEGVNDHENLGSIFRNGAGLGVD
AVVFGSGCADPLYRRAVRVSMGHALLVPFARSTDWPADLAMLRDRGFRLL
AMTPDPRADALSTAMAKVHDDPVAVLVGAEGPGLSEQAMRASDLRVRIPM
SRGTDSLNVATAAALAFYERTRLPA
333989445YP_004522059.1 hypothetical protein JDM601_0805 [Mycobacterium sp. JDM601]MAAPLLKAEIDIKAPVTEVWNLISDFRRMPEWSPQCRWMKPLGAVRPGTR
TINVNRRGRMFWPTTSVITEYVPDRKLAFRVSENHSVWSYELEPTAEGTR
VTESRHVENGNTTAVSAFLVDKFMGGTPTFERELIEGMNASLQRIKAAAE
NR
333989443YP_004522057.1 hypothetical protein JDM601_0804 [Mycobacterium sp. JDM601]MPAVLAAAVDEARAAVVEFSGADTVGEHLGVDYEDATAATHRFGAVLPGY
QGWQWAVVVAAFPGAAHSTVSEVVLVPGPGALLSPEWVPWDQRVRPGDLG
PGDLLAPPADDPRLVPGYTSSGDPDLDEVAGELGLGRRWLLSPLGRAEAA
QRWHDGDYGPDSAMARSTKRVCRDCGFYLPLAGVLGTGFGVCCNEMSADG
RVVDSGYGCGAHSDTPVPAGTGSPVHDPYDDGVLEIVDDAESADGAEATT
APPAETPAEPADAPAEPVDPADEAPVEAEAPATESAAEPGEPGTG
333989441YP_004522055.1 hypothetical protein JDM601_0801 [Mycobacterium sp. JDM601]MTTVLVTVLVAATAALAGFATWWFSRGGEPTPPQISAYSNGRLTHAGPYM
FCDVLDLNECVLTEAQGTLAVDERNPVQLSVDTVIGRAPWRLLRLYDDPA
DATGKMYQPGSTLAVTIPTVDPHRGPLRGLVVQLLTLVVDRDTDEKFAVP
HAEWAVGLQWRDQRQD
333989439YP_004522053.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MSQQVTEEQARAVAEESRESGWDKPSFAKGLFLGRFPLELIHPFPRPSDD
DAARTEEFLGRLREFLETVDGAVIERDARIPDEYVKGLADLGCFGLKIPG
EYGGLGMSQVAYNRALVMVSSVHPSLGALLSAHQSIGVPEPLKLAGTEEQ
QQKFLPRCAAGAISAFLLTEPDVGSDPARLASTATPIEDGAAYELEGVKL
WTTNGVVADLLVVMARVPKADGHRGGVSAFVVEADSPGITVERRNAFMGL
RGIENGLTRLHAVRVPAENLIGREGDGLKIALTTLNAGRLAIPAMATGSA
KWSLKIAREWSRERVQWGKPVGEHEAVAKKIAFIAATGYALEAVLELSGQ
MADEGRNDIRIEAALAKLWSSEMACVIADELLQIRGGRGYETAESLAARG
ERAVPVEQLVRDLRINRIFEGSSEIMRLLIAREAVDPHLSVAGALANPKA
GLRQKAQSAAGASGFYSKWLPQLVFGEGQRPTGYREFGRLAAHLRFVERH
SRKLARNTFYGMARWQAGLEKKQGFLGRVVDIGAELFAMAAVCVHAEAQR
AADSAEGQQAYQLADAFCQQSRLRVEALFAALWTNTDDTDVALAHAVLED
RCTWLEDGILDPSEGTGPWIAHWEPGASDEPDLARRFAVGSAAPRT
333989437YP_004522051.1 molybdenum cofactor biosynthesis protein A2 MoaA2 [Mycobacterium spMDAIGAEDKTAARQAFHEAVERAIAEQMPTSGPLVDTFGRVHTDLRISLT
DRCNLRCTYCMPAEGLDWIPSQHLLQDDELIRLMRIGVTRLGITDIRFTG
GEPLLARHLEGVIAAAAGLQPRPEIALTTNGLGLARRAGALVAAGLDRIN
VSLDTVDRAHFAEITRRDRLPDVLDGLAAAAQAGMAPIKVNAVLDPKITG
EDIVNLLRFCLQHGYQLRVIEMMPLDADHNWSRDAGLGVEQLLELVQAQF
ALRPDPKPRGSAPAEVWLVDEGPDNPAGTFGIIASVSRPFCGDCDRTRLT
ADGQIRNCLFAAEESDLRALLRDGSDDDAIEQAWRAAMWSKKAGHGINDP
DFIQPDRPMSAIGG
333989435YP_004522049.1 resuscitation-promoting factor RpfA [Mycobacterium sp. JDM601]MSGRHRKPTQSNVNIAKIAFTGAVIGGGSLALAGHAAGATDDEWDRVARC
ESGNNWGINTGNGYHGGLQFSPSTWSSNGGGKYAPVAHQASREQQIAIAE
NVLATQGRGAWPVCGRGLSGPSPRDVPTAPADAPVDHPDANGETVAMDNP
MAPPPAPEPAPWWAPPAPEPAPPAEDAPAVAPAGWLPPAPEAPAPEAPAP
EAPAPIAEDLPPAPEAPAPEAPAPAPEAPAPEAPAPEAPAPIAEDAPPAP
EAPWWMPPAPEAPAPEAPAPEAPAPGDEAVPAPEGDKQQAVSVGFHQQLW
QAIRAENVSGNDALAAFAQQPSRVVV
333989433YP_004522047.1 molybdopterin biosynthesis Mog protein [Mycobacterium sp. JDM601]MSARTAHVIIASTRASAGVYTDRTGPIIAEWLTQRGFAPAQPEVVPDGDA
VGTALRAAVAAPVDLVITSGGTGISPTDDTPAQTAALLDYEIPGLADAIR
RSGLPKVPTAVLSRGVCGVAGRTLIVNLPGSSGGVRDGLGVLADVLDHAL
DQLAGGDHDR
333989431YP_004522045.1 hypothetical protein JDM601_0791 [Mycobacterium sp. JDM601]MAANQDKKNRYVDNGWPETDGEPAVSELRTDRAGALSPFGSLVFPLPSEE
LPYLHPVTVVNR
333989429YP_004522043.1 DNA helicase Ercc3 [Mycobacterium sp. JDM601]MSTDGPLIVQSDKTVLLEVDHEQAGAARAAIAPFAELERAPEHVHTYRIT
PLALWNARAAGHDAEQVVDALVSHSRYAVPQPLLVDIVDTMARYGRLQLV
KSPVHGLTLVSLDRAVLEEVLRNKKIAPMLGARIDDDTVVVHPSERGRVK
QMLLKIGWPAEDLAGYVDGEAHPIALCQDGWQLRDYQEMAADSFWSGGSG
VVVLPCGAGKTLVGAAAMAKAGATTLILVTNTVAGRQWKRELIARTSLTE
EEIGEYSGERKEIRPVTIATYQVITRRTKGEYRHLELFDSRDWGLIIYDE
VHLLPAPVFRMTADLQSRRRLGLTATLIREDGREGDVFSLIGPKRYDAPW
KDIEAQGWIAPAECIEVRVTMTESERMTYAIAEPEERYKLCSTVHSKIAV
VRSILKQHPGEQTLVIGAYLDQLEELGEQLDAPVIQGSTRTAEREKLFDA
FRKGEVSTLVVSKVANFSIDLPEASVAVQVSGTFGSRQEEAQRLGRLLRP
KADGGGAVFYSVVARDSLDAEYAAHRQRFLAEQGYGYIIRDADDLLGPAI
333989427YP_004522041.1 methyltransferase [Mycobacterium sp. JDM601]MYRLGFTPWDGHALARGLRNLVELDAGVGLAPGTALDLGCGTGDNSIYLA
QNGWRVTGVDFAQRALRAAHAKAQAGKVSVRFVCADIAQLASAGLDDDFA
LVTDSGCLHGMSDHDRSIYARQVNAVTGPDSRLLIVAFTPGALFGVRGID
EAEITRLFAPQWELISSGDEPHYVPANGGQPVRHYLLARRA
333989425YP_004522039.1 fatty oxidation protein FadB [Mycobacterium sp. JDM601]MAENTIQWDKDADGIVTLTLDDPTGSANVMNEHYRESMHNAVERLVAEKD
SVTGVVITSAKKTFFAGGDLKAMIHVGPDDAQAVFEQCEGIKADLRALET
LGKPVVAAINGAALGGGLEIALACHRRIAADAKGSQLGLPEVTLGLLPGG
GGVARTVRMLGIQNAFMNVLAQGTRFKPAKAKEIGLVDEVLPTVEELVPR
AKAWIKEELKADPDRVFAQPWDVKGYKMPGGTPSTPSLAAILPSFPALLR
KQLKGAPMPAPRAILSAAVEGAAVDFDTASRIETRYFVSLVTGHVAKNMI
QAFFFDLQHINGGGSRPDGIGQTPIRKIGVLGAGMMGAGIAYVSAKAGYD
VVLKDVSLEAAQKGKGYSEKLEAKAVERGRTTAEKSSEVLNRITPTGDAA
DLKGVDFVIEAVFESQDLKHKVFAEIEDIVEPNALLGSNTSTLPITGLAT
GVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEALARVFDYVLAIKKTP
IVVNDSRGFYTSRVIGTFVNEALMMLGEGVEPASIEQAGLQAGYPAAPLQ
LCDELNLELMQKIANATREGIEAAGGTLERQRNEEVVDKMIEIGRPSRLS
GAGFYEYVDGKRTGLWPGLRETFNSGSATPPLQDMIDRMLFAEALETQKC
LDEGVLTSTADANIGAIMGIGFPPWTGGTHQFIVGYPGGQAGFVARAKEL
AGKYGDRFNPPQSLL
333989423YP_004522037.1 aminotransferase [Mycobacterium sp. JDM601]MTVSRLRPYATTIFAEMSALATRIGAVNLGQGFPDEDGPPAMLEAARAAI
ADGVNQYPPGPGIAALREAVAGQRKRHFGIDYDPDTEVLVTVGATEAIAA
AVFGLVEPGSEVLLVEPFYDSYSPVVAMAGARRVSVPLVPDGRGFALDVD
RLRRAVTPATRALIVNSPHNPTGTVFTESELAAIARIAVEADLLVIADEV
YEHLVFAGRAHLPLAGFEGMAQRTVTISSAAKMFNCTGWKIGWACGPAEL
LAGVRAAKQYLSYVGGAPFQPAVALALNTEDAWVAGLRATMQARRDRLAA
GLAGVGFEVHDSFGTYFLCADPRPLGYDDSTAFCAELPHRAAVAAIPLSA
FCLPPGEATAPDVWNHLVRFTFVKREDTLDEALRRLEVLREGRVTAR
333989421YP_004522035.1 hypothetical protein JDM601_0781 [Mycobacterium sp. JDM601]MVIEASPEEIFDVLADVESVPSWSPQYQSAEVLDTHDDGRPRRVRMRIKA
AGLTDEQVVEYSWTADSVGWTLVSAGQLKAQDAKYTLTPQGEATKVRFDM
AVDPSIPIPGFLLKNTLKGGMKTATDGLRTQVLKVKKGR
333989419YP_004522033.1 protease [Mycobacterium sp. JDM601]MAVAALIASIGGPVPAAAGDQILLGGGAAIVLNDDTLCTLTAIGHDSAGR
LIGFTSAHCGGPGSPVAAEGAEERGVVGTVVAADDALVYAVIDFEPAKVK
PIADYEGFGIFGLWPPEPEPAGPEPAEPEPAGSEPAGAAPASPEPAEPAP
AGPEPAAPEPVPAKQACKLGRGSGLNCFDVVPAGLDSVGEKWWQPGDDGS
PITIDNLLVGMVRDGSTPVAPLDQSGPGVVTFKEILDDVNAKGGPGAGFG
LG
333989417YP_004522031.1 hypothetical protein JDM601_0777 [Mycobacterium sp. JDM601]MGSAFAGALAAAMLCGSAGTAAAAPAGCTAADLARVSASVATDTETYLTA
HSDVNEFFTSLKTMPAEQVQSSVESYMDSHPQVHDDLKKIRQPRNDLQKR
CNWSSDELPD
333989415YP_004522029.1 hypothetical protein JDM601_0775 [Mycobacterium sp. JDM601]MPSITGSTGGHDNRHGSAVHRLASHHPNGQPEHGRSRGRREAASARGRQA
AGRDSRPGGGSGGGRVPAGTPGLVICPKSVRDDAEDDAGADWSVADALRL
RFPRPEMVTSAAALFEPAAPWAEGRDRRGVEPESGRFRITVGPGVVRLSW
ANPVRAERSAEREVNRRQFDVAVEQDRIKSGRDEADPPGRSITEWSRKSR
SAMCRTFAELDYSPLVESGRVPAMITLTYPGDWEVVAPDGASVKRHIVLW
RKRFHREYGEPARYIWKLEFQRRGAPHIHLWMAPPMSPGRSGRGFAQWLS
VTWAQVVDHPDPVQKARHRLAGTAVDVRNGLKACDPKRLAIYFTKHSSPS
LHGDKEYQHIVPELWRRPGRGPGRFWGVYGLMKASAIVDVTQDAYVNARR
IVRRWSRNQAVYGDSTSQFPTTVVPRTAVRLVPRVHRDTGAVEHRRVRRR
RTLCNQGGLAGGYALVNDGPNFAAQLARAIS
333989413YP_004522027.1 hypothetical protein JDM601_0773 [Mycobacterium sp. JDM601]MRKYRTDEASDGADQVVGDLTHTFTPTRGEKYLPRKVWEGLRDRRINRAK
FLGFDEGTELDEVDVTVTDGTQSKTFELGNEKTPNLNLVLTTSGQVAPNS
TKVLHTALDEAAEIFKNYRIEWSEADAIKRAISSR
333989411YP_004522025.1 transposase ISMyma01_aa1-like protein [Mycobacterium sp. JDM601]MASKKRRRHTPDQIIRKLAEGNKLLGTGQELSEVCRHLEITESTWHRWVA
QYGGMKASDAKRLKELEAENARLKKLVANQALDIDMLKEISEGNF
333989409YP_004522023.1 hypothetical protein JDM601_0769 [Mycobacterium sp. JDM601]MQLTADKVVAWNEPSAPAGVKTEKVYLGPDPFGLGGFQVAVATAATAPSR
QVLRDLFTARKGKTQIQLVVAVVDDATVHLFGPDPQALPVEFPIERAQRQ
LQSVLAEPDVLAATERFAGLRKASDSTGVPGFTNSGLFATHHVTSNVPKW
ADWDALGNQALPLLAIRRKQLIELLGFTTQAGPNGTLLLSIDGHPPRAVA
VLLDDAEQFDAKTQRFQLSPVAFGLAVAARQEVPWLVVLRKDQIRLYPGR
DGVGVGSKGQAETYFEVDLSTIDAEYAALLPLIFSASALSAGGTADELLR
DSARYATELGARLRERIYDEVVPPVAIEVAQRLAKHAGVKLDADGLATAY
RVTLRILFRLLFQAYAEDRGLLPSGRNEGFDANSLKTNARRLLDSDTEEF
GDASTIWYDLVQVWNAINQGNPQWQVPSYNGGLFSTDPERSPEGALIKTI
ELPDRVLGPALKSLLIDVNDDGVPGPVDFRSLSVREFGTIYEGLLESALS
LAEQDLTVDSSGAWVPAGDGDEVCARSGSVYFHTASGERKATGSYFTPKV
VVDHLIERSIVPALAAHLQKIAGYLSKGEAAAAAREFFDFRVADLAMGSG
HFLVAAVDKIEALMRTFLTEHTVPGVTEELLRMAGVAKEALGSDDVAKSE
VDEVGLLRRQVARRCIYGLDINPMAVELARLALWIHTFVPGLPMSNLDHG
LANANSLTGIGTIDEALDALQPNRRPGELSLFDSTLTDQLASAKTLLVDV
ANASEANKAEIDEGARLLAQARDAADTARRIFDAAIAVRMGTLAPNTVFD
EDSLLQMLARPEVAEARERLQPGHLPYLFPEVFLRDSPGFDAVIGNPPW
333989407YP_004522021.1 hypothetical protein JDM601_0767 [Mycobacterium sp. JDM601]MFWGIACGFGPAIAEGLVHLIGIDLKYGIEVSTGARLFTTIATTEANAVK
TLVAVETLMDKRGTQTKTRQYTATQSMPLIVLMIDELAGLTAYMSDPALR
KEANASLSRILSKGRGLGIVVAAFVQDPRKEVIPMRGLFTQTIALRLRSR
EEVTMVLGDGMADRAPAHRVSPDAPGTGYVVAEDGQVTKVRSDFWTDDQI
SSTAKKYGRTRAPKEGQRHE
333989405YP_004522019.1 prophage integrase [Mycobacterium sp. JDM601]MAGNTPRGIRKRLNAAGEPRYQVRYLVRDPAAPSGWVETSATFPTLREAK
AFKSERDNEAALGARRFDPRLGRTPLNRVWTQFSGSKKPAVSPKTWSGYT
QHWELRIAPRFGHIPVDEITRANIQAFVDELTVGPWAKVSTLRLLRSILD
VAHQDGRIHRNPALGVSAGRIPERERHRYLTAQEVQTLAAACGDQGDVVT
ILAYTGLRWSELVGLRVKDIDLTARRLYVRRAAPEVEGRIVIGPPKTRAG
IRTVPLPQVVVDILKTRIGGRAPDEPAVTSPNGALLRSNNWRRHTHWNKA
LKKTGLAPLTIHELRHTYASLARKSGADLRYVQKTMGHSTPTVTANIYSD
LYADELDQVATNLDQLHTTEVQTPKTGQEPDESNRPTSA
333989403YP_004522017.1 hypothetical protein JDM601_0763 [Mycobacterium sp. JDM601]MIEAKRNYRTLQLAEHVRKILDMAPPLTCDQRDWLATLCKTYTPQGEAAS
WTGGQDEAVA
333989401YP_004522015.1 gp49 [Mycobacterium sp. JDM601]MLGTSEFVWPTTNKIYRSRSTAKKRAELIESFGATAAIERSSKITWPHA
333989399YP_004522013.1 hypothetical protein JDM601_0759 [Mycobacterium sp. JDM601]MSQTERRTDLRLSTLAEYLTALGGRAELTITVGENTYTYDLSEKESR
333989397YP_004522011.1 helicase [Mycobacterium sp. JDM601]MTGQPAHARLEDLQPDVRVSGLLPQPVTVVGVRQDGPDAITVTYEDADGG
LGRRVLYRSDEARLGIVSEQARWSFDADPVEFRLAAEALRIRMAGLHDPM
VAVSTSAIDPLPHQIKAVYGELLPRTPLRFLLADDPGAGKTIMAGLYARE
LMLRGDLTRMLIIAPGGLVEQWQDELAAKFGLQAELLSRDMIASLVDANP
FTRYPLLIARMDQLARNDNLLTLLDDSEWDLVVVDEAHRMSAHYYSGELD
TTRRYQLGQLLDHITRHLLLMTATPHAGSESSFQAFLALLDPDRFEGEYR
SGAHSTDTSGLMRRMVKEELLTFEGKPLFPERIAQTVPYELSTAEMDLYE
EVTRYVREEMNRAERLGSDNPRARTVGFALTVLQRRLASSTHAIYRSLER
RRNRLEAKRKEMLDPTYSAVEDDLASLNTFTPLDDPDELDAEETEELEEQ
VVDAATAAQTVAELEVEIKQLEVLIGLARRVRDSGEDRKWSELRTLLLDD
ADLRAADGRVDKLIIFTEHRDTLDYLTVQIRNVLGREDAVVTIHGGTNRA
NRRVIREAFTHHMDVRVLVATDAAGEGLNLQAAHLMINYDLPWNPNRIEQ
RFGRIHRIGQKHVCRLWNLVAAETREGQVFTRLLEKMEVQRAAYGGRLFD
VLGDAFNDRSLRELLMEAIRYGNDPARMAELNRVVDAEVAKGCHDLIAER
ALAKESLSAQQLDEMRRRMDDARARRLQPHFVEGFFTDAFKRLGGSLRRR
EKDRFEISNVPATIRHRQRPGAAIPIATRYERVTFEPTAVEGTDDGRRAE
LLAPGHPLLDTVLDATLEEHRGALESGVVLFDPNDPSSQARLVVALTAEI
IDGAGTTVSKRFEFVSLTSTGGAAVSGPAPYLDLQPLPADAHAVAKQALA
GAWLTGGVEQIAASWAISQAQPQHLEEVRARVVPLVDKTREAVRARLTQQ
INYLYAEAARLRDQHTAGGRHRKPRQSPDRLEARAQDLEVRLTQRLAACE
AEAQLSAGPPRVVGAALVIPAGMIGGQVATHAKDTAAVERRAVDAVLAAE
HALGRTPEEMPHNNTGYDIRSTTHDGSTVFIEVKGRIHGAKDVTITRSEV
LLGKNVPEAHRLALVDVHPDGPEHDQVRYLAEHFRGISVGGLDVTDVRLD
WAKTWAKGTPPC
333989395YP_004522009.1 hypothetical protein JDM601_0755 [Mycobacterium sp. JDM601]MAQLSNRNRVRRALELLGQNLDPFITAATRDKLGDKHWTLLLAAKDTGKG
AGSDKKYNPVDPQNGLRMLTENITSRAISGWYPFDQLLSRAEQSLASELR
DIRDREAHHEPFSADDAYRALDTSERMLRAIGAVEAADEVKNSRIDLRRL
SSEQEDRRVVKATGATEVGSAGLLPWREVLRPHDDVAKGNFRAAEFAADL
AMVARGEGDAEYTDPVEFFRRTFLTTGLRDLIARAVKRIGGDMNAAPVIN
LQTNFGGGKTHSMLALWHLASGRPLADYPQDVQDLLSGAKLDRDIRRVAL
VGNHIQPTGLIKDDGTKVNTLWGELAWQLGGRAAYDIVAASDQASTNPGD
SLRELLAAYSPAVVLIDEWVAYARQLYGRDDLAGGTFDTQFTFAQLLTEA
AKAVPGVLVVISIPASVRDDDGQTEISEEEVGGENGREALRRLQNVVRRV
ADQWRAASAEESFEIVRRRLFITPDGQALAQIGATSKAMVEFYRKHHGEF
PREVTENDYLDRLKATYPVHPELFDRLYQDWSTLERFQRTRGVLRLMNTI
VGTLWRRGDTAPLIMPGSVPLEEQEVMTEITQYLEDQWKVIIDTDVDGPN
ATPAQIDAASPDLLGKRFVTERLARTVFMGATPTLRSAHKGIDKSRVFLG
TALPGDVPGNFHSALNQLADRATYFYTSGAQYWFDTQANTTRTARDYAER
LHDEDVWAEIVHRLQTHRSPSRDGFAAVHIAPDNAADVPDTQEARLVIVP
PSHAYDRKQGVESPAVAWASAVLERRGSGARSFRNMLVFLAADSARYAEL
QASVRDYLAWKYVRENADGALGLTAQQRNQAQDRLDKADRATADRLLGAY
HWALVPEQPDPTRPLHLDAVKAEGSDTNLAERTAKRLVNNSQLTTRYGSN
NVRLDLDASLRSVWERDGHISLADLWGFYATYPYLARLRDRTVLEDAVLS
ALHSLIDWEHQGFALATSITEGTYRGLVLPGDSAAPPATVDSLLIVRPGP
ASQQRERELEEQRKREGERHEGSDGHGGDDDGSGGSGGTGEHGGHDGGGP
PPPPPPPPTPMNTRFFGTATLNPQFYARDFNKITQEVIQHLAAAPGVELE
VRLEITAKTPDGFDDSRVRTVTENATTLKFDQSGFEQD
333989393YP_004522007.1 site-specific recombinase PinR [Mycobacterium sp. JDM601]MAVIGYARVSTIDQDPQLQLDALKEAGAARIFTDHGVSGSTAQRPELDAC
LDHLREGDVLTVWKLDRLGRNTRHVLEVVEQLTSQGIGFRSLTEGLHTDG
PMGKAMLTIMAAFAQLERETMLERTRAGLAAAAANGRKGGRPRKATTADV
AKARHLRGKGIAVDDIANVLKVSRATVYRYLAEDAA
333989391YP_004522005.1 hypothetical protein JDM601_0751 [Mycobacterium sp. JDM601]MTAEKGWIGEPQPPKQWHESRASAARRWVQDEQRRRQERGDYSPVTVEW
333989389YP_004522003.1 O-methyltransferase [Mycobacterium sp. JDM601]MTRTDSDSWDLASSVGATATMVAAQRALATAGPDKLINDPFAAPLVRAVG
IDFFTRLIDGDVALPEGDDFDPVRMGHGMGIRTRFFDQHFLAGTQSGIRQ
AVILAAGLDSRAYRLDWPAGTVVYEVDLPAVIDFKSNTLAELGAEPTAQR
RTVAVDLRDDWPAALKAAGFDPQAPTVWSAEGLLVYLQPEAQDTLFDTIT
ALSAPGSRLACEFIQDTTVFAGPEWREHREKLQSVGCEVEIGELIYHGER
NHVVDYLTQAGWTVSGREVRDLYTEAGLEYGDDALAVAFGDLTYLSAVLP
GAEV
333989387YP_004522001.1 hypothetical protein JDM601_0747 [Mycobacterium sp. JDM601]MGGAAWGASGLAWLTGQPDGPPDFSRAAVLQHATRVLGRFTTATGVAVDA
ATLLAGRAGLLGFSRAGRVSAGGASRLLAAADGWWAITLSRADDVDAVPA
LIEADCPEPWTAVAGWASQRPVAEVVERARLLDLPAAALGESAAATPSIR
RAGPRGPARDAHGALVVDLTSLWAGPLCGQLLTQAGATVIKVENPSRPDG
TRRGPKAFFDWMNSGKLSCTADFDRDTDFLARLLDAADVVLEGSRPAALA
RRGLGPFDVAGRPGRVWLQITAHGGEAPGSYGGPSFASPSSSLAEPPGLC
GGPGFASPPPARGPTPPSLAEPPGFGDDTAVAGGLVGRDGAADPVFCGDA
IADPLTGIEAAVAVLDSLAGGGGEVITLSLAAVAARYAALPLHPVGDYPV
SLPARPHIVGTGPRLGADNARVGELVNAASRC
333989385YP_004521999.1 long-chain-fatty-acid-CoA ligase [Mycobacterium sp. JDM601]MSISLLLEMAVSADPDRVAVVCESTRYTTAELNALADAGAGVINETGARS
VAYIGMGGDMLPLLLFSAARAGRPFAPLNYRLSGPALRELIGRLPQPLVV
VDKEYLDLIGDLGVAQIDSATFCARARTTTPEVQWPDPDDVAVVLFTSGT
TSAPKAVELTHNNLTSYITQTVEFGSAGPEDAALICVPPYHIAGVGAALS
NLYAGRKSVYLRRFSPAEWIRLVKDEAVTTATVVPTMLERIVSELEAHPA
PLPTLRNLAYGGSKVALPLVRRALDLLPDVGFVNAYGLTETSSTVAVLTP
DDHRTAYAATDEAVRKRLGSVGRPVPGIEVVIRDDEGRPVAAGEPGELFL
RGEQVSGTYTGMGSVLDADGWFPTRDLAVLDDEGYLYIVGRSDDTIIRGG
ENIAPAEIEDVLVEHPQVREVAVVGAPDPEWGQIIVACVVAAPGASPEPE
ALREYVREQLRGSRTPDRIVFRSELPTTPTGKVLRRELLDDL
333989383YP_004521997.1 DoxX family protein [Mycobacterium sp. JDM601]MTAYGVGLLIVRLCLGLTMAAHGYNKIFSGGRIPGTARWFDSIGMRPGLF
HARVAAGTEIAAGLGLAAGLLTPIPAAGFVALMLVAAWTVHRDNGFFIVK
SGWEYNLVLAAVAVGIAMLGAGPLSLDHLLFGQNWCDGWTGLLIAAGLGL
AGGIGQLLVFYRPVRERA
333989381YP_004521995.1 hypothetical protein JDM601_0741 [Mycobacterium sp. JDM601]MTPDPDMRYRFDIVGHSVVDIVTAAGGWLYDRATAGWDVSVMMLDAFEGT
DTRPLQILGARVLDLASVLTHWEQWPHPQTIAVCAEMFDGHARVRQGVLD
ALEHSSTEVTLWGDVPAELDRDVDTRQHRLSAAARAFKAQALRAAGIDPK
GVAGSGHVEMFRCGPACASVAADLSPAS
333989379YP_004521993.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MQRVLFTEDHEAFRALARDFVEKNVVPEYPNWEKAGRMPRAVFEQLGSLG
MLGMAIPEEYGGAGIDDYRYNVVLQEEAARALVTLSTVRTQLEVILPYFL
HYANDEQRARWFPGLAAGKLLTAIAMTEPGTGSDLAGMRTTAVRDGDDYI
LNGAKTFITGGIQADLVIVVARTATDPDNRRAGLTLLVVEDGMPGFARGR
ELDKMGCKVQDTAELSFTDVRVPMANRLGADGEAFSYLGHNLAQERLTVA
VGSVAQSRSALAATIDYVKNRNVFGSPVASFQNTKFELAAVSTEIEAAQC
MLDRAVIEHVDGTLSGADAARVKLFCTEMQARVIDRCLQLFGGYGYMMEY
PIARLYTDARVARIYAGTSEVMKMIIAKSLGL
333989377YP_004521991.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MTPDTDVLLRTDRDGVRTLILNRPARKNAINPQLWRALRDALRDAADDRD
LRALVITGAGGAFCSGADIGTGDDTHPVYKLQRLTDVALALHELAIPTIA
KVTGVAVGAGWNLALGCDLVVATPESTFCQIFSKRGLSIDLAGSWLLPKI
VGLQQAKRLALLAETIDATEAQALNLVTWVIGAGEIDGFVDDLADRLAAG
PPRALAQTKMLLNQGADCTLPEALLNESRAQLVNFAGTDAAEAYAAFAER
RTPRFTGGWPAK
333989375YP_004521989.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MPEGMSFELTEDQQLIRQSVAELASKFDDHYWMSKDQAHEFPQEFYDAIA
GGGWLGMTIPEAYGGHGLGITEATILAEEVARSGGGMNAASAIHMSIFGM
QPVVVFGSDEMKAETLPRIVSGDLHVCFGVTEPTAGLDTSRITTFAKRDG
SDYVVNGRKVWISKAIESEKILLLTRTESRDDVEKRGGKPTEGLTLFLTD
IDRDHIDIRPIPKMGRNAVSSNEVFIDDLRVPAEHRIGEEGKGFSYILHG
LNPERMLIAAEALGIGRVALDRAVKYANERVVFDRPIGMNQGIQFPLADS
LARLDAAELILRKATWLYDNGKSCGREANMAKYLCADAGFAAADRALQTH
GGMGYSEEYNISRFFRESRLMKIAPVSQEMILNFLGSHVLGMPRSY
333989373YP_004521987.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MTTTDFAELHDDLRAVAADVLGRGRAVDWPTIADAGWVGLEVPEAFGGAG
ATFAEVAVVCEELGRAAVAADYLGSAVLTVGVLNTLQHSAVRDRLLTDVT
AGTTRAATVMGDFTLAADGRLSGRADFVPDADGADLLLVLATDHTGAEVA
VATDLLAVTAQPVLDQTRRVATVTAEGVQVAEPLSFTGNPRSVQNRAAVA
VACDSLGLAEAMLAATVSYAQTRHQFGRPIGSFQAVKHACADMLVTVSVA
RALVREAVDAVATTGFGGSEADVAVAMAKSYACGGAVEVVGKALQLHGGI
GYTWESGIHVYLKRAVFNRSLFGSPAAHRRHLAQRY
333989371YP_004521985.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MILELGADAEEYGRAALRAFDAAGGDELAVRADADPAVRDELVAPVLRGL
GAFDLKPRADADELEAAAALCRSAGYWALPYPVAECLSVPADLDDLDVHG
LIVVADHAPAGAVAGLSKRWAAVTAAGVRSMAVAHPAAGPGLVAELTLTE
IDTEGADDVALALALGCWTLLGMLDRALDLTKDHVRLREQFGQPLAKFQG
VQFQLTDAEVERAGLDMLAKYALWSTATARPEAVDDALALRSAALEAADV
VFRVCHQLHGAVGFCDETALSWLSRYSQPLRRLPWGLSATRQLLVERAGR
TGLTGLYA
333989369YP_004521983.1 hypothetical protein JDM601_0729 [Mycobacterium sp. JDM601]MVDLTTMVMGPYCTQIMADMGADVIKVEPPEGDATRYISAGPAPDMSGVF
VNVNRGKRGIVLDLRTDEGKAAMTALIAGADVFIHSMRAKAITKLGLDYG
AVAAINPAIVYTNCYGYGRRGPDGDRPAYDDTIQAECGLPAVQQQLTGRA
DYVGTIMADKIAGLTALYATMMALFHRERTGQGQEVEVAMFETMASFMLV
EHANGAMFDPPLGPAVYPRTVAPNRRPYQTSDGQIAALIYNDKHWNAFIN
AVQPAWASQQFATLAQRAQQIDTVYGLLAETMTERSTAEWLKLLHELEIP
AAPLNTPGDLFDDPHLNAVGLFETVDTPAGPVRFPGVPTWLSRTPGRVAG
PAPELGAHTAAVLAELGLGGGPA
333989367YP_004521981.1 NHL repeat-containing protein [Mycobacterium sp. JDM601]MERVTAPSRLFGANGLRTGPDGRVYVAQVTGSQISALDVSTGELAVISAR
GGDVVAPDDVAFDSAGTLYATEVMDARVSALDNGRARVLRDDLPCANGIT
VHQDRLFVGECRDGGRLMELDRATGAQRILAENLPSPNAMEVGPDGLLYF
PVMTANEIWRIDPLATEALPQRVAGDLGVPDSVKFDADGFIVSTQAASGQ
VLRIDPRTGDHTVLAQLSPGLDNCTFVGERLLVSNFSGEIAEITGGAVTT
VLPGGLNWPLDLTIDATGTLHVADGTYFYAVGDDRRLQTLGMLFSPGYPG
FIRGVTAVGAGEFVVTTSGGQVSRYLPAQSAGEVLADGFDQLYGVTAGPA
GVVVTEFGTGRVLRVGAGETEVLAAGLAGPVGIAAVGDGSHLVAESGAGR
VVRVGASGTATVVDGLARPQGILPADGRLYIVDAGNREVLAVDLATGSRH
TIAAGLPIGPPPGVVPKPLRGMPPFSGPQGPFAGIARGPDGTLFVAADGE
GSVLALHPVGP
333989365YP_004521979.1 acyl-CoA synthetase [Mycobacterium sp. JDM601]MRLHTLADALAQETDRAPDRVLLIDGDTRLTCRELHSAAHALAGAMSEKM
PAGSVVSFMLPNWHEAAVVYLAAALAQMVVNPILPSLRDAELTFILSDSG
SRMLFAPQRFRGHDYAAMLARVTAALAEPPEVVLVRASGPSAGTDYRALT
DHPRAVSPTPVDPDAVLLLLYTSGTTGRAKGVLHSHNSINALIAQLGRHW
LIQTGTTFLVPSPIAHIGGSIYAFEAPLLLGTTAVLMDTWDADAAVALML
AEHCTHVAGATPFLAQLLAAARRAGTRLPDLKLFVCGGAAVPASLIREAA
DYFGTAAVTRVYGSSEVPVTTVGAVGAHERAYAADTDGRAGIADIKLVAH
RGAPDGEGEIYVRGPQMLVGYRRSEDAQGCFDAEGYFATGDLGRWVDDEY
LLVTGRLKDVIIRNGENISAREVEDILVSHPGIAEIAVVGVPDERTGERA
CAVIVPAGGTGPDVAELRELLTAQGVAVFKAPEQVEIWDELPKNDAGKVV
KQRIRAVLARPEVGD
333989363YP_004521977.1 fatty-acid-CoA synthase [Mycobacterium sp. JDM601]MNLFTLLDQAAARFGERGAVYHGERLLHTWRELADRALRLAASLRRVGGP
GARIVIASENRPEIIELMFATWAADCVVVPLNYKLHPREMAQIISDAGAD
LVFASPTLAAGLTGAVPIRIEIIGSAAYLERFQTEPAAPPDPDPSRLAWL
FYTSGTTGRSKGAMLTHRNLVAMTVAHLADLDDPDADCSLIHGAPMSHGS
GLYIAPYLLRGARQVVPASGSFDADEFLDLCGHHPGATAFLAPTMVARLL
ATGRDRPPNLRTIIYGGGPMYLGDLKRALAAFGPVFAQLYGQGEAPMTIT
GLSRADHDSGDDAMLASVGYPRSGVEVSVLRDDGTSAPVGEVGEIVCRGD
VVMGGYWNDPEATAATIRDGWLFTGDKGCFDERGFLTLRDRSKDVVISGG
SNVYPREVEEALLDHPGVVEAGVVGAPDAEWGEIVVAFIVGEASAAELDA
HLLERIARFKRPKRYEFVAALPKNSYGKVLKRELRSLAGDMATLPGN
333989361YP_004521975.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MYIDYEVADRIATITLNRPEAANAQNPELLDELDAAWTRAADDDDVAVIV
LRANGKHFSAGHDLKGGGPVPDKITLEFIYKHECKRYLEYTLRWRNVPKP
SIAAVQGRCISGGLMLCWPCDLIIAADDAQFSDPVVLMGIGGVEYHGHTW
ELGPRKAKEILFTGRAMTAQEVEQTGMVNKVVPRDELDAETRRLAEHIAT
MPSFALRQAKRAVNQTLDVQGFYSAVQSAFDIHETGHGNALSVCGWPVLV
NLDEMKSQVK
333989359YP_004521973.1 hypothetical protein JDM601_0719 [Mycobacterium sp. JDM601]MRKVLAPEVTNWPDENLALVGSQCDDCEATVWPRQDHCPRCSGPRMQDLL
LPRQGTLEAWTTQGFVPKLPYAGGETAESFTPFGVGLIRLGDVIQVEARL
TESDPAKLKFGMDVELTMVPFYVDDDGTEILTWAFQPV
333989357YP_004521971.1 hypothetical protein JDM601_0717 [Mycobacterium sp. JDM601]MAVAIQIKDVPEEVRDALAARAEARGQSTQAYLRSLLEREYQAQRNRQLL
EALARHRSLTMTAEEVATVIHADRDG
333989355YP_004521969.1 acyl-CoA transferase [Mycobacterium sp. JDM601]MSGPLSGIRILEVGVMLAGPYATMLLADLGAEVIKIEPPSGEISRQVGPS
YFASLNRNKRSVRLDLTTDAGQARLGELAAESHALLVNMKPSVIKRLGLT
YSALSRFNPKIVCVALTGFGLDGGDEPAFDYVIQAATGIAAMTGDPNGPP
TLPGYSSADNSTGLAAALGLLAQIVSGRGGQVEVSLLDVMLSQLNYRASA
YLNDGVEPQRHPHGAHSYYVPAQLFPTAAGYLALFVTHDGFWKSFATEAG
IDGFATMEERASRRSEVLAVVTAALAGDTAAGWERRLRPLGIPAAAVRTM
PEALKEYHHAIVTAGDFRLVGSPIRVAGYEPAYRPPPALD
333989353YP_004521967.1 methylmalonyl-CoA mutase subunit alpha [Mycobacterium sp. JDM601]MPQRVLVAKPGLDGHDRGAKIVARTLRDAGFEVIYTGIRQRVEDIVATAL
QEDVAVVGLSILSGAHVALTARIVEALRAADGGDIAVVVGGTIPQSDVDK
LLSLGAAAVFPTGTSLDELVTGVRQVIGHMEAS
333989351YP_004521965.1 hypothetical protein JDM601_0711 [Mycobacterium sp. JDM601]MALRALQAVYPGVTRQVRRPIAALSRLGDHTLFYGRAIATAPFAFTHYRR
EVVRLIAEISMGTGTLAMIGGTVVIVGFLTLAAGGTLAVQGYSSLGNIGI
EALTGFLAAFINVRISAPVVAGIGLAATFGAGVTAQLGAMRINEEIDALE
SMAIRPIAYLVSTRIVAGLVAITPLYSIAVILSFIASRFTTVFLFGQSAG
LYDHYFRTFLNPIDLLWSFLQAFLMAVTILLIHTYFGYFAAGGPAGVGVA
VGNAVRTSLVVVVSVTLLVSLSVYGASGNFNLAG
333989349YP_004521963.1 enoyl-CoA hydratase [Mycobacterium sp. JDM601]MGAAGQGPSGPPEGDWLGTPFLSFRREGPIAVCTLDRPEARNAMTPAMYF
GIRYAVGRVNEDPELAGLLITGTGDVFAPGGDMGGGGADDWITFGSALGM
DVTPFDAVRTSVKPVVAAVNGLCQGGGLQIALCSDVAVVSDRATFRVPEL
FRGIADTYYSQMLARVIGPVRTRDLMFTGRTFGAQEALDWGMVARVVPHD
DLLGAARDVLAQCCRTAPAARAVVKASLDSYIGLFDRIGMSTSLRAPEAV
EGFRSFKERRSPDWVHPDLRVDGRL
333989347YP_004521961.1 propionyl-CoA carboxylase subunit beta [Mycobacterium sp. JDM601]MTNAQGWQETLEDLDRRRQHTHAMGGSERVAKHRGKGKLDARARIGRLLD
PGTFRELGTMVGGEIAADGIVVGSGEINGSPVMVGAEDFTTLAGSIGPGG
NAKRYRIAELALRDKIPLVMLLEGAGFRPTGEHYGRTPTDLLAQAQCSGK
VPTVAAVLGPSAGHGALVGPVCDFRIMSPHGAIFTAGPPVVKESTGEEIS
KEELGGPDVALTSGVIHNFADDDAAVLDDIRRYLSYFPSSAWSYPAPLPD
EAAGHARPTPELLDIVSRDNRRVYDMRAVLDVIFDTPDWFEVQPRFGQAI
ICALAHLGGHPVAVVANQPKVLAGSIDADAADKAAHFITVADSFHLPIVF
LADNPGMLPGSRSERSGVLRAGARMFAAQTAATTLKLHLTLRKAYGFGSM
VMSLLGFDSQVATFAYPGATMGAMSAAALSSATHAGQDLAAKLRDTELQA
SYHSAKQLGFDELIDPRETRDALLSALRRGLCSRQAAAEPVTRTVIMP
333989345YP_004521959.1 quinone oxidoreductase [Mycobacterium sp. JDM601]MVVRVRAAAVNFPDVLLIDGKYQLKIPTPFTPGSELAGDVIAAGDGVPFG
PGDRVVGTSFVGAFAEQALLPAASVTAIPDGIDYAAAAGFGVTYRTAYHA
LRSIAQVSQGDWVVVLGAAGGVGLAAVELGVALGARVLAAASSPEKLAVC
TERGAEAVIDYDREDLKARIREITGTGAQAVLDPVGGRYAEPALRSLARG
GRFVTLGYAAGSIPAIPLNLVMLKGITVQGMEIRTFADDHPDDNERDLAE
LAELFAGGRVSPYIGARFPLAETAAALRYVADRKAIGKVIIDV
333989343YP_004521957.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MAWDFSTEPEFEAKLDWIREFVRDEVEPLEVLFPGCEYLPLNDERRLIVD
PLKDRVRAQGLWAPHLGPELGGQGFGAVKLTLINEILGRSSWAPIVFGTQ
APDTGNAEILARFGTAEQKDEYLAGLLSGEIFSCFSMTEPQGGADPRVFT
TKAVRDGDEWVITGRKYFSSNASVASFFIVVAITDPDVPVHRGASTFLIP
AGTPGLVVEATHHLVGSYPHEAGHSLVRYDDVRVPAEAILGEPGQGFLIL
QNRLAGGRLHHAMRSIGVAQRAIDMMARRAKSRFTQGSSLADKQLVQEFI
ADSYAELVPFRLTVLHAAWLIDTAGEHAARAEIGVCKILASQVLKSIGLR
AIQVHGAMGLTEQLPLVNVLLGGVALGLADGPTEAHKVNLARLLLKGYEA
EDPEWPSEFLDNRIEAARAKYGDLVDRIPAVP
333989341YP_004521955.1 hypothetical protein JDM601_0701 [Mycobacterium sp. JDM601]MRPMDAGQGTRLDAVALGRWLDVNGAPGDGEAPTLEPLTGGSQNTLYRLR
RADATMVLRMPGARADTARIDGLRREIRLVRALAGTDVPRAQLIAADEVG
ELLGLPFYVMAEVDGWNSTGNAWPAPFDEDLSARRGLAFELVEGAAKLGR
VDWRARGLEGFGRPDGFHERQVDRWLAFLDSYRVRELPGLDDASDWLRRN
RPDHYTPGIMHGDYQFANVMYAHGAPAKLVAIIDWEMTTIGDPLLDLAWA
LLGYDGENPRTQGYYADLAGMPTRSELLEHYEKISGLSTEHIDYYLVLAN
WKLGIVLEKTYAASVTGDRVDPQVAAAMGPMIPQLIATAAELARSSTGA
333989339YP_004521953.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MNANGTLQGRVALITGAARGQGRAHAIRLAAEGADIIAADICAPASECIT
YPAATPDDLAETVRGVEAQGRKVLARSVDVRDDAALRALVSDGVEQFGRL
DVVVANAGVLSWGRLWELTDEQWNTVIDTNLTGTWRTLRAVVPAMIEAGN
GGSIVIVSSSAGLKATPGNGHYAASKYGLVALTNTLALEAGQHGIRVNSI
HPYSVDTPMIEPQVMAKIFGEHPDYLHAFPPMPLHPNGFISSEEVAEVVA
WLAGDGSGVLTGMQIPVDKGALKY
333989337YP_004521951.1 iron-regulated elongation factor EF-Tu Tuf [Mycobacterium sp. JDM60MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDKYPELNESRAFD
QIDNAPEERQRGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQ
MDGAILVVAATDGPMPQTREHVLLARQVGVPYILVALNKSDMVDDEELLE
LVEMEVRELLAAQEFDEEAPVVRVSALKALEGDEKWVKSVQDLMEAVDES
IPDPVRDTDKPFLMPVEDVFTITGRGTVVTGRVERGVINVNEEVEIVGIR
PDTTKTTVTGVEMFRKLLDQGQAGDNVGLLIRGIKREDVERGQVVVKPGT
TTPHTEFEGQAYILSKDEGGRHTPFFTNYRPQFYFRTTDVTGVVSLPEGT
EMVMPGDNTEMSVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
333989335YP_004521949.1 30S ribosomal protein S7 [Mycobacterium sp. JDM601]MPRKGPAPKRPLVSDPVYGSQLVTQLVNKVLMAGKKSLAERIVYGALEQA
RDKTGTDPVVTLKRALDNVKPALEVRSRRVGGATYQVPVEVRAERSTTLA
LRWLVSFSRQRREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
333989333YP_004521947.1 TetR family transcriptional regulator [Mycobacterium sp. JDM601]MIVNAALNFLDREGWDALTINALATQLGTKGPSLYNHVHSLGDLRRAMRM
RVIDDILEMLTQVGQGRARDDAVLVMAGAYRSYAHHHPGRYSAFTRMPLG
GDDPEYTAAATRAAAPVIEVLASYGLDGDRAFHAALEFWAAMHGFVLLEM
TGVMDNVDTDAVFADMVRRLAAGMDSRTG
333989331YP_004521945.1 hypothetical protein JDM601_0691 [Mycobacterium sp. JDM601]MTRGSPPLRCAAITTLMLGLVLGLAGCDDATDAAPAKRLSVSSNIDTIDY
GSFGTTSAVDCADGKSLNVAGSNNRLTVRGRCEAVNVAGADNRITVERVD
KSLTITGLNNSVAYRAGEPRVDDRGSGNTIAGSR
333989329YP_004521943.1 regulatory protein [Mycobacterium sp. JDM601]MTARSVVLSVLLGAHPASATSAELLNLTAGFGIKETAMRVALTRLVAAGD
LVRSAGGYGLSERLLERQRRQDEALNPQTRRWGGDWLAVVITSIGCDART
RAALRSRLTERRFAELREGIWMRPDNIAVDLGAELTPHTRLLIARDDQPA
ELAGRLWDLTGWAATGNELLAGIAAAPDVPGRFVVAAAMVRHLRRDPVLP
TELLPPDWPGDRIRSRYAEFVDEVAAQRDAGRTVEVP
333989327YP_004521941.1 acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]MVGNRIDEVEYDPAYHELMRTAIAHGLHAAPWADPRPGAHVVRAAQTGVW
TAEPGHLCPISMTYAIIPALRYNQELSKTYEPLLTSRVYDPVLEVPATKA
GITAGMSMTEKQGGSDVRAGTTQAAPNADGSYTLTGHKWFTSAPMCDVFL
VLAQAPGGLSCFFLPRVLPDATRNRMRLQRLKDKLGNHANASSEIEYDGA
TAWLVGEEGRGVSVIIEMVNLTRLDCALGSATSMRMGLARAIYHAQHRKA
FGDYLIDQPLMRNVLADLAVEAEAATMVTMRMAGATDKAIQGDDREALLR
RIGLAATKYWVCKRATGHAAEAMECLGGNGYIEDSLMPRLYREAPLMGIW
EGSGNVSALDTLRALATQPDSVAVLFDELAASAGQDRRLDAHIDALKAQL
GDLGGDLQAAQYRARKIAEDICLALQGALLVRHGHPAVAEAFLTTRLDGQ
WGGAFGTLPAGLELGPILERSLVKD
333989325YP_004521939.1 endonuclease IV (apurinase) [Mycobacterium sp. JDM601]MLIGSHVRPQNPLAAAEAEGADAVQIFLGNPQSWKAPKPREDAAQLREAA
LPIYVHAPYLINVASPNNRVRIPSRKVLQQTCDAAADIGAVAVIVHGGHV
TADDDDPLAGFVRWRKALDQLETTVPVYLENTAGGDHAMARRFDTIATLW
DHIGDTGVGFCLDTCHTWAAGESLPDAVERIKAITGRIDLVHCNDSKDAA
GSGRDRHANFGTGQIDPDLLVAVVQAAGAPVICETAEEGRKADIAFLRER
LG
333989323YP_004521937.1 DNA-directed RNA polymerase subunit beta [Mycobacterium sp. JDM601]MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEK
IFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAP
VTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDTEMRHNELST
LEAEMVVEKKAVEDQRDADLEARAQKLEADLAELEAEGAKADVRRKVRDG
GEREMRQLRDRAQRELDRLDNIWDTFVKLAPKQLIVDETVYRELVDRYGE
YFTGAMGAESIQKLIETFDIDAEAESLRDTIKNGKGQKKLRALKRLKVVA
AFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINR
NNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALE
LFKPFVMKRLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVIAEHPVLLNR
APTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAE
AQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYFLTTEIEGDTGEYT
PAAKDRPESGVYSSPAEAIMAVDRGALSVRAKIKVRLDQLRPPAEVETEL
FGENGWRPGDAWMTETTLGRVMFNELLPVGYPFVNKQMHKKVQAVIINDL
AERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPRKKEILDSYE
ERADKVEKQFQRGALNHDERNEALVEIWKEATEEVGQALRDHYPADNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPIKSSFREGLTVLEYF
INTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCGTERGILVE
LAEVAADGSLIRDPFIETSAYARTLAVDAVDEKGNVVIERGHDLGDPSIE
ALLGAGISQVKVRSVLTCATGTGVCATCYGRSMATGKLVDIGEAVGIVAA
QSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARIPRGKAPIADVA
GRVQLEEGDKFYKITIVPDDGGEEVVYDKLPKRQRLRVFKHEDGSERLLA
DGDHVEVGQQLMEGSADPHEVLRVQGPREVQIHLVKEVQQVYRAQGVSIH
DKHIEVIVRQMLRRVTIIDSGATEFLPGSLTERAEFETENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLQGLKE
NVIIGKLIPAGTGINRYRNIAVQPTEEARAAAYTIPSYEDQYYSPDFGAA
TGAAVPLDDYGYSDYR
333989321YP_004521935.1 ribonucleotide-transport ABC transporter ATP-binding protein Mkl [MMGVAIEVQDLTKSFGSARIWEDVSLTIPAGEVSVLLGPSGTGKSVFLKSL
IGLLRPERGSIVIDGTDILQCSAKELYEIRTLFGVLFQDGALFGSMNIYD
NTAFPLREHTKKSEKEIRDIVMEKLELVGMPNDGYKFPGEISGGMRKRAG
LARALVLDPQIILCDEPDSGLDPVRTAYLSQLLIDINAQIDATILIVTHN
INIARTVPDNMGMLFRKQLVMFGPREVLLTSDEPVVRQFLNGRRIGPIGM
SEEKDQATAAAEEAMLAAGQHHGGVEEVEGVPPQLSASPGMPERKAVGRR
QARVREILHTLPPNAQAAVRDELEGTHKYAVHEFPADDDAPTASIPSPPG
333989319YP_004521933.1 transcriptional regulator [Mycobacterium sp. JDM601]MTSQPDHTVRDDLLNAALGLLDEHGPDALQTRKIAAAAGTSTMAVYTHFG
GMAQLIAAIAEEGLRRFDAALSIPETDDPVADLLATGVAYRDFAIGRPHL
YRLMFGSTSAHGINAPTQNMLTLGLAEIDVRFPSFAHLVRGVHRSMQAGR
IAAGSNDTDSDGSDAQVVATAAQFWTVMHGFVMLELAGFFGGTGASVAAA
GPVLKPMATGLLIALGDTPERVAQSLAAVTDRP
333989317YP_004521931.1 50S ribosomal protein L10 [Mycobacterium sp. JDM601]MARADKTAAVADIVEQFNDSTATVITEYRGLTVANLAELRRSLGGSATYT
VAKNTLVKRAASEAGIEGLDELFAGPTAIAFVRGEPVDAAKAIKKFAKDH
KALVIKGGYMDGHALTVAEVERIADLESREVLLAKLAGAMKGNLSKAAGL
FAAPASQLARLAAALQEKKPAEAPADTAEAPADTAEAPAEAAEAPAEAAE
333989315YP_004521929.1 HxlR family transcriptional regulator [Mycobacterium sp. JDM601]MAVSKKEVGECPIDAALSVVDGRWKGTILWRLADGPMRTAELRRSIPGIT
ERMLIRHLHELVDDGIIDRHDAGTVPPCVHYSISDYGATLAPVLQALCDW
GRTHITRGSTS
333989313YP_004521927.1 PemK-like protein [Mycobacterium sp. JDM601]MRGDLYRLKAPKDARGHEQAGGRYAVVVQSDDLPLSTWIIAPTSTGRRAA
SFRPEIDIAGTKTRVMVEQLTVIDPQRRLGEFVGRLTGSELAAIDTALVA
VLGLD
333989311YP_004521925.1 alpha-mannosidase [Mycobacterium sp. JDM601]MQVISAESTEKFVGPADAPLQLVRVEYAGATAPTPVRVDGDGLAGEAVAE
PGSDVVEVPVTVADPVPGRQRAARANGTGFSFTVAEPGWTMFMVGHFHYD
PVWWNTQANYTSAWSEYPLGACRQTNGINLVRGHLDWASEHPEYKFVMAE
VDYLKPYWDTHPQDRAELRRLLAQGRVEVMGGTYNEPSTNLTDAETTIRN
LVAGMGFQRDIMGAAPATAWQLDVFGHDPQFPGMAADAGLTSSAWGRGPF
HQWGPMAPQNGVAGDPHRMQFASEFEWISPSGRGLLTHYMPAHYAAGWWM
DARETLADAEDEVYQLFVEMKKVAATRNVLLPVGTDFTPPNRWVVQIHRD
WNARYTWPKFVCGLPREFFAAVRAELAERGESPSPQTRDMNPIYTGCHVS
YIDTKQANRAAERALLAAESFGVFASALTGTGYPEAALAKAWAQLCYGAH
HDAITGSEADQVYLDLLTGWRDAWQLGVDARDAALAVLSGLVEAGSGPGQ
TTVVWNPVAADRTDVVTVRLDPPAAAGVRVFDSDGTELPAHVEHGGRSVS
WLARDVPSLGWRAYRLTPEADPQGWAPIPGSRISNGRHRLTADPDRGGGI
TSWRCDGREMISEGGLGNQLAVYDEYPKHPQSGEGPWHLVPSGNLFTSAV
ATAVTVQAYRGPLGERLVVSGRIRGVLAYTQTLTLWHGIDRVDCSTTVDE
FTGADHLLRLRWPCPVPGALPVAEVADAVIGRGFALLHEPTGRSVDTAQF
PWTLDTPAHRWFGLSATARINVGDGSRPVSVAEIVTAIAPSARELMVALV
RAGVTASCSDADGPRYGNLDVDSNLPDVRITLGGPDRNAFTRTVLDAADP
AYTAELDRQLEQHGRARVWVPAAKPLAEVWVPGADLSGPRALPVLVIAAD
DDAALAAEIARVTEELAGNEISVEQTARADLEPFEARTVALINRGVPSFA
VDTAGTLHTALLRSCTSWPSAAWEDEPRRTAPDGSAFQLMHWTHTFDYAL
VAGDGDWRQAGIPARSGEFADPLLAVPVTEGSGALPVTGSLLRIDAAGAV
GLGALKAAGNPTARASAQPVDARTVTLRLVETRGADAAVTLRSDVGTVSV
LGRADLLEQAREHPDPRRLHGYEIATVTARLDVERLGAAGPLAPEAETAQ
PLYARYWLHNRGPAPLGGMPVTPALQPHRLDADPGALLSLDLTVASDSID
ADLAGAVTLACPAGWNAAPAEHPVRLAAGEHVRTPVAVTVPADAAPGLYP
IRARLDVTGDVPPSWRQPVEDIAVVRVGDPGADRLLYVDGPGGVEVTAGQ
SARLRVTVGTDARADLAVEAHLISPWGTWEWSGPAALGAVVPARSSVELE
FTLHPPVWASPGSWWALVRVGGAGALVYSPAVRLAVLAPGTSGLD
333989309YP_004521923.1 hypothetical protein JDM601_0669 [Mycobacterium sp. JDM601]MGRCMAVRWPPPSWFVLVKGMGHDVPPRLWGPVSQALTEHFRR
333989307YP_004521921.1 lipase [Mycobacterium sp. JDM601]MEVRSGTARSGELEIFYEDLGSPDDPPVLLVMGLGAQLLLWRTGFCEKLV
AQGLRVIRYDNRDVGLSTKLGRKHARGALVPRMARFWLGKPSSAVYTLED
MADDAAALLDHLDIDRAHVVGASMGGMIAQVFAARFAERTRSLGVIFSSN
NRRFLPPPAPRALLALLSGPPPDSPREVIINNAVRASRIIGSPGYPTPEE
QLRANVIEAYERSYYPWGIARQFGAILASGSLAAYDQLITAPTVVIHGLA
DKLMRPSGGRAIADAIDRARLVLFEGMGHDLPEELWDPVITELTTTFAAG
H
333989305YP_004521919.1 methoxy mycolic acid synthase [Mycobacterium sp. JDM601]MVDKQMVEKATRAEGMRPKFENIQAHYDLSDDFFALFQDPSRTYSCAYFE
PPDISLEEAQIAKVDLNLDKLNLRPGMTLLDIGCGWGGTMKRAVEKYDVN
VIGLTLSKNQHAYSQSLLDEIDTERTRRVLLQGWEEFNEPVDRIVSIEAF
EHFGFENYDDFFKNCFEIMPADGRMAIQSSVSFHPYDLNARGKKLTFETA
RFIKFILTEIFPGGRLPTTDMMVEHGEKAGFTVPEALSLRSHYIKTLRIW
GDALEAHHDEAVAIQSEEVYQRYMKYLRGCEYYFTDEALDVSLVTYVKS
333989303YP_004521917.1 50S ribosomal protein L12 [Mycobacterium sp. JDM601]MAPKKKVAGLIKLQIEAGQANPAPPVGPALGQHGVNIMEFCKAYNAATEN
QRGNVVPVEITVYEDRSFTFALKTPPAARLLLKAAGIAKGSAEPHKAKVA
KVSWDQIREIAETKKADLNANDVEAGAKIIAGTARSMGITVE
333989301YP_004521915.1 preprotein translocase (tail-anchored membrane protein) SecE [MycobMTDELDRPDAAAGGDSEADSTGHGRTAVASMQVGAPLRPTGKRSRRRGAA
DDDVAELESTATELGGDDAGVKKAKKAKKKSDGPSRNPFVFVLNYLKQVV
GELRKVIWPNRKQMVTYTAVVLAFLVFMVALVAGADYGFAKLILLVFGE
333989299YP_004521913.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadB [Mycobacterium sp. JDMALREFSSVKVGDQLPERVIPLTRQDLVNYAGVSGDLNPIHWDDEIAQQV
GLDTAIAHGMLTMGLGGGYVTAWVGDPGAVTEYNVRFTSVVPVPNDGKGA
EITFSGRVKSVDPETKSVTVALTATASTNADKKIFGRAVASAKLA
333989297YP_004521911.1 50S ribosomal protein L33 [Mycobacterium sp. JDM601]MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQS
HRESR
333989295YP_004521909.1 hypothetical protein JDM601_0655 [Mycobacterium sp. JDM601]MGSVEDRWYDITHAGPEAWLACAAWLAIGITVLALIYLNRQLQRNRRAAA
EQTRPHVAMFMEPHAADWHVIELVVRNFGKTAAYDIGFSFAQPPTVARYE
TASDGYADVVALQLPEELTVLAPNQEWRTVWDSAIDRAELGEGIESRFTG
TVSYYDTPEEPKGWFGRGKRTRYENKVTLDWGDLPPVRRVELMTTHDLAK
REKQKLELLRSLLSYFHYASKETRPDVFRAEIERINGAAREIQDRLRGRE
QLDSAGNTDITVRLGDASAELGKHRH
333989293YP_004521907.1 cyanate lyase CynS [Mycobacterium sp. JDM601]MLEAMNRSEITEQIVAARLAKGLSWQELADAIKRPVVWTTSALLGQQPIP
AELGEILVGLLGLDRSVVPVLAAVPMRGASPGAVPTDPTIYRLHEAVSVY
GPAIKELIHEQFGDGIMSAINFSVDIDKKQHPGGDRVVITLDGKFLPYEW
NSAD
333989291YP_004521905.1 lipoprotein DsbF [Mycobacterium sp. JDM601]MLLAALLVAGCGSRTPAEGTQLDFTAQTLDGRPFSGASLAGRPAVLWFWA
PWCPTCQKDAPLVARVAAANPAVTFVGVGARDQPDALREFTAKYGVDGFT
ELADTDAAVWARFGVTRQPAFAFISPGGEVEVVKGSLPEAELSARVQALK
SS
333989289YP_004521903.1 hypothetical protein JDM601_0649 [Mycobacterium sp. JDM601]MPTTIAPIARQVAERARTDAGFAQVLDVLLEAPTAPQGTLERIAAHALND
QRRAALIDDFVAGALPTPKVQELLRLGTPQAVHRLRSRGKLTGAAVGNQT
WFPAWQFDDARVRADLPEILELLRRFTSDPLAADRIMRLTHDELDGVSIA
EALRHPETAPAARRMLTALGA
333989287YP_004521901.1 hypothetical protein JDM601_0647 [Mycobacterium sp. JDM601]MAEREPRRGDYGVDGSFKRVPLGGQVAALALGCSALAIYAGIALARGPVW
AGVVALLLDAGILAQVGLYWHATRTGKFTVWERILDGLRLRGDETVLDMG
CGRGAVLCAAATRLPTGRAIGVDLWHADQTGNSADATLANAALEGVAERV
AVRTGDMTALPLADASVDVVVSNLAIHNIPSRDGRRRALAEAARVLRPGG
RLAIADLWEVRAHAAQLREIGWGDVRWRNLGWRMWYGGPWAATRLVTATK
PG
333989285YP_004521899.1 zinc-dependent alcohol dehydrogenase AdhE2 [Mycobacterium sp. JDM60MKAVSCRNAQLDVIDLPTPAPAKGQLLLGVLRSGICGSDLHARHHCDEVA
AAAAETGYDGFMRSDQQVVLGHEFCGEVLDHGPRTRKAPRAGTRVVSVPL
VRRGDDIHPVGLSAAAPGAYAEQLVVEQSLTLPVPNGLSAEAAALTEPMA
VAWHAVRRGEVRKRDVAIVIGCGPIGLAVVCMLKASGVRTVIASDFSPGR
RALAVRCGADVVVDPAHGSPYDAAAGHGHFEGSADAFGVAVGTVEKLYKA
RLPWWHVWRAAEAVGVAKPKHPVIFECVGVPGVIDGIIAGAPLFSRVVVV
GVCMGNDTIRPAMAINKETDLRFVLGYTPMEFRDTLHMIAEGKVDVTPLI
TGTVGLGGVANAFDALGDPARHAKILIDPQSPLQEVS
333989283YP_004521897.1 exodeoxyribonuclease V subunit beta [Mycobacterium sp. JDM601]MTHRFDLLGPLPAERSTVVLEASAGTGKTFTLAGLVTRYLADGVARVDQL
LLITFGRVASRELRERVRGQIGDALAVLEGRREPANDLEHHLLTTGEAGQ
ACARLRNALADFDAATIVTIHQFCAMVLKSLGVAGDTASTATLLESLTDL
VTEIVDDHYLAYFGNDENKPPMTRKEALDLAGRVVEDPAAQLRPQHPDPE
SEAGVRRAFAEAVLDELERRKRRLGLLGYNDLLTRLAEALRRSGSDAAER
MRRRWPIVMVDEFQDTDPVQWEVIDRAFSGQSTLVLIGDPKQAIYGFRGG
DIYTYLAAVRAAGDRRTLATNYRSDKALVDSLQTVLDGAQLGHPEIVVPP
IEAHHTGYRLSGAPRNAPFRLRVVKRPTLGKDGLDSLLIGPLREHIPADL
AADVGALLNSGARYGDRPLCAGDIAILVEQHQDAALCRDALTKLGIPVVY
TGDTDVFASRAAEDWLCLLEALDQPGRTGLVRAAACTMFFGESAESLARD
GDSLTDRVTETLREWADHVRLRGVAAVLEAAQLAGMGRRVLSQRGGERHL
TDLAHIGELLHEAAHADRLGLPALRDWLRRQREDRTGAVERNRRLDSDAG
AVQIMTVFAAKGLQFPIVYLPFMFRRYIAAEGNLLYHETGNDGAEVRCLH
IGGSRSPGMAAVKELHRREEALDHIRITYVALTRAQSQVIAWWAPAGDEI
NGGLSRLLRGRPPGQAEVPDRCESRISDDDAWAVFTAWQDRGGPVVEESV
IGPPTAPVRREAPGELAVRHFHRHIDAGWRRTSYSALLRGAQEQAESGVH
SEPDAHTRDDESEDVTVTRAAAADGVEVRSPMADLPGGKTFGSLVHGVLE
TADPFAADLAAELTEQVRVHEPWWPIGVDAETLAAALVPMHDTPLGPLAD
GLTLRQIGLPDRLRELDFEIPLAGGDTAAAATQLRVADVGALLREHLAPE
DPFAVYADRLLSEALGGQSLRGYLSGSLDVVLRLPDQRYLVVDYKTNNLG
ETAADYSPPRMTEAMLHSDYPLQALLYTAVLHRFLRWRQPDYDPDRHLGG
VLYLFVRGMCGPDTPILGGYPAGVFSWRPPAALVVALSDLLQQGVAA
333989281YP_004521895.1 hypothetical protein JDM601_0641 [Mycobacterium sp. JDM601]MFAVILVLALLWWLRWVILAGVVITLAVIVARWLLRSYAEHRAAELARLQ
AIRHRAEIQNAQVLRGDPQGFYGRYPLPDPELIPRWYRVDGAGGPGPCG
333989279YP_004521893.1 elongation factor G [Mycobacterium sp. JDM601]MTDNAVHSEASRRRTFAVISHPDAGKSTLTEALVLHAKAITEAGAVHGKS
GRRATVSDWMEMEKARGISITSTALQFGYRTARGQDCVINLLDTPGHADF
SEDTYRVLTAVDSAVMLIDAAKGLEPQTLKLFQVCRHRRIPIITVINKWD
RPGRHALELMDEIATRIGLRPTPLTWPVGIAGDFQGVLDRRSGNFIRFTR
TAGGATAAPEEHIAAEDAHGAAGVDWDTAVEECELLSADGSDFDREAFLD
CTASPVLFTSAALNFGVNQLLDVLTELAPPPGGALDVDGNRRATDAPFSA
FVFKVQAGMDSAHRDRIAFARVYSGTFERGDVLTHAVTGKPFVTKYAQSV
FGQQRATLDTAWPGDVIGLANAAALRPGDTLYCDVPVQYPPIPSFSPEHF
AVARNADPSKHKQFRRGIEQLDQEGVVQVLRSDRRGDQAPVLAAVGPMQF
EVAAHRMATEIGAPIMLESLAYQVARIVDPGDVDFVDRQSLTEVMTRTDG
VHLALFSNSWRLQGFQRDNPDIQLRSLVAAEG
333989277YP_004521891.1 hypothetical protein JDM601_0637 [Mycobacterium sp. JDM601]MTVEQRLEALEQIEAIKALKHRYFRACDAKDPDTFRACFIAEGADLDYGP
LGGFTDADQMAEVFRRIALHTVDGKHVIFDMHHGMHPDITITGPGRATGR
WTLKFRQLNLIERTERLLTGEYDDAYVIENGNWKMSRSHFRQLWSLVRPL
GDAVVEAAR
333989275YP_004521889.1 hypothetical protein JDM601_0635 [Mycobacterium sp. JDM601]MPISLPEHPRFASPSERHVYQALIEQLQDGDVVVAGQRVTDHLKDHEIDF
VVAIEGAGIICIEVKGGEVWHDGSGWRQLRGGKECRIHPVRQARDACYAL
RDYIEHDPRMTQDRLRWDHVVALPHTELPADFELPDCPRWKVIDRNDLPQ
LVSRLRHVLIRQELDRPLLTAEGIEQFRTALGGRGLPQRDVVARALANDS
AADALTEQQAVILEAIRLLNRVQVRGSAGSGKTYLAVEQARRLSADGKRV
ALLCYSHGLASYLKRLTGSWRRRQQPAYVGEFHSLGVVWGAPDGPADPAE
EVTFWEEQLPQQMLALAENLDDGQRFDAIVVDEAQDFADAWWDPLLASLR
DDEEGGLFVFSDEGQRIFDRQGTPPVPLVSLVLDRNLRNTRQIAATFRPL
VDHPIRFLGADGPEVRFVPCRKETAVETGDDEVEQLLDDGWRAEDVALLT
TGSRHPEQVARQGQGDQAYWDSFWDADQVFYGHVRGFKGLERRAVVLVVD
ASGPVELARERLYVGLSRARDQLVVCGDPDFIAEVGGPDLARKLGIGLTV
TPGIPE
333989273YP_004521887.1 cytochrome P450 [Mycobacterium sp. JDM601]MRYRPGDALATLHRRRGPMVDAGVGRYGYVYLFGAEANKFVFANSDAFNW
WDAFQVLVPVDGPTALIVSDGADHRRRRSLVQPAFHHRHLGNYLQVMAAN
ADAVIDTWRPGDTIDIVAQLRSAIRRSAIEALFGQSMAGHADFLGEQLQP
LMDLTQRLPQVLKAEARLKTPAWRRAMAARARVDELIYAEIARARTHPSA
DDNVLATLIGGRTEVGESLRDDEIRDQIVSLIAAGYETTSAAMGWAVYAL
LSTPGVWQTAAAEVGDVTDGRTPASADLKNLTYLNGVVHETLRLYPPAVI
SARKVTRELSFHGRRIHAGRTLVFSPYVTHRLPELWVDPLRFEPRRWDPS
FPAYRRAAPYEFLPFGGGTHRCIGSSFATAELTVMAARILARTSLSLPDQ
RIRAGGYAALQPRGGLMVQVNGLR
333989271YP_004521885.1 hypothetical protein JDM601_0631 [Mycobacterium sp. JDM601]MTDPSDAAPTLAAILTEHGPASQDDIADRLHEAGIADPDTVIDELLDEFS
CPARPLPDGRWVWLPAVLAGRVFTHRLTAEELTHDLLAVSPDLDPITELC
DDDYPELADGSPVSLVLPRYDDELLEERGIPLELVDEPGALLLAPGTLAG
LGLAAGDLLGMRLTDKGIALEPVTATMDPTLGDRLAALVDVDESPSRFAS
VVWAACAVDPALFNTPLAPLGEIADAHGLARSGDWLAPAGFDFDRWRFER
KCARLADEYGLDDDDAFVLTTLVEIHGQMARIFDMAPGAEDDEEGAADAP
TDAWPADGPYADILGELGAALANPVLALSLMEEATHEGRRGAAALGILAE
SLQPKVPRSARVATHWLQAMACEGLGDVAGCARELLAAESSDPDWPLALL
SLARIASDRGDAEAGLGLLRRAGVGSDHPLVRLLEQHRAQPRTDVGRNEP
CWCGSGRKYKKCHLGNEQLSLTERVRWLYAKAHQAGARWRVGRVVDAGGL
RAHPLLRG
333989269YP_004521883.1 hypothetical protein JDM601_0629 [Mycobacterium sp. JDM601]MQDEGLEPRVAALEEQVRELRDRVRASEQDAAAARVLAGGADRDVGELGD
ELRDFRQATNTSFNALREDMLDMRQEMTGGFSDVATGFAEIRAEFDLTAA
GQQHIAALIQQVIDRQGGAAPT
333989267YP_004521881.1 hypothetical protein JDM601_0627 [Mycobacterium sp. JDM601]MAQFDIEYEVVYRGIDLEQVPPLTLQPRGSTDTGTEIPTCR
333989265YP_004521879.1 type III restriction enzyme res subunit [Mycobacterium sp. JDM601]MDPGVYESLLTEHLHAQLARHADLRPDFATVDDAEQALTITRYLAPIIER
SLRSARTVEDRVDLTHRILELLPDTVTDGAALRTDDPGKITRLDEVRRAK
ALADNRLPRPATPFSDAALMTNGRGEPTLAAELRAELASADRVDLLCAFV
KWQGLRLFEKELTELRERDIPLRVITTTYLGATDARALDALVNEFGAEVR
VNYDTTITRLHAKAWLLRRNTGFHTAYVGSSNLSHAALVDGLEWNVRLSA
IGTPHLLEKFRATFDSYWENRDFEPFRPDQDGERLRQALQNASGERKRDS
LAVTLSGLEVRPKPFQAEMLEQLDAERTLHDRHRNLIVAATGTGKTVIAA
LDYRRLAREVHGRDLTLLFVAHRKEILGQAQRMYREVVTDATFGELLVDG
QQPTKWRHVFASIQSLSANRLADIAPDHFDVVVVDEFHHAEAASYRRLLG
HVQPIELLGLTATPERADGVDVRAFFEGRIAAELRLWEALEQSLLCPFHY
FGIHDDTDLEAVQWKRGGYDLAALSGIYTGNDARTRIVLKQLRDKVGDVA
AMRALGFCVSVDHARYMADSFNDAGIPALAVSAETPADERRSALAALRNR
DINIIFAVDLFNEGLDIPEVDTVLFLRPTESATVFLQQLGRGLRLTHGKT
VLTALDFVGHQRREFRFDQRFRALTGTGGKALQRQVEQGFPFLPSGSQIV
LDRVAQKLVLDNIKQQVAPRWAALVSEVRAHPGDRLAGYLDAYGRGLPDI
LKNNRSWTTLCRETGKQAAAPGPRETDLVKRVRALAHADDRLRWQTYRTI
LDGSADLASPAERRLAAMLFYSLFPNGGGFPDVAAGLDALGGEPVSDEMR
QVIDIAFDAARRSTYDLGRFVPSLAEVPLQVHATYSREEILAALDYAAQN
RTPSTMREGVVWRPDLNTDAFLITLKKSETDYSPTTMYRDFALSDRLFHW
ESQSTTSENSPTGQRYIHHRENGSHILLFVRAAKTNALGAAPYVFLGPAD
YVSHEGEKPMAITWRLHQPMPAEVFQASSVAVA
333989263YP_004521877.1 hypothetical protein JDM601_0623 [Mycobacterium sp. JDM601]MTAGLLAARGAVSVGQLATEVHPLLGHHWRIGGNPLTIDDVRRQIYSQCA
IMSGLDLIDTSDWRVWAVGPSARSLLPGIDVLAEYLANQ
333989261YP_004521875.1 hypothetical protein JDM601_0621 [Mycobacterium sp. JDM601]MASLEELDDLINAVAAEANHEPGASRRRRLDAAFNVLDRAADGF
333989259YP_004521873.1 hypothetical protein JDM601_0619 [Mycobacterium sp. JDM601]MAALSQRVGLLAGVLDDRDLMLIAAVAVDDVYKSCFQELFWGQSVADYLA
ATAGVVVQELERRGVALHYVISNALGDADLHGMLTGLPAVFSAAGLFVVG
PQVVALYLMEQSGQPRDVDAIPRYRDEGQIMADELIERCHRERRSSLYLH
IDVDDTATDGALNVAVPRNRIPGALVVYRDEAPVQGSLMHAMPPPGTDWP
ARLLKGISERT
333989257YP_004521871.1 hypothetical protein JDM601_0617 [Mycobacterium sp. JDM601]MTDIGLQLVDSLFKQLMVDDEWAVRRERGFTWWAYRLAQHVEIGPPVWSE
DRYICSVRIWTDVVRDVDPATEPASVLGVVNAQATVNALVWDDATATITE
CCTAVIHEEIFAWMSKVLSTAAVLQNAAAHSRAHALAAACGGVPAASNHP
SSGERPEMDDLLNFPNVIAHEGRQPSWFAGPGMEQMNRFFTDLGVAGSAD
STGLTCEIPFTGRTPAAVITAASQLQTALLQIFTDAPHPEFGNGALVVMK
LPLSIEPGQVALVANEMNHVEAHGTSGTALFGAWCPDPASKTTLAFCSFV
PNTLARKTSPQNLVIYQGSRSRFAAEQLIG
333989255YP_004521869.1 hypothetical protein JDM601_0615 [Mycobacterium sp. JDM601]MRGGVDSSGNYATVNGTSWTAYPTADEDYVMLPGWDEDEEPDMSPCWAEH
GVEEGEWNPLIGHTAIGLAVPGVAVEYGWYDHGGIERSSAVSVRRFDDFA
TVFADWLVEGSVHESLWGGDSAPYSHTVQLFADAAKANKREGHWSTEMDE
EDEEDEEDEEDEEDEEDEEDEDDNGDESQSHCVSVHLKLYLSDELIDQVR
SRLSSLDPAYADILKPNGR
333989253YP_004521867.1 hypothetical protein JDM601_0613 [Mycobacterium sp. JDM601]MVEGGSGYAPIDADGRIVTLYSDGRNRWTVDELRQQIYPAVTSAASFDDW
LSASVTAGDFRSVDVLQFVGYADEDSDGQTVLTERLILD
333989251YP_004521865.1 hypothetical protein JDM601_0611 [Mycobacterium sp. JDM601]MDGVELGGSVEAEVWELLDADETVSEETAYLVAAALHGDDDLTEQLGGQA
PVPQRPDTTTTDTPAPLRAFLRSITVSGFRGIGPRATLELNPYYGITVIS
GRNGSGKSSFAEALEYALTGSSYRWDNKKGQHWETSWRNLHMGEPAAIAI
DFAMEPDDARGGTTATVGVDWATGAELHGARRWSQIKGQKREPVTALGWD
QALETHRPLMSYDELGGRLEDSPSALYDSLNRLLGLDLIADADNRLKDAE
KQLSGPRKTANEARTQLRKILDSSSDPRAAQVKKLTARTPYDLEAITATT
LGTNTAQAATIAQLRALAALVVPEPANATAVASELRAAIDDHVAGADAAM
KAMTARAALLREALHLHADIGDGVCPVCETGTIDAAWRTAAEERLKEADA
STIKYQAMAQRLARARSAADGFFGTVTSQPPIEGVDLPALSAFNDALASA
RSAPDSLSDLPTHLEVAALDVAEAASALRAEAAQRAAELEDAWAPIARTI
AAWVELETAARNDDDRLDRVKAALKWLRANAETLRDRRLAPMVGQAQQIW
GRMRHESNVDLGSISLEGSATRRRAVIDGTVDGVPAGALSVMSQGELHAL
ALALFIPRATTPASPFRFIVLDDPIQAMDPAKISGFLDVLIELAKTRQVI
VFSHDDRLPAAIRARSVPAQLLDVTREHQSVVVVKENDLPAERYVADAEA
VIFDEDLDDLIKRKAAPGLFRMAIEAAAHQRFFSDRAKAGVAYHESDAEW
EKAMTTQSRVALALTGDAAGDVSGWKAYRPHRFPTIALCASGAHKGAALD
RNSVADLRKTVRDIVENR
333989249YP_004521863.1 hypothetical protein JDM601_0609 [Mycobacterium sp. JDM601]MSQVELIDRYLAAVPHTRSEVFTRPSPIPAEPGVYGWWFRQLPAAIDVSR
CQRKGDLTLLYAGISPSRPPANGKPPSQQNIRKRITYHYRGNAEGSTLRK
TLGCLLADELGIELRRVGSGTRRTFAAGEEVLSQWMADNALVSWIAVPEP
WVLERELFTALDLPLNLQGNAHNPFHVELTTVRAAAEARARTLPVVDT
333989247YP_004521861.1 hypothetical protein JDM601_0607 [Mycobacterium sp. JDM601]MTDQDKAVVPVWTLATQDVSVPPIAGDEAMTPERLGELRTVLAALADSPI
ATLEAHPLPTKLDRKQGLHLDAASPLATHLSQLISQTSKAAPSAAVGATG
ETLYRMVVPAKVAAQVGGGMVKSMTSKAVPGGVRSALIGPSGIAAHATFV
PVAGKAAASGAAGGAAAGAGVVAAGAGALTLAAPLVLMAVAVGVSAHAEQ
KRQQAIENITAMLTRLHDDALDRERVALSGCRAAIDKATAILLDEGQIGV
ALGLDSAVYAIETAVAQASQRLKKWQRALGTMDNRPVELAPLAEHFDGID
RQQGGDFRAHLELAELAIALKKRVIVLQAVEQAQLNPANPFENFIGALKR
DQKTVLELEAGIAGVLRQLSTLQLDRSHGVRDVVFSRGAVDDLLRAAYRL
RELGNGLDAAERPADVAIEMVREDDGSVVVLPAYRVEAA
333989245YP_004521859.1 serine protease PepA [Mycobacterium sp. JDM601]MSNHGHRLLRQLSDEIADLAQRVVRSTATVTGQTRELSEASGSAWLYDHE
HLVTNNHVVGDLVDPIRVRFAGAPETQALVVGSDPLTDLAVLRVDRQNLE
PLRLSAEPPQLGELCLAVGSPLGEFPESISFGIVSGLKRSIPTADGRSVY
DVIQTDCAINPGNSGGPLVNVDGHVIGVNTMGIADADNINFAISADVVSD
IVGELLAHGTIERATLGVGVALRQVAGLPSGEGLLVTAVRHNVAGPLERG
DVLLRLGDRPLRNQHDLLRALRRDVANRKVELLVWRGGEELSLECLPRSR
RKP
333989243YP_004521857.1 hypothetical protein JDM601_0603 [Mycobacterium sp. JDM601]MIRRWPRPQERSCVEVLAALSGRDLAAAVGRAQFVAACPYTEAHFLPEGA
LMTDRDFGIAVIAELYQKLMIDDEWSVGRSRGFTWWSLRLAQHVEVSQPA
RRGDREVCTVQIWTDVVDQVAPEKHPVEILAIANMQSTLGALVWDPDRRK
ITLNSTLLVDVHNVAFAVWLLQTVAVTQNAQAHSSAHALAEVVGGFPAES
HHPENGRRPAADELLSVPESVILPVGNTESRFTALLTEDLASAMGHYGVA
GCVEPPALTCELPFNGASPLAALEPPDHAVETALLEVFTDVEHPEYRTGA
LMTLSLPMVVDQGHAAVVANRLNLAEATAATTLLGAWCPDPRAKSRDRVA
FNTFLPNALARPGLLERLISSQMVRSRFAARELDVPSPGGAPWGDGLIFE
LFWSVVTALDAGYVPEVSDGPVEEVADGEVPLHAAPDLVVNAMREAASRL
SVPSTQVQSGGWRAAVESQRLR
333989241YP_004521855.1 UvrD/REP helicase [Mycobacterium sp. JDM601]MANLVIASNSKAMSKLDGSVKNKVYDFFEKLTADDTAPGLHIEPLKLAVD
PRVRTGRVDQNFRAVLFRVDDKSNERTYIYMGTWAHDEANKLAERATLRV
NPINGTLEGLIGEPAEVAQPESVTPPAKPETAPSYLANVGYKLEDLTDGL
GIAPAVAARAMGAADEDGLLDAAEGALKWEASALLELATGVAIETIRENH
GFTEKPVDPAVDEDQQIIDALKRPASKMQFAFIEGNDELRRVIEGGDFTA
WRTFLHPEQRKYVEQNYNGAFRLSGGAGTGKTVVAIHRARRLAHDNPDAR
IILTTFNATLAQGLRADLAVLDPDVPVADKPGERGVYVGGLDALGRAVLD
RSGETAALAGERIFGRHVDFGPKRTSTDAVWRDVIGTVDSGLDAKLATPA
FLEAEYVAVVLANRINTLEQYAKVARAGRGVRLSRPQRIAVWKLIDAYRR
QSQMDETISFPEVLALAAEALCIQTEKTGQYLADHVIVDEAQDLHATHWA
LLRALVAEGANDLFIAEDSHQRIYGSPIVLSRFGIKIVGRSRRLTLNYRT
TAQNLHFAVGVLAGANYADLEQGAEDTSEYRSARTGPLPELIPCDNQTAE
LDAVAAKMDAWLKAGDVQPENIAVLTRTQDDRDRFVRGLGERGVSARALD
KTVASPGHPLVLTMHRAKGMEFSRVILSGVDDKRVPSPAVLRSMPDEERD
EALLRERSLLYVASSRARDALVVTWSGNRSELLGKSDHESRRAW
333989239YP_004521853.1 hypothetical protein JDM601_0599 [Mycobacterium sp. JDM601]MSLCIVDAVWSIGADYDSVVVPVVRTLAGKLGVGQPTVPATEPIGADPLP
VTRIAEISVDEMTALTNRQRTSTRNGILKSDAVLRHARMFAEHHVGTMAE
AVALFADAARFDTLDAALRPIPGEGGDGIRRGYLWMLIGQDDLIKPDRMV
LRWLDHVGVSVDPKGARNIITQLIPVLAARLGRDVTAWEVDHAMWKAGRA
LGRGRGRRFAKGDI
333989237YP_004521851.1 helicase [Mycobacterium sp. JDM601]MILDGDQYDAADALREVYGARPKDQFIREAWPTLLETWLKHDNESRSWIV
TALRQTRHEEGTLTKRRDQLEYLRDLRNAKNLRAIVLEAFIAAGETEPPR
SEPQPPPAPGADVTTTAEPPTTPPQHQPAIQEQPLNIAPGSIVVIRDAEW
LVTSAEQGADGWLVRVRGLSELVLDTTAAFYSSLDKIEPQDPKEASVKAD
GSSGYRDTRLWLEALLRKTPVPYGDQAITVSTHMLADALGYQQAAITAAL
DPNHIRPRILIADAVGLGKTIEIGMILSELVRRGRGERILIVTPKHVLEQ
MQHELWCRFALPFVRLDSAGIQKVRQKLPATRNPFTYFKRAIISIDTLKS
PRYKAHLERQQWDAVVIDESHNLTNVGTQNNELARVLAPNTEALILASAT
PHNGREESFAELLRLLDPTVVKPDGTFTKQDVESLLIRRHRHSPDVAMEV
GSDWAERADPVHRLVKPSPAEDAVAGELSTTWLYPQSGSSPYSGDTKALF
PWTLAKAFLSSPAALAESIKARRSKLNSQDPAQNRELEALNALDELNAKA
LSTPAGKFTALTDRLQEIGVGKDKPTRAVVFAERVATLTWLRDHLPKATG
LKPENIAMLHGGLSDVEQQEIVDSFKLETSPIRVLVTGDVASEGVNLHAQ
CHHLIHYDIPWSLIRIEQRNGRIDRYGQKHPPVISSLILEPADEKFSGDL
RVLSRLLERETQAHTTLGDVASLMGKHSVTEEENVIRDVLAKGRSIDDAV
RTAQQVADGDDLDALFAQFDAVDDTPAPLPQAPRQSLYADDLTFLNEALH
AAFHDVPHTPPNNGGVGWKVSPAHGIAELTPPKDLRQRLGQLPQNYLLHG
RVLERLKLATTTAVGEAHLRAARGGKGVNNTTWPEAHYLGPLHPVLDWAS
DRALAALGRNQVFAIRGDVDAPTVLLMGTLTNKRGQLISRVFSTATFPNP
GNPSFCLVEALEDLTFLTTDTGLKPGSSNPGPITDAERYRALIPVAVDNA
HREMARVLDAQEQATNARLKAWRQRAARWHDEVEKLELFGAQRSRVTKLS
RRITEEQQLADLLAPTQQLVRPLLVIVSGKDR
333989235YP_004521849.1 restriction endonuclease [Mycobacterium sp. JDM601]MVPEENVEPDPLADYESIAFERIKDQVNRLGWEGMQQLIAGILRAMGYKT
QVSPPGSDLGRDILASPDGFGFERPRIVVEVKHRKQTMGSTDIRSFLGGR
HPDDRGLYVSTGGFTKDARYEADRSTVPLALWTLDEVTKALLDNYESTDT
KTRSLISLRTFYGPVAD
333989233YP_004521847.1 hypothetical protein JDM601_0593 [Mycobacterium sp. JDM601]MAASRKRPLSALITRVTIAVVVAAILVATIWASRAHPVRNPIPIPAAKTI
GPGIGINVTPTDGSDNISCTTGFLVRTKDDRPALLSAGHCNKPGGPAAVA
IRHGGLYKYPVVGTFTETIYDGNDWNDFDIGLIDLDRPGKIPLTSEIDGH
PVVGLGERVEIGETVCHFGIRSGGAMCGPVVAGEENKIRFAATAKCGDSG
GPVYRIRPDGAIEAVGIFTAVSNGDYSEPTCDGPHAYSVAQLIKPWLNAW
ELTLVTAEP
333989231YP_004521845.1 metallophosphoesterase [Mycobacterium sp. JDM601]MADSVVQGYDIIGDIHGCASQLEALLVELDYEIAQGAGEYRHPHRQAIFV
GDLIDRGPGQLRVLEVVKAMVEAGSAQIVMGNHEFNALAYHTEWPAGSGK
HLRSRSKKHTEQHQAFLDQLTEDQQRHYLDWFATFPLWLDLDGLRVVHAC
WHDESIAVVQQRCGTAAPFTKVAHLVAASDKGDPLYRAIENLLKGPEISL
TARGYPAYKDKGGHDRDQARTRWWDSEARTLRQIAVMEAVELTVDDELYP
ELPELELLADAMPYVYTDEIPVFYGHYWRRGKPEHRTAWTQHTACVDFSA
VNDGALTAYSWSGETEIDPANYHQLGAAQRG
333989229YP_004521843.1 hypothetical protein JDM601_0589 [Mycobacterium sp. JDM601]MTDNLPYIDEHTVRVDAPRRAVWHGLRWYVESLLRGTERNPLVALLGPQP
RAGFDVAESVEEQRLSLTGRHRFSRYRLHFELSDAPGGGTCVHARSYAAF
PGLHGSVYRALVIATRLHVVATNYMLHGIRAAVVGKSR
333989227YP_004521841.1 hypothetical protein JDM601_0587 [Mycobacterium sp. JDM601]MDGETFYTQTGPGQFDSSPLTGGPWSAASQHGGPPSALLAREMERYQPRD
GHRLGRVSIDILTPVPVAPLRIAVEEIRTGKRVQLLQATAQADGRTVLIG
RAWRIAAASADFPADAPARAPGGAEPTAQTFTFPDGWHAGGYLSSIDWCF
EDGGFAGYGPARAWARPNVALVAGEAMTPWQRVLTVGDSGSGISACAPPA
EHPAINCDFTVVLHRDPVGQWVGMDSRTLVTPGQGAFTQTTVFDPAGPAG
LATQTLVA
333989225YP_004521839.1 hypothetical protein JDM601_0585 [Mycobacterium sp. JDM601]MEVLAEPYRERDGLADYATSAPPEFGDYRTFCGDLTRGSR
333989223YP_004521837.1 CopG family transcriptional regulator [Mycobacterium sp. JDM601]MEHRLQILLDDERHRRLTAAARERGVSVASVVREAIDRGLAGPVDRRKSA
GQRLLDAPDMPVPDPAELKQELDELRGRRG
333989221YP_004521835.1 hypothetical protein JDM601_0581 [Mycobacterium sp. JDM601]MPEELGAHADAARDREAALATRLHTTTQLDRAFVATLRGAAQVALRGRRR
LDGIEAEIRQALANQQALALDTPAGARQFQQFLTVKTRDIHRVIADTVAD
SHARAAAVRSLGGGYTVKGPRAPGVQAVDHTFKRSPASADERRLNQIDAF
KQVFGRDPVSASDWTTAAALDAHTYDPKFQGVDSEIRVARIDPVPGQGVV
RASQWIPQPWVKSGLTPRDAGNGRGPDTRFDPEDTKVTTYIDYDNGIVVM
RQNPSIELSKDGSPKRVSVGAPQGSVMQAPDGAVRIKYDAGNPLVPALTT
DPNGPLNDHRLSVNGDLVFTPGPSGLRVDGTRTDYPSLEVYQDLPNGTTR
TVLIDPAQSGSSLGPMFNLPFHHEIGLGSFTFDQFGPGAATDFGPRYAPP
SVSTINDGALP
333989219YP_004521833.1 hypothetical protein JDM601_0579 [Mycobacterium sp. JDM601]MMTAQHDSRHEARYGLSSFVAVVITVAVFEAITWAWFPYFWFELLFFGIA
SAFAVPAGLFMSQMGGSTAQAGRGILIGYLATPLTIALIGIPTLIVTQIL
HRA
333989217YP_004521831.1 hypothetical protein JDM601_0577 [Mycobacterium sp. JDM601]MLKTVFNRIRLQDSDVWRIATRSSPVVVQPVLAVWFGIGWLLGQTPVVDH
TGVPILVAVAAVLTAVASLLIGAALLGTDSPRRRGMGLAVGGCGLVVLIS
GLVYALIFLPIVYPG
333989215YP_004521829.1 hypothetical protein JDM601_0575 [Mycobacterium sp. JDM601]MSRTDAHSPYRVRVARREVRVCAVHTCGGRDCDLPAIDPGWSIGRVGRCY
WEFAYTGTNVCSCWMCHWHHRPERRRAAVRTELRAAAREWNGGEREG
333989213YP_004521827.1 ankyrin [Mycobacterium sp. JDM601]MLELSLLPEEAITAGHRLADAAEAGDWPALFDLLDAIPALSVNQWRPGAA
AWLTPLHQAARHGAPTEVVAALLERGALRGLRDARGWTARDVAEDAGGSA
ALLAQLTPPRSPLTAELIRTLDANLEWAIDGTIRTVGLLDGYSDQDLRRA
LRYPPVAVLHEAAAAALHCAIPGLPGGVQVTLRCGYLETVAAGQTRVITQ
RGAVLTTEGIA
333989211YP_004521825.1 hypothetical protein JDM601_0571 [Mycobacterium sp. JDM601]MIMRVEGRDVAVAGNLLQPLTRRTNDILRLVLAALFLATVITSSLVTRYE
WVTLERSVSQIIGVLSPTHANQVYLAYGIAIVALPFAILIGLVVSRQWKL
LAAYAIAGLLAVASLSIRSNGLAAPSWHFDLSERLATTLAQFLDDPRWIA
MLAAMLTVSGPWLPARWRRWWWALLLAFVPIHLVVSAIVPARSLLGLAVG
WFVGALVILIVGTPALEVPLDGAVRSLARRGCTVTELTVLRPAGRGPLVL
STAGKHPALIELYGPNQRSGGAVRQLWRKFRLRTTETAPLHASLHRAVEH
RALMAIAIGETGVANADIVALAALDRGWTLYAHTPPRGTPLADCTTQTPV
GKAWESLRRLHDQQISHGDLRSKEMTVEHGTVLFGGFGNAEYGATDAQLQ
SDIAQLLVTTSSLYDAAAAVGAAIEHFGRTAVLAASRRLTKSAVPARLRK
AVPDAGAVMAAAREEVKRQTNTQEIQTKTITRLTRSQLIQLVLLVGLVYV
AYPFISQVPTFFSQLRNANWSWALVGLIVSSLTYVGAAGALWACTNGSVR
FRDLAIMQVANTFAATTTPAGVGGLALSTRFLVKGGLSTLRATAAVALQQ
SVQVIVHVILLVVFTTAAGARADLSHFVPSATMLYLIAGVALGLAGTFLL
VPNLRRWLTTALRPRLSEVSGDLMELAREPKRLALIVLGAAGTTLGAALA
LWASVEAFGGNTSFVTVTVVTMVGGTLASAAPTPGGVGAVEAALIGGLAA
FGVPAALAVPSVLLYRVLTCWLPVFVGWPVMRWLTANEMI
333989209YP_004521823.1 hypothetical protein JDM601_0569 [Mycobacterium sp. JDM601]MILVDTSVWIEYFRATGSAAALEVRRLLSEEPDQVVTCEPIAMEILAGAS
NEQTYRMLERLVNGLSSLGVETATDFRSAAGIYRAARSTGQTIRSINDCL
IAAVALRHHARVAHRDADFEVIEGITGLMTTSLR
333989207YP_004521821.1 galactokinase GalK [Mycobacterium sp. JDM601]MIGYSAPGRVNLIGEHTDYNGGFALPIALPQRTSVTFTPAEIDTLTVLSD
HADASVRIPLDTAPGGVTGWAAYVAGVIWALGDSGLVLPGGAMTISSDVP
IGSGLSSSAALECAVLGALTTATGVRLDRAEQARIGQRAENDYVGAPTGL
LDQLASLFGEVSTAVLIDFRDVTVHPVPFDPDAAGVTLLLFDSGQRHGHV
DGEYAARRASCERAAAALGVSSLRDVQHRGVSVLDGVGDPVDARRARHVL
TENERVLDFVAAVSELDFAAAGKLFTASHASMRDDFQITTAHLDLIADAA
VAAGALGARMTGGGFGGCVIALVPTELTLKVGDAVRSAALAAGYGEPEVS
RVYAAAGAG
333989205YP_004521819.1 hypothetical protein JDM601_0565 [Mycobacterium sp. JDM601]MTTRDRDESGRPRNARPRDRLGRPLPRGSKGGVEGVPDDLDLPPAQTLAY
AQLLLDDGLAFNAHEVLEAAWKHRPDAERDLWQGLAQLAVGVTHVQRGNV
IGAVSLLRRGADRLATVPAPVPYGIDLAGLRSFAAGLADDLAAGVEIAPQ
RLRPRLVA
333989203YP_004521817.1 serine/threonine-protein kinase [Mycobacterium sp. JDM601]MLTAGSTFAGYRIVRQLGSGGMGEVYLAEHPRLPRRDALKVLPGQVSADP
NFRERFHREADLAASLWHPHIVGVHDRGEHDGQLWIAMDYVDGPDADALL
QHHPGGLPREQVVEIVTAVAQALDYAHQRGLLHRDVKPANILLTKPGESG
DRIILADFGIGLRVDEVSGLTATNMAVGTLRYAAPEQLRGEAIDHRADQY
ALAATAYHLLTGKPPVHPDPARLDAALARALAENPAERYASCEEFAAALH
TAAPAPRPFSPPKPRRRVSKGWGLSAAALLALYLLGSTSDPEPPAPAAAP
APPTTTTSTTTVTAPPPPQVIPPPTTTTPPPSAPATTATRAAALLDSMCS
HAQLNTTATSTSGTVLRCVSGLAGYSWQADPGVTRVDSAIVGQIGWSDCL
ARYPRADCVAAAAQIAGSPERTGPVFPPGTYTIPDYMPYGTYGAGLGPGG
SCSYTVFDRHGQVVDTGSRLITLGTPTVEIDPRAEDGMFVSYGCTPWART
KPLPGDW
333989201YP_004521815.1 nucleotide-binding protein [Mycobacterium sp. JDM601]MADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTTIAWKGEETIE
LVSSTEERVKAAVEVFKEKLIRRDISMKAFDAGDPQPSGKTYKVSGGLKQ
GINAEQAKKINKLVRDEGPKGVKTQIQGEEIRVSSKKRDDLQAVISLLKG
ADLDIALQFVNYR
333989199YP_004521813.1 glycerol-3-phosphate dehydrogenase [Mycobacterium sp. JDM601]MAAATRTPKVVVLGGGSFGTTVASICSRRAPTLQWVRSESTADDINANRR
NSRYLGNEVVLSETLRATTDFAEAAHSADVVVMAVPSHGFRGVLTELASE
LRPWVPVVSLVKGLEQGTNMRMSQIVDEVLPGHPAGILAGPNIAREIAEG
YAAAAVLAMPDPHLAAELALLFRTKRFRVYTSDDVTGVEMAGALKNVYAI
AVGMGYSLGIGENTRAMVMARSVREMSKLGEAMGGARDTFSGLAGMGDLI
VTCTSQRSRNRFVGEQLGAGKPIDEIIASMNQVAEGVRAASVIMEFASQY
GLNMPIAREVDGVINHGSTVEQAYRGLIAETPGHEVEGTGF
333989197YP_004521811.1 peptidase heat shock protein X HspX [Mycobacterium sp. JDM601]MTWHPHRNTAKTFLLLLVMSGLIVLVGRAFGPQMMWLAVLFAVGMNVYTY
FNSDKLALRAMRAQPVTEVQAPEIYRIVRELATAAHQPMPRLYVSDTNAP
NAFATGRNPRHAAVCCTSGILRLLNERELRAVLGHELSHVYNRDILISCV
AGALASVVTGLANMAMFMGNRRDGNPLAMLLVALVGPLAASIVRLAVSRS
REYQADQSGAVLTGDPLALASALRKISDGVQAAPLPPEPQLASQSHLMIA
NPFRVGEKVGQLFSTHPPMADRIRRLEEMARG
333989195YP_004521809.1 FAD-linked oxidoreductase [Mycobacterium sp. JDM601]MADVVIVGAGPSGSAAAAWAARAGRDVLVVDRATFPRDKPCGDGLTPRAV
EQLELLGLGDWLDSHIRHRGLRMSGFGGDVQVDWPGPSFPSTGSAAPRTE
LDDRIRKVAEESGARMLLGAKAVDAHYDSSGRVRSVLLADGSEVSCRSLI
VADGARSTLGRVLGRQWHQETVYGVAARGYLASPRADEPWLTSHLELRGP
DGAVLPGYGWIFPLGNGEVNIGVGALATVKRPADVALRPLMSYYADLRRD
EWGFEGPVRAPASALLPMGGAVSGIAGPNWMLIGDAAACVNPLNGEGIDY
GMETGQLAAEMLDCPDLTHAWPELLAARYARGFSVARRLALLLTFPRFLP
ATGPVAMRSTTLMRVAVRVMANLVTDEDADFVARAWRGGGRLSRLIDRRQ
PFL
333989193YP_004521807.1 hypothetical protein JDM601_0553 [Mycobacterium sp. JDM601]MNKVMVAMQKLGITAGPVSVLTVPGRKSGQPRSTPMTPFTYGGRPHGVAF
PGADWASNARAAGVGTLSRGRKSRQVQIVELSAEEARPVLRVFHDEVPVG
VGFMKRTGLVQQGTPDEVEALAGRVSVFRFDPLPN
333989191YP_004521805.1 hypothetical protein JDM601_0550 [Mycobacterium sp. JDM601]MRSWLGTLVALVTFGVALAAPATAEPPGTTLAPDHFGVLAGSADAPVQLE
IFCDPQCSECAKFMADSGGELGRHLAAGDVAVTYRWMTFLDARRGNDTSA
RVGNALMAAADPANSAATYQTFVNELYRNGGTPNLEEIATTARDSGLPAH
VVDRIAAGEFAVDPTSMNAFNRVQLLAANPESPGTPTVYDLGTRTVVDTD
DAGWLDRLPR
333989189YP_004521803.1 bifunctional 2-succinyl-6-hydroxy-24- cyclohexadiene-1-carboxylate MTNPSTAQARIVVDELIRGGVRDVVLCPGSRNAPLAFALHDADRAGRLRL
HVRIDERTAGYLAIGLAVGAGAPVCVAMTSGTAVANLGPAVVEANYARVP
LIVLSANRPYELLGTGANQTMEQLGYFGTQVRATISLGLAEDAPERMAAL
NATWRSAVCRVLAAANGSRTANAGPVQFDIPLREPLVPEPDDSGSLPPGR
RGGLPWTYTPPVTFDQPLDIDLTPDTVVIAGHGAGTHPNLAALPTVAEPT
APAPQHPLHPLALPLLRPQQVIMAGRPTLHRPVSALLADPSVPVFALTTG
PRWPDVSGNSQATGTRAVTTGQPDAAWLRRCAELNASANAAVRDQLAAHP
LTTGLHVAAAVTDALRPGDQLVLGASNPVRDAALVGFAADGVVVRSNRGV
AGIDGTVSTAIGAALAFERTQTGSDPGRTIALIGDLTFVHDSSGLLIGPT
EPTPRQLTIVVSNDNGGGIFELLEQGDPRFADVSSRIFGTPHDVDVGALC
RAYHVESRQIEVEQLGAALAEPAGGMRVLEVKADRSSLRALHAAIKAAL
333989187YP_004521801.1 hypothetical protein JDM601_0547 [Mycobacterium sp. JDM601]MASGLVLACALLTGCSRVTVGLAVPADHDGPRPVAASALPDLLLEASTVS
DIMGSHEMRVKDSRSRMFDSVGQFPDRACMAAWMPVEQSVYADTEWTATY
VQTLSEASLDHFVIQAVTMFVSRDDAQSFFDATVRRWSPCGERSFTTSKD
GDVETPWTFDTVVDVDSTVWMTQHQDDSAGWSCQRALRVANNIAIDVLAC
KLYVGDEAVTIANSIDARLPSV
333989185YP_004521799.1 muconate cycloisomerase MenC [Mycobacterium sp. JDM601]MPHPSLQDLLDRVHVVALPMRVRFRGITVRELALIDGPAGWGEFGAFPEY
EPPEAAHWLAAAIEGAYQPPPPGRRDRIPINATVPAVDAEQVPDVLARFP
GARTAKVKVAEPGQALADDVARVEAVRALIPTVRVDANGGWGVDDAVQAA
HALTATGALEYLEQPCATVAELAELRRRIDIPVAADESIRKAVGSQAPLA
VAKAGAADIAVLKVAPLGGISALLQIAEQIGIPVVISSAIDSAVGIGAGL
HAAAALPELPHACGLGTGSLFVEDIAETPPQTAGYLPVRSVTPDPARLHA
LAASPQRRQWWIERITACYAHLG
333989183YP_004521797.1 hypothetical protein JDM601_0543 [Mycobacterium sp. JDM601]MRQLSSADWTMVSLDSAAAHNTIGIVGIYDPATRNEPRNGTHRGPVSYDE
VLAYVEARLHVAESFRERLVHVPFGADRPWWIRDGGFDLEYHVRHIALPG
PGSWRQFCTQIARIHARPLDLARPPWELYLIDGLDAVDHVPKGAFAVFLR
VHHAAIDGVAGAEILTALHTHEPDGEPPPPPEGYHWEPDAVPSDLELLGR
AALHGVGRPFGVLGQVGKVARQVPMLLSDNRDPELTSPASLPQATRFNQV
VSPHRVFGTAYTTLDVLKEIRTALPEAKINDIGLAIVGGAIRRYLLDKDE
LPEQAMVAMMPISIRPTATRASGDAAGTSGNEYSVAPITMATDEDDPLAR
LARIVTSTAHVKEAGAHPVRTLIEMSEEALGGLMGTVQRAAVRALSRRGR
AVAAHTLVSNVPGPLTPMYFCGAQMVDTTGLGPVLDGMGLNNGIGSYGNR
VTFCFTADRAALPDPEVYEQCLRDAVDELLAAARARS
333989181YP_004521795.1 naphthoate synthase [Mycobacterium sp. JDM601]MSSNPFDESIWRTVDGFADLTDITYHRHVTDATVRVAFDRPEVRNAFRPH
TVDELYQVLDHARMSPDVGVVLLTGNGPSAKDGGWAFCSGGDQRIRGRSG
YQYASGETADTVDVARAGRLHILEVQRLIRFMPKPVIALVNGWAAGGGHS
LHVVCDLTLASREHAKFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFF
LGRAYTAEQMHAMGAVNEVVDHAELESVGVDWARQINGKSPQAQRMLKFA
FNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDSFLEKRDPDWSRFPRYF
333989179YP_004521793.1 glyoxalase [Mycobacterium sp. JDM601]MEVLASRVLLRPADYQRSLRFYRDEIGLAIARDYGAGMVFYAGQSLIELA
GHGGSERPGAPFPGALWLQVRDIAATQAELEGRGVPIAREARREPWGLHE
MHVTDPDGVTLIFVEVPANHPLRRDTRQDKRAEPEG
333989177YP_004521791.1 transmembrane protein [Mycobacterium sp. JDM601]MNEWFNYAATGKILVFGLLVGAALPALFAVATRINVAANGGSGGVGVRRP
LLIAVSWAIFLLVLVVAVVGVLFVARDFLGHHFGWYLLGAKPQ
333989175YP_004521789.1 O-succinylbenzoic acid-CoA ligase MenE [Mycobacterium sp. JDM601]MSTLLPALQDVLDGHSAALTPVLADGDPSVLAALRVGEPVDDDVALVVTT
SGTTGAPKGALLTGTALQASAAATENRLGGPGRWLLALPPHHIAGIQVVV
RSLLAGTTPVQIDVATGFDVERLPAAVAELGSGRRYTSLVATQLAKALEA
PASTAALAELDAVLLGGGPSPQPILDAAAAAGVRVVRTYGMSETAGGCVY
DGVPLSGVRVRIGDDGRIALGGPTLARGYRNPVAPDPFAEPGWFHTNDIG
ALDSSGRLRVLGRGDDAISTGGLTVLPGPVEAVLSTHPAVADCAVFGVPD
ERLGQRVAAAVVVAGAEPPTLAALRAHIAGSLDATAAPRELHIVAALPRR
GIGKLDRKSLVRQFSR
333989173YP_004521787.1 hypothetical protein JDM601_0532 [Mycobacterium sp. JDM601]MIAESTRRWNIGRDVTAAVLLCVAPALPWSLYFGAGIPGSDTRLLAVLAA
ATVLALGSVAATYAGPWGILGADADPALAGRLRRLLSAPYLLLVLGVVVV
DVVQTIQYGGTSRPPGGVGPGAWLGVAGAVLAGQPVLAGPVRYWKRGARL
LGDVAIAGAALSVLFNLYWRVHFAVPDVHSASDFGRPHAAIIATALVYGA
VAWITVAIASRWILRRDKASQLCVVLLGGAALLAGVLVWVLPVGRLIDSF
HGIAQNTSTAGVGFEGYLVWVAAAAIFAVAAVRDASAATWLGATRNTLLL
IIIWCLGSVLMRINDLVVAVSLELPYSPYDSAAMASFDVVTAVVAIWLRI
NLANRSIPAAALWSVAAVLFGFTIARIVVGVGLAPRLPDSQRTDAVAQPV
YGNGLAQQITSTFDVMLCGLALCALLVTIVAGRFALPADDRPKPGDPGTP
RIFRTTGSTRKVRAGGPKIYRGADDSAGDESIQGSSNGSSTPS
333989171YP_004521785.1 14-dihydroxy-2-naphthoate octaprenyltransferase MenA [MycobacteriumMSQKASFAQWIEGARPRTLPNAIAPVVAGTGAAAWLGAAVWWKALLALTV
AVALIIGVNFANDYSDGVRGTDDDRTGPLRLVGSRLATPRAVLTAAIVAL
SVGALAGLALALVSAPWLLAVGAACIAGAWLYTGGSRPYGYAGFGEIAVF
VFFGLVAVLGTQYTQALRVDWVGVVLAVGVGALSSAVLVANNLRDIASDE
PAGKITLAVRLGDARTRVLFQLLVAMAGLLTFALMRATPWCAAGFIAAPL
ALRAIAPVRSGQGGVALIPVLRDTGLTMLVWAVVEAVALSVPQ
333989169YP_004521783.1 hypothetical protein JDM601_0529 [Mycobacterium sp. JDM601]MLYLLLILALGTLVYLGLRASRSRPKTRVIGPDDDPDFLWKLSQGDNQP
333989167YP_004521781.1 cytochrome C-type biogenesis protein CcsB [Mycobacterium sp. JDM601MNSTHIDVGLARYSDWAFTSALIVLVIALLLLAVELAYSRARSSAGAELV
PAGKVSADSATPGVVVPAPRRPFDERVGRAGLALVYLGIALLLACIVFRG
AATLRPPWGNMYEFINLTCFSGLLAAAVALRRPQYRSLWVFVLLPVLILL
TISGRWLYATAAPVMPALQSYWLPIHVSVVSIGSGVFLVAGVASILFLVR
STRLSDPDAPGALARMVRRLPDAQTLDRIAYRTTIFAFPVFGFGVIFGAI
WAEGAWGRYWGWDPKETVSFVAWVIYAAYLHARSTAGWRDYKAAWINVAG
FVAMIFNLFFVNLVTVGLHSYAGVG
333989165YP_004521779.1 cytochrome C-type biogenesis protein CcsA [Mycobacterium sp. JDM601MSSLTAIATTGPLLLAVAVSALAGLVSFASPCVVPLVPGYLSYLAAVVGI
DETPEPGTLKAPPATRWRVAGSAALFVAGFTAVFLLGSIAVLGMTTTLIS
NQVLLERIGGVVTIAMGLVFVGFVPALQRQVRFNPRQLSTVLGAPLLGAV
FALGWTPCLGPTLTGVIAVASATDGSGVARGVVLVIAYCLGLGIPFVALA
FGSASAVAGLGWLRRHTRTIQILGGVLLIAVGLALVTGAWGHFVAAVRDG
LVSDVRLPI
333989163YP_004521777.1 hypothetical protein JDM601_0523 [Mycobacterium sp. JDM601]MQTRIHLIRHGEVHNPDGILYGRIPGFRLSEKGRAQAVAAAEMLADADIV
AVIASPLQRAQETAAPIAARHDLPVDTDDNLIESTNVFEGKRVSPGDGAW
RNPRYWWQLRNPLTPTWGEPYAEIAARMATAVDKARSRAAGHEVVCVSHQ
LPVWTVRQHLSGNRLWHDPRRRQCDVGSVTTLIYDGDRLVDVDYRVPSGG
333989161YP_004521775.1 hypothetical protein JDM601_0521 [Mycobacterium sp. JDM601]MTIMQLPQRLARFNRHVTNPIQRMWAGWAPSFGILEHVGRRSGKPYRTPL
SVFSTLDDGRPGVAILLTYGPDRDWLKNIIAAGGGRMRRHGKTFAVSNPQ
VVTKAEAAQHVRGRAQAVFARLPFEQAVLLTRLD
333989159YP_004521773.1 hypothetical protein JDM601_0519 [Mycobacterium sp. JDM601]MVGAATSVGTFLALGLSPVATAPARADFDDLFSLDQFFDDFALADPGATA
GDTLDLGQVGTDIYTWTSVVEVVFAGLVQNQLYATIHDLGTLWMMGPGAL
IDPIINPLFAFDGACGLICDGVDGTVDHPDGGDGGWLFGDGGNGYGAGSD
ENIAAGVTGGDGGDAKMIGNGGWGGDGGASGDGGVGGTGGWLLGNGGEGG
WGGDGLDSITGPAGDGGTGGLGGDAISLFGAGGRGGDGGDGGWGNGGGDG
GHGGDAGDGGNGVAGFGGPGGSGGYGGNGGAGTEDHPSGGNGGDGGAAGN
AGDLVFMGNAGPGGFSAPGGNGGDGLAGSPDGDGGNGGHGGDGGAGGYGG
VPSHGRAAGAGGNGGAAGSWSATAGNGGDGGDGAVGMLGHPYAGESGAGG
KGGTGGAGGAGTADHPDGGTGGLGGNGGDAGSGAAATAGGAGGTGGAGGA
PAAGGAVGPGGGGGDGGNGGDGVEAGAAGAAGAGGPGNPDGPPGQPGAPG
TETG
333989157YP_004521771.1 PPE family protein [Mycobacterium sp. JDM601]MAQELSAMLSAVQAGSWQGPSAESYVAANVPYLAWLSKAGADAMALATQH
QTAAAAYTSALATMPTLAELAANHAIHAVLVATNFFGINAIPIALNEADY
TRMWVQAATTMSTYQTVAGAAVASAPAASTAPTVLNPDTPQHRDHQHRSD
QAPTQDFGNIYQQSWWTTRIAEINEAIQADLAGNNPLVSLISDPVLMTIA
PHYAGEIVLGIAPAVTSLTETMLALVAPASPLAGFAGVAGLAGLAGINVP
AAPALPAPAPPLPVAAAPAGLAAPPAPAPAAPPAMAPPTLAPAATVGGGV
PVMPPPITGAETAAFPYLVGAGPSYGAAAKMRVAAPAAAQRSQAHAAAAA
TTATASQARRRRQRETLTDPGNRYEYLDPGGIAASASGAGQLGFRGTVPH
ETRSAVTGLTTLTDSTAGPAAPMLPHTWEKPDDPAPG
333989155YP_004521769.1 glutamine-transport transmembrane protein ABC transporter [MycobactMRMLITALRDLQWRLRRFIVAAVGTAMVFALTLVLAGLTHGFRVEAEHVV
DSLGIDSYLIQTAAVGPFMGSSRFPQKEAGDVAAISGVEAALPVVYGNTI
LQDGEAPLNVNVYGVPKAAMPPITAGRAPTEPNEIAMSATLKRAVGDDVE
LGAGKLRIVGLVGKSTTLAGQPNAFLTVAGAQRLMYSGQPVASAIGLRGT
PAEVPEGYRVVDRAAAVDDMVRPLAGAQMALSYMSVLLWGVAALIVGSLI
YLSALERTRDFAVFKALGVTTGMVLAGLALQAVTVAVAAAVLGGALAVAI
GPLFPMLVAVTTSSFALLVLTAVGIGLLASLAGLRHAVAVDPVLAFGGP
333989153YP_004521767.1 hypothetical protein JDM601_0513 [Mycobacterium sp. JDM601]MSAARGGVETNWIIARPPGQTAPLRPVIALHCKDADAAWVMDLGVEEELA
QLTASGRPPFAVVAVDGGNSYWRPHGSGEDAGAMVLGELIPMLADKGIDT
SRVGFMGWSMGGYGAMLLGTRLGPARTAGICAISPAIYMTYFGAPAGAFD
SVDDWRTNSPFSLVPQLAHIPLRVDCGTSDSFYYATRSFVGQLNPPPAGG
FSPGGHDVSYWRAQLPAQLAWLDS
333989151YP_004521765.1 transmembrane protein [Mycobacterium sp. JDM601]MVSTPVVRGCAELTLAGAAALGCAVSWMHVRYLVLVAPVIDGEPATTSVT
YHPRMLLLALLLATVAGVLAVTGTARLRRARRRSEPIYPAGV
333989149YP_004521763.1 hypothetical protein JDM601_0509 [Mycobacterium sp. JDM601]MDPVEALRQIAFYKDRAREDPRRVMAYRRAADVIEALGDDERRRHGVAES
WQSLPGIGPKTAAVIAQAWAGGQPDTLVRLRDEAADLGGGVLRAALRGDL
HLHSDWSDGSAPIEEMMTTAVALGHDYCALTDHSPRLTIANGLSPQRLRH
QLEVIDGLREHFAPLRILTGIEVDILDDGSLDQEPELLERLDIVVASVHS
KLAMESGAMTRRMVRAVSDPRVNVLGHCTGRLVTGGRGRRAESQFDAEAV
FTACREHNTAVEINCRPERRDPPTRLMHLAHEVGCLFSIDTDAHAPGQLD
FLGFGAQRALDAEIAIERIVNTWPVEDLLAWATA
333989147YP_004521761.1 delta-aminolevulinic acid dehydratase HemB [Mycobacterium sp. JDM60MPGVYQHTRDSLRAAAADAVAAGVGGLMLFGVPAEADKDATGAAGIDRDG
ILNTALRELAADLGDATVLMADTCLDEFTDHGHCGVLDDRGRIDNDATVE
RYVELAVAQAESGAHVVSPSGMMDGQVAAIRDGLDAAGHSDVVILAYAAK
FASAFYGPFRDAVASSLQGDRRSYQQEPGNAREALREVALDLAQGADIVM
VKPAMSYLDVIAAAADLSPVPVAAYQVSGEYAMIAAAAANGWIDGRAAAL
ESLIGIRRAGADIVLSYWAVDAAGWLA
333989145YP_004521759.1 porphobilinogen deaminase [Mycobacterium sp. JDM601]MLATTQAGTVRDALVAAGHPAELVMISTIGDRSSGPIADLGVGVFTAALR
EAILDGRVDAAVHSHKDLPTADDPRFLLPAVPAREDPRDALVARDGLVLG
ELPAGARLGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLNRVSSGELDAI
VVARAGLARIGRLDAITETLEPVQMLPAPAQGALAVECRAGDTGLAALLA
ELDDTDTRQAVTAERTLLAELEAGCSAPVGAIAEVVESIDEDGRVFEELS
LRSCVAALDGSDVIRASGIGSPDRARELGVSVAAELFELGARELMSDAR
333989143YP_004521757.1 hypothetical protein JDM601_0503 [Mycobacterium sp. JDM601]MQLLTRDGCAVCVKVHDQLAQLAAELGFDLRTTDVDAAARAGDTAMRAEF
GDRLPVVLLDGREHSYWEVDEARLRADLAGR
333989141YP_004521755.1 phosphoserine phosphatase SerB1 [Mycobacterium sp. JDM601]MMALPGPTDGDSAAGPELEPVVGGDFAASAERALADVLDADTPAPVDLTA
AAFFDVDNTLVQGSSMVHFGRGLAARNYFTYRDVVGFFYAQAKFQLTGRE
NSEDVAAGRRKALAFIEGRPVSELVELGEEIYDEIIADKIWPGTRELAQM
HLDAGQQVWLVTATPYELAETIARRLGLTGALGTVAESADGVFTGRLVGE
ILHGPGKAHAVRSLAIREGLNLRRCTAYSDSFNDVPMLSLVGTAVAINPD
AALREMARKRGWEIRDFRTARRAARIGVPSALALGAVGGALAAAVAHRNE
RA
333989139YP_004521753.1 hypothetical protein JDM601_0499 [Mycobacterium sp. JDM601]MAGDSRAKVIPLHKNSASARRHPSTLARPDDRGSAEQISAVVRDIDGRRG
VAAGASGDAEAAPSEFVRRVAGLAAFLRERITGDYHVDEFGFDPHFNEAV
ALPLLRVFFNDWFRVEVSGIENLPADGPALVVANHAGVLPMDALMLSVAV
HDHHPGRRDLRMLGADLVFDLPVIGPAARKAGHTMACTADAHRLLAAGEL
TAVFPEGYKGLGKRFKDRYKLQRFGRGGFVSAALQTQAPIVPCSIVGSEE
IYPMIADIKLLARLLGVPYFPITPLFPLAGPAGLVPLPSKWHIAFGEPIE
TTDYEPAAADDPMVTFELTDQVRETIQQTLYRLLAGRRNMFFG
333989137YP_004521751.1 hypothetical protein JDM601_0497 [Mycobacterium sp. JDM601]MPDVASRAVVRGSGLVHPASLTASPEKQYRGDRPSPARDPGAGSAELLTE
FSALHPGTAKQLAVLLLRHALAPLLDD
333989135YP_004521749.1 pyrroline-5-carboxylate reductase ProC [Mycobacterium sp. JDM601]MTRIAIIGGGNMGEALLAGLLAAGRPVKDLVVAERFGDRARQLSEKYSVL
VTSVADAVENASIVIVAVKPQDVESVVAEFAKNLTAASENSPEQVLVSIV
AGVTTGYVESKLPAGTAVIRVMPNTPVKVGAGASALAKGRFASSEQVEQV
AELFECVGTVVIVPEEQMDSVTAVSGSGPAYFFLMVEALVDAGVAAGLSR
QGATDLAVQTMAGSAQMLLEERGETAGTANSVIDTGPAQLRAMVTSPGGT
TAAALRELEAGGLRTSVDRAVRAAKTRSEQLRITSE
333989133YP_004521747.1 hypothetical protein JDM601_0493 [Mycobacterium sp. JDM601]MRPAIKVGLSTASVYPLRAEAAFEYAARLGYDGVELMVWGESVSQDIGAV
QRLSRKYRVPVLSVHAPCLLISQRVWGANPIHKLERSVRAAERLEAQTVV
VHPPFRWQRRYAEGFSDQVSELEARSDVAVAVENMFPFRADRLFGADQSR
ERMRRRGGGPGAAISAFAPSHDPLDGNHAHYTLDLSHTATAGTDALEMAR
RMGAGLTHLHLCDGTGLPADEHLVPGRGDQPTVEVCHLLAASDFTGHVVL
EVTTSHARSPHEREALLIESLQFARTHLLR
333989131YP_004521745.1 hypothetical protein JDM601_0491 [Mycobacterium sp. JDM601]MVDAYRGGHPTPMSSTKATLRLAEATDSSGKITRRGADKLVSTIDEFATI
AGSSGCAELMAFATSAVRDACNSEDVLARVRTETGVELQVLEGEDESRLT
FLAVRRWFGWSAGRIINLDIGGGSLEISSGLDEEPEVALSLPLGAGRLTR
EWLPEDPPGRRRVSMLRDWLDTELAPAAATVLDAGPPDLAVASSKTFRSL
ARLTGAAPSAAGPRVRRTLTAAGLRQLISFISRMTTADRAELEGVSAERA
PQIVAGALVAEASMRALSIETVQICPWALREGLILRRLDREADSATLLQS
SSVGIARQRGGAR
333989129YP_004521743.1 ABC transporter ATP-binding protein [Mycobacterium sp. JDM601]MVLEARKLNKQFGHGDTATPVLRNVDIQITRGEFVAMVGPSGSGKSTLLS
ILGLLDLPTSGDVLINGHSVSQLSRRQLAAVRCQTLGYVFQAFNLLAGLS
VVENVMLPGLLAGKSGRSQHAHAMGLLDQVGLAAKSKRVPSELSGGEQQR
VAVARALFMKPDVILADEPTGNLDTVNGQRVIDALYNLNAAGQTIVLVTH
DRKIADDAPRLVSLLDGEIETDSGMAHAPDNVTWLAGH
333989127YP_004521741.1 oxidoreductase [Mycobacterium sp. JDM601]MPGFSGEVIAPSDARYDEVRQVFNGMIDKRPRVVLQCRSTDDIVAAVRYA
VAAGAEIAVRSGGHSVAGHSATDGGIVIDLTLMRGVRVDAQARIAYVDAG
ATWGDVDPVTSRHGLACPGGVVSTTGVGGFSLGGGIGWLSRAHGMTCDNL
IGATLVTASGNVLTVSETEHADVLWGLRGGGGNFGVVAQFVLRLHPVNAV
TAGVQSYPDTDAEAALKHFRAQMDNAPDHLASILDFSTDFTTGKTLVNVL
ACSTRTDSIGSNDVSALLDVRGVAAKPVVAVQHTLDYSTWQQALDYTAPY
GWLNYWKSLFVTELTDEAIRRIALLGRSRPSTQTRLHLIRLGGYASRVPP
ESTAVVARDHPYIVHLMTTWTDPADTARCTAWAGQAFEILRPLGPASAYL
NFVGDEGQDRIRATFGDAGYQRLAELKARLDPENRFTLNHNIEPAD
333989125YP_004521739.1 amidase [Mycobacterium sp. JDM601]MALYLDRIARLDPVLNVFRTVLGDRAMDEAAHIERRLAAGEVLPLAGVPI
AVKDDTDVAGVSSMCGTGIDVGPASTDSAAVRRLRAAGAVIIGKTHLSEF
GAYPVCESATWGVTRNPWDLYRTPGGSSGGSAAAVASGMVPGATGSDSGG
SVRIPAACCGLVGLKGQRGRISTKESPERAYRFHGLNHIGPLARSVVDTA
LLHDAMTGPEPDDEIPSPPSAPPLMDALVAPTRRLRIAMSFKPVVPVHVS
DEVRRPVLETAELLRSLGHDVVERDPVYPVVGIAAVLALFMNGFADEIDR
LPKTELLERRMQAEARTSRLVPDWLARRAVAAEPRITARSQRRIADFDVL
MTPVLAIPPVRVGYFEGFGPTRAMLRMLKFIPFTFPQNYSGQPAISVPTG
IDAAGVPEAVHLVGRANDEATLISLAAQLESVRPWAQHRPPTEALLSQVG
333989123YP_004521737.1 hypothetical protein JDM601_0483 [Mycobacterium sp. JDM601]MASLAAVEAAYDRLESCSFDALSAEELVEVLARREALAWRAPSIDHQIVA
RFVAEGHSEVLAGCSLAKALSERLRISSAEARRRVAEAADLGPRTAMTGE
TLEPVLPSLAAAQAAGLVGPEQVAIARKAMEKIPARVATADRERAERELA
ELATLFAPEAFQRLAVHLIAVLDQDGDEPDDRERQAQRGLRLGPQRADGM
STLSGKISPELRATLEPVLAKLAAPGMCNSADEQPCVSGTPSQEQIQNDH
RSRDHRQHDALLAALRAVLACGDLGQLNGLPVTVIVSTTLAELQAAADHA
PHTDQPRPEPAPPVGEPRITGKAYTAGGSLLPMSDLLRMASHAYHYLTIF
DGKGRALWLGRTKRLASADQRIVLHNRDRGCTRPGCTVSGYLSQAHHLER
DWADNGQTDVDDLALACAPDNRMASEQGWTTRLGETGRVEWIPPPKLDHG
QPRVNPFHFIEAVIDYHRRPPPAELPPPDAAWPWPDAPVSDDPLFDEASY
EAVPVEGSVQRHVFADDDWQKAG
333989121YP_004521735.1 amino acid adenylation protein [Mycobacterium sp. JDM601]MTDGPDGPIDISGLSPAQKRELLAALLTAKAQQQTTEHQLSYGQRSMWFV
HRLAPDSAAYTVAYAGRVAARLDVPALERAAQALVDRHPMLRTTYAERDG
QPIGLVHAHWPVRIDTHRIGADPAELQQWIQAETDRPFDLRNGPVLRLTL
LERPDDHVLLLTVHHIAVDFWSIDVILDELRGLYAHGHGAAMPEATADRY
VDYAAQQTAMLNGPEGERLWEYWRGAMSGELPTLALPTDRPRPAVQTYVG
ALHRFSVDAAVSAGIKQVARTAGATPYMTLLAAYAVLLHRYSGQDDLVIG
SPFACRDRAGLMGMVGYVTNPLPLRVDVGDDPSFAALLGQVKDTVLGAIA
HQEFPLPLLVERLRPARDAGRTPLFQVSFAWQQVRLFDENTANAAGSDAV
LPLETLYIGQGGSPFDITLQVGEHEDQLQLALQYNTDLFDAATMDRMGEH
FRLLLEGIAADPNTPVSRLPLLTDAERARLQSWNDTAVDYPDAPASLHDM
VAAAAARTPDAVAVSYDGRELSYADLDRRSNGLAHRLRGFGVGAGADTDV
VPVLLERSEDLVIALLGVLKAGGVFLPLDPAQPVRRMEAMLADVPDAPVC
VTRRDQLTCVPTDFTGARLCLDQPSAAPAEADSAPEVTAAELAYLMYTSG
STGTPKGALNTHAGIRNRLLWMQDAYRLTAEDRVLHKTPINFDPFVWEIF
WPLIVGARVVIAKPEGHKDAGYLARIIAEQQVTTMHFVPSMLRRFLAEPE
AASCTGLRRVFCSGEALTADLRDAFFEVLPAELYNLYGPTEAAIDVTHFH
CVRGETEPVIPIGRPIANIAIHLLDAVGNPVPVGVPGELCIGGVGVARGY
LNRPEATAAAFGDDPFSAVPGALLYRTGDLARYRACGNIEYLGRRDDQVK
INGFRIELGEVEAALANHPGIAECAVVARKDSSGNTQLIAHIVPVAALPG
TAELRRFLLELVPAAMVPAVFRATDLLPLSPSGKVDRRALLALDADLEAA
PKEFVAPRDATEEALAQIWREVLDVDRVGVTDDFFALGGASTQALEVAVR
VGELGMELRPESMFVYGTIAELAAEFGPIGGAAKADQPAEQPAATPQPAV
VAPQRVPAAQPAPAPVITPAQAGPSRNVVIESLGVYLPPRAVSTEQVLAD
CVNEVKIPLERLTGIKNRRMAGVDEFSIDLGRKAIADCLSRSSYAPEEID
LVIACNISRCDGPEHMFTFEPSTASQLRDELGLTNAVCFDINNACAGMFT
GVSVAQDFLKTGLVRNALVFSGEYISHITETAQQEIEGAMDPRLACLTVG
DAGAAAVLELGAGDRVGFHDLDLATYSEFAKLCIAKATEGPHGGAIMVTD
SVTQTAIAVKHSVPYVAAVMQRHGWRPETADQLLMHQTSEASINDAILTI
NRVFGAGAASRANTICNLAERGNTATTTHFVALYDYINAGRINSGDNVVL
SITGSGQTIGTGLYTFDDLPDRMRRAGNGQAGQPARGTRSRRRELPATPR
VRIEGIGIAVPDLGAAGPQPSSIQFAVDAAAACLDDSGVERTDVGLVIHT
GIYRDDFLSEPAVATLVAGEVGINAEPESADAPKTFAFDILNGAVGFLNG
CHVAAGMIGAGRTGHAMVLASEVENNTPQSGYPRAGITETGSAIMLSPSA
GPEGFGRFVFAHHPEYRGALRTYTQERDGRMWLRVDRDPNLAAIYVSCLP
SAVKELLTLESLEPEDISLVFPPYLPGTALDELAAGIGVDRSRFVDLAAQ
GCTSDPFTSTLAYQIADARQRGLTKPGDVALIMAVGSGVEVGCTTYRF
333989119YP_004521733.1 two-component sensory transduction protein RegX3 [Mycobacterium sp.MTHVLIVEDEESLADPLAFLLRKEGFEATVVTDGTAALAEFDRSGADIVL
LDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVT
KPYSARELIARIRAVLRRGGDDEGGVGEGVLESGPVRMDVERHVVMVNGE
QITLPLKEFDLLEYLMRNTGRVLTRGQLIDRVWGADYVGDTKTLDVHVKR
LRSKIEADPANPVHLVTVRGLGYKLEG
333989117YP_004521731.1 phosphoglycerate mutase 1 Gpm1 [Mycobacterium sp. JDM601]MSDTATLVLLRHGESEWNASNQFTGWMDVNLTDKGRTEAVRAGHLLVEHD
LLPDVVYTSLLRRAITTANLALDAADRHWIGVHRTWRLNERHYGALQGLD
KAATKARYGDEQFMTWRRSYDTPPPPIEPGSRYSQDTDSRYADIGGGPLT
ECLADVVARFLPYYTDVIIPELRSGKTVLIAAHGNSLRALVKYLDGMSDE
AVVGLNIPTGIPLRYDLDSELRPKLAGGVYLDPEAAAAGAAAVASQGAK
333989115YP_004521729.1 mannosyltransferase [Mycobacterium sp. JDM601]MGRGFGSDVRRVAVLSVHTSPLAQPGTGDAGGMNVYVLQSALHLARRGVD
VEVFTRATSSADPPVAHVAPGVLVRNVVAGPFEGLDKNDLPTQLCAFAAG
VLRAEAAHEPGYYDVVHSHYWLSGQVGWLAADRWAVPLVHTAHTLAGVKN
AALAAGDSPEPPMRSVGEQQVVDEADRLIVNTEDEADQLVALHGADPAGI
DVAHPGVDLEVFRPGDKRQARAALGLSPDEPIVAFVGRIQPLKAPDILLR
AAAELPGVRVVVAGGPSGSSGLAAPGGLVRLAADLGISDRVTFLPPQSRE
DLATLFRAADLVAVPSYSESFGLVALEAQACGTPVVAAAVGGLPVAVRDG
VTGRLVAGHGIEAWATAIDDLLRLGSGPRGWAMRRAAVAHAATFSWERTV
DAQLASYTNAIEDFAAARGERMRVVGAARRPRRWPARKGARA
333989113YP_004521727.1 short-chain dehydrogenase [Mycobacterium sp. JDM601]MIAVARRADRITALAQQIGGTAVVADVADQAAVAALAEECDRVCDSLSGS
INVLVNNAGGALGLAPVSEADLEHWRWMWETNVLGTLQVTRALLPKLIDS
GDGLIVTVTSIAAFEIYDGGAGYTAAKHAQSALHRTLRGELLGKPVRLTE
IAPGMVETEFSLVRFDGDRERADAVYAGLTPLTAADIADVIGFVASRPPH
VDLDQIVIRPRDQASATRKVTRASRRAE
333989111YP_004521725.1 UDP-N-acetylenolpyruvoylglucosamine reductase MurB [Mycobacterium sMAGSEFAGARVAEAVPLAPLTTLRVGPVARRVISCADTEQIVATLAALDR
DGGRPLLLSGGSNVVIADDLTDLTVVLLASDGIEIEGNLLRAQAGAIWDD
VVAAAVAAGLGGLECLSGIPGSAGATPVQNVGAYGAEVADTLTRVLLLDR
STGIVRWTPPAELNFGYRTSVLKHSDAGVVLEVEFELDPAGRSAPLRYGE
LATALGAGDGDRADPAAVRAAVLALRSAKGMVLDAADHDTWSVGSFFTNP
VVPHDSYRQIAESQAGPVPHWDAPGGVKLAAGWLVERAGFGKGYPGEGAV
ARLSSKHALALTNRGGATTGDVLSLARTVRDGVHDTFGIILHPEPVLVGC
AL
333989109YP_004521723.1 amidohydrolase [Mycobacterium sp. JDM601]MRIACAQILSGTDPAANLELVADYTERAAGQGAQLVVFPEAAMCRFGVPL
GPVAEPLDGPWATGVREIADRAGVTVIAGMFTPADDGRVRNTLLATGPGI
DSHYHKVHLYDAFGFTESRTVAPGFDPVVIDVEGVGVGLSTCYDIRFPAL
YTELADRGAQLIAVCASWGAGPGKLRQWELLACARALDSTSYVAAVGQAD
PGTAGPATSSGAPTGVGHSLVASPWGEAVASAEAAPQLLVCDIDLDVVTT
ARRTLAVLSNRADFVQVGKAESRG
333989107YP_004521721.1 hypothetical protein JDM601_0467 [Mycobacterium sp. JDM601]MMSTSGAANPKHRFTGLPAVLLALTVLLVLAVVALFGGQAYATHRAKSLV
ADAVQCEADDSATVSFASDPPVLAQYLRGDYPHISVQTAGNQIRKAKGMQ
LDLDIRDVHVQKSADSKGTIGSLDGTITWPADGIKQSIQDVVPVIGSIVT
GKVSTDPAAGTVELKGLLNRATVKPQIVDNGLHLEVVDLEALGKDLDSET
VQRNLDDLTGKVTGDLPLGIHIDSSQVTDSGVVVKFSTRNATIPASSSSQ
CFARL
333989105YP_004521719.1 hypothetical protein JDM601_0465 [Mycobacterium sp. JDM601]MLRSILFAALAAELVVAAPAAADTGFVDRTEWVSYSSGSGLASLRVYPTP
AGRAAAARVDAAAEGEQAWREVLAAAPDADTVSMRDQFRCHWNYAEFARP
GKTSWNLEPWRPVVDGVTMLESGCNPGAEEEAF
333989103YP_004521717.1 iron-regulated heparin binding hemagglutinin HbhA [Mycobacterium spMAENPNIDELKAPLLAAIGAADLALATVTDLVATLRERAGEAREDATTRV
EESRARLTKLQEELPEQFAELRERFTADELRRAAEGYAEAASGRYSDLVA
RGEAALVRLRNQSGLDDASAQVEGYVDQAVELTQEVLGNVATQTREVGER
AAKLVGIELPQKEEAKTASPAKKAPAKKAPAKKASASAAKKASPAKKAPA
KKVTQK
333989101YP_004521715.1 transmembrane protein [Mycobacterium sp. JDM601]MQSLAESFADADPAADAVRLRDLRRMKVVALSFLLGATVVFLLCRWAQAD
SAAHGGVGPWVGYVGAAAEAGMVGALADWFAVTALFKHPLGIPIPHTAII
KRKKDQLGEGLGTFVRENFLSPPVVETKLRDAQVAGRLGKWLSEQTHAER
VAAETATVLRVLVELLRDEEVAYVIDRMIVRRIAEPQWGPPVGRMLGTLL
AEHRQEALIQLLADRAFQWSLNAGEVIQRVVERDSPTWSPRFVDHLVGDR
IHRELMDFTDKVRRNPDHELRRNATRFLFEFANDLQYDAATIAKADSVKD
QVMAREEVAKAAATAWATLKRYVLEGVDDPTGALRTRVAAAVVQIGESLR
DDVELRDKVDNWIVRAAQHLVAQYGVEITAIITETIERWDAAEASRRIEL
HVGRDLQFIRINGTVVGALAGLGIYAIAQLMF
333989099YP_004521713.1 3-hydroxybutyryl-CoA dehydrogenase [Mycobacterium sp. JDM601]MSIQRVGVIGAGQMGAGIAEVSARAGVGVKVFETTDALVTAGRNRIVKSL
ERGVSAGKITERERDDAVGNLTFTTDLGELADRQLVIEAVIEDDTVKSKI
FAELDRVITDPDAVLASNTSSIPIMKIAAATANPQRVLGLHFFNPVPVLP
LVELVSTLVTDSAAAARTEQFASAVLGKQVVRCSDRSGFVVNALLVPYLL
SAVRMLESGFATVEDIDKAIVAGLSHPMGPLRLSDLVGLDTLKLIADKMY
EEFKEPLYAAPPLLLRMVEAGQLGKKSGRGFYTY
333989097YP_004521711.1 hypothetical protein JDM601_0457 [Mycobacterium sp. JDM601]MLDLLGALRRANGRHGYSFWSRSSGASRICQTPRRIHWCVNATLAQHIRP
GPLVFVAKFGKTVRSLCEVCEESLGGPVVVAVE
333989095YP_004521709.1 transcriptional regulator [Mycobacterium sp. JDM601]MAKTYVGARVRQLRSERGFSQAALAQLLEISPSYLNQIERDVRPLTVAVL
LRITEVFGVDATFFASQDDTRLVAELREVTMDRDLDIDVDLTEVAELVSV
HPKLARAMVNLHRRYRITTAQLAAATEERYTDGSGTGAITMPHEEVRDYF
YQRQNYLHELDTAAEELATRMRRHQGELAVELANRLTEVHGVHINRRIDL
GETVLHRYDAQTKTLDMGHHLSWGQRVFKMAAELAYLEFDDLICAMVEEG
KFTSKDSRTLARLGLANYFAAAIVLPYGQFHDSAETFRYDIERLSAFYRV
SYETIAHRLSTLQRPSMRGVPFSFVRVDRAGNMSKRQSATGFHFSSSGGT
CPLWNVYETFGNPGKIGVQIAEMPDGRKYLWVARTVERRASRWGQPDKTF
AIGLGCELRQAHRLVYSEGLDLNGDNATPIGAGCRVCERDNCPQRAFPAL
GRDLDLNEHRSTVSPYLVKQQR
333989093YP_004521707.1 hypothetical protein JDM601_0453 [Mycobacterium sp. JDM601]MADTVWHDLAVAGGGTLAIAAVLIVVGRMLLRRGAGPLVTRKIPHALCGL
FAAAAAFELTNKAVVAGVLAAATVALAFIVERGLVPVPGVFDGTRSRDYG
LVGFAGGALIAVLAFWPDRVAIATGVVVLGLADAGAALVGDRFGRHRVAA
GGGVRTLEGSVAFVAIAFAVSLTLCLAALELNSFMAVTVSLFVAVSTAAV
ELLVVPAADNLLITPWVALLLHVARDLSTDDALRWLAAVVFGCAIVPFMI
RMRWLDLPGALCGGLIAGVAVGLGGWAWIIPAAVFFSLTSVLTAYRRPGR
ASSMRGMSQVAVNAGLPVLVPVVGFAFTRDPLWYAVSIGGIAAGIADSWA
SEIGRFSGREPLSLRTRGRVPKGTSGAVSPLGSAATVLGALLVGAFGALF
GGPAMVPVGLAAGIAGSLVDTVIGATAQARFRCESCGATVEDALHCGRPT
EPSAGWRWVGNDVVNAGANLTGMLVGCAVYLLLAA
333989091YP_004521705.1 methoxy mycolic acid synthase [Mycobacterium sp. JDM601]MADPTSSAPKMAVAYEDVQAHYDISNDFFSVFQDPTRTYSCAYFEREDMS
LEEAQLAKIDLALAKLDLAPGMTLLDVGCGWGSAMRRAIETYDVDVVGLT
LSRNQCSLGQRLLDDVDTDRSRRILLRGWEEFDEPVDRIVSIEAFEAFPK
ERYAAFFELCHRLMPRDGRMVLQTIMGHPLKRWPEMGIPITMTDLRFMRF
IAKEIFPGGSVPCDDDVIEYSAAAGFSVADRHDLTPDYVRTLDTWATRLQ
AAREQAIAATSPEVYDRYVKYLLGCADFFQRNISYVAQFTLAKGN
333989089YP_004521703.1 hypothetical protein JDM601_0449 [Mycobacterium sp. JDM601]MASKNITLTMPAELVRRAKVLAAQRDMSVSSLVARLLEQLVGEVADYDDV
ADLERRMMSGVAGLQVGPITWSRDDLHER
333989087YP_004521701.1 transmembrane protein [Mycobacterium sp. JDM601]MSETTDTGALPMTEPHMAPIFDTGPHPAPLPGLSGELEPQPGLEARPEPE
PIGPESKAGPAPAKPPKPVVVEGQYRFLKWWQFALVLVGVWIPAAGIGLG
LFSWWYALADKTPAVFVVVVYAAVCVVAGLIVAMVGEKPLLSAVALALMS
AVFASAVAAAPLYGHYFCQHVDRCVGGIIPY
333989085YP_004521699.1 hypothetical protein JDM601_0445 [Mycobacterium sp. JDM601]MGAPERVRITEAAAELLARLVARHGPVMFHQSGGCCDGSAPMCYPDGDFI
VGDHDVLLGVLDVAGGGVPVWISGPQFGAWKHTQLIIDVVPGRGAGFSLE
APEGLRFLSRARAFTDHENAALEEVPVITGSLPR
333989083YP_004521697.1 peptidase [Mycobacterium sp. JDM601]MAVMADDPTTDPYLWLEDVTGDDALDWVRAHNAPTVDEFAGDDFEAMRTA
ALEVLDTDARIPYVRRRGDHLYNFWRDAANPRGLWRRTTLDSYRSGAPEW
DVIIDVDELSRVDDRNWVWGGANVIEPELTRALVSLSPGGSDAAVVREFD
MATREFVPPAAGGFQLPEAKSRIGWENEDTVLVGTDFGPDSLTDSGYPRI
VKRWRRGQPLADAETLFAGEATDVVVGAGRDRTPGFERTLVSRAVDFFND
EVYELRGGPGGQELIRIDAPTDASVSVHRQWILIELRTDWDTGTASYAAG
SLLAADYDEFLAGTAQLSVVFEPDAHTALHHYAWTRDRLVLVTLHDVASR
VEVVSPVDWQRRPVAEVPANTNTVIAAADDTGDEIFLDSSGFNSPSRLLH
GPVDGPLTEIKSAPAFFDAEGLEVSQHFATSKDGTAIPYFVVRPQDATGP
TLLGGYGGFEVARTPGYDGVLGRLWLARGGTYVLANIRGGGEYGPGWHTQ
AMREGRHLVAEDFAAVAADLVGRGITTVAQLGAVGGSNGGLLMGIMLTAY
PQQFGALVCQVPLLDMRRYHLLLAGASWMAEYGDPDNPDDWAFIGEYSPY
QNISASADYPPVLITTSTRDDRVHPGHARKMTAALEELGKKVWYYENIEG
GHGGAADNAQAAFKSALSFSFLWRMLGGRG
333989081YP_004521695.1 hypothetical protein JDM601_0441 [Mycobacterium sp. JDM601]MRFLTAALFWLLATVTLAVTLPTAWAQCNLVDADGYARLAQRAAAQPALQ
DAVAAELSSQAVRLIRAQGFPINPAPVREAAAEYTAGPSFPAQFVKLNRD
GHDWLLSGDDTGPWEIDVVPMLRDKAFAQLLGDYNVALPASMTVPLTPTS
TEVTRPGGLHRFAVWGPSLSLVLVALTGLCAALTIAAARHRGRALASLGV
SGLLVGAAGWSGIEVARRYLNQVLNQATGDIRRIADAVADVAEASLHQWL
NVTLAAGAVMVLVGVAVALLGAMRR
333989079YP_004521693.1 hypothetical protein JDM601_0439 [Mycobacterium sp. JDM601]MTDAALQGLLRDAFTRLVEHADEVTEDLTDAVATYRPTPEANSIAWLLWH
SARVQDIQVAQVAGVEQVWTRDGWVDRFGLDLPRDDSGYGHSAADVAKVH
APAQLLAGYYRAVHELTLRYLDGVTADELARVVDTHWDPPVTAGVRLVSV
LDDCAQHLGQAAYLRGLKG
333989077YP_004521691.1 D-amino acid aminohydrolase [Mycobacterium sp. JDM601]MTHVAELVIRNGMIVDGLGGQTYVGDVAVRDGLIVEVGTVSGDAEHVIDA
AGLLVTPGFVDLHTHYDGQSIWSDRLNPSSSHGVTTALMGNCGVGFAPCR
IADHEVLVDLMAGVEDIPGVVMTDGLPWTWETFPQFMDTVDSQQRDIDVA
AFLPHSPLRVYVMGQRGVDREPATPADLARMRELAQEAAEAGALGFSSSR
LVTHRTRTGSQIPSYGAAYDEILEIGRGIADGGGGLIQFVPDLPDGAYQP
VLQQVFDAATDAGLPVTFTLLIGNAGEPVWQDALTMVEKANGSGAAITAQ
VFPRPIGLMVGLDLSINPFVLYPSYREIAGLPLAERVAEMRKPDVRQRIL
ADRASIAPTNPIAYLAQSWEWTYPLGDDADYEPDPSKSIAARARARGVSP
LEEAYDRLLDDDGHAILLDALANFRDNSLDTVGTLMHREDVVLGLGDGGA
HYGMICDSSFPTYVLTHWARDRGSGRLSVPEAVRELTSTPARVAGLGDRG
RIAVGYKADLNVIDHQNLRLHKPVITYDLPAGGRRLDQTADGYVATIVAG
EIIAEHGKPTAARPGKLVRGRQPAPA
333989075YP_004521689.1 hypothetical protein JDM601_0435 [Mycobacterium sp. JDM601]MEFRYLGNSGLQISEITYGNWLTHGSQVENDVATACVHAALDCGITTFDT
ADVYANGAAEEVLGAALKGQRRESLEIFTKVYWPVGPAPLGKNDTGLSRK
HMMEAIDSSLRRLGTDYVDLYQAHRYDSFTPLEETMQAFADIVRAGKALY
IGVSEWAPDQIRQAHGLARQLGISLISSQPQYSMLWRIIEPEVVPVCREL
GLSQIVWSPMAQGVLSGKYQPGQPPPAGSRATDEKGGANFVKRFMTDDVL